Protein Family IF10087
Metagenome
Isolate
143
Members
92
Samples
101
Scaffolds
326.93
Avg Length
Representative Sequence
- ID
- 3300042654|Ga0466725_332846|Ga0466725_332846_27347_28456
- Length
- 369 aa
- Sequence
- VLLNWYRNLQNLNKKMNYLITGGSGFIGSHLAEHLLKSGHFVINIDNFDDFYDYKIKIENTLESIGKSPKFQYSDKETDIQKLISETKSDNYILYYQDIRDIFGLRKIFENHKIDLIIHLAALAGVRPSIQKPLEYEEVNIRGSMNLWELCKEFNIKKFVCSSSSSVYGNNEKIPFSETDNVDKPISPYAATKKCGEILGHVYHHLYKIDMVQLRFFTVYGPRQRPDLAIHKFSKLILENREIPFYGDGSTSRDYTFIDDIIDGVLKSIKYLEQHENVYEIINLGENEVINLNQMLSEIEENLGKKAKKNILPMQAGDVPKTNADITKAEKIIDYRPNTKFNIGIKKFMAWFLEKTDNVQRKGFLPNLE
Sample Types
Isolate
29.4%
Metagenome
70.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
25.0%
Unclassified
20.5%
Kalotermitidae
12.5%
Elmidae
8.0%
Culicidae
5.7%
Scarabaeidae
4.5%
Formicidae
4.5%
Pyralidae
3.4%
Drosophilidae
2.3%
Apidae
2.3%
Passalidae
2.3%
Rhinotermitidae
2.3%
Calliphoridae
1.1%
Cambaridae
1.1%
Tenebrionidae
1.1%
Aphididae
1.1%
Termopsidae
1.1%
Noctuidae
1.1%
Taxonomy
Archaea
1
Bacteria
138
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 2 | 2508501067 | Opitutaceae bacterium TAV1 | Isolate | Unclassified |
| 3 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2837204985 | Lysinimonas sp. 2DFWR-13 | Isolate | Scarabaeidae |
| 11 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 12 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 13 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 14 | 2820096063 | Unclassified Proteobacteria Lab288P3bin136 | Isolate | Unclassified |
| 15 | 2820106212 | Unclassified Proteobacteria Emb289P4bin44 | Isolate | Unclassified |
| 16 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 17 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 18 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 19 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 20 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 21 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 22 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 23 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 24 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 25 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 26 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 27 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 28 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 29 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 30 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 31 | 2912849059 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 32 | 2209111004 | Macrotermes natalensis queen gut microbiome | Metagenome | Termitidae |
| 33 | 2820602899 | Unclassified Firmicutes Emb289P1bin51 | Isolate | Unclassified |
| 34 | 2820457604 | Unclassified Firmicutes Lab288P3bin15 | Isolate | Unclassified |
| 35 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 36 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 37 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 38 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 39 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 40 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 41 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 42 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 43 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 44 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 45 | 3300005309 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut | Metagenome | Drosophilidae |
| 46 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 47 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 48 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 49 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 50 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 51 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 52 | 2820052737 | Unclassified Proteobacteria Th196P3bin127 | Isolate | Unclassified |
| 53 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 54 | 643886085 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 55 | 643886091 | Bacillus thuringiensis sv. thuringiensis T01001 | Isolate | Pyralidae |
| 56 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 57 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 58 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 59 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 60 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 61 | 2820100407 | Unclassified Proteobacteria Lab288P1bin48 | Isolate | Unclassified |
| 62 | 2820137450 | Unclassified Proteobacteria Emb289P3bin120 | Isolate | Unclassified |
| 63 | 646311952 | Sebaldella termitidis ATCC 33386 | Isolate | Unclassified |
| 64 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 65 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 66 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 67 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 68 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 69 | 2841168549 | Agromyces protaetiae FW100M-8 | Isolate | Scarabaeidae |
| 70 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 71 | 2820075487 | Unclassified Proteobacteria Nt197P3bin122 | Isolate | Unclassified |
| 72 | 2820111668 | Unclassified Proteobacteria Emb289P4bin34 | Isolate | Unclassified |
| 73 | 2820141685 | Unclassified Proteobacteria Emb289P3bin118 | Isolate | Unclassified |
| 74 | 2998929858 | Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 | Isolate | Aphididae |
| 75 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 76 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 77 | 2883683260 | Protaetiibacter larvae KACC 19322 | Isolate | Scarabaeidae |
| 78 | 2706794701 | Opitutaceae bacterium TSB47 | Isolate | Rhinotermitidae |
| 79 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 80 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 81 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 82 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 83 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 84 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 85 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 86 | 3300003097 | Cutworm gut microbial communities from Hangzhou, China | Metagenome | Noctuidae |
| 87 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 88 | 2820918931 | Unclassified Actinobacteria Emb289P3bin56 | Isolate | Unclassified |
| 89 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 90 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 91 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 92 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466701_031837 | 3300042598 | Bacteria | 1220 |
| 2 | Ga0466724_07109 | 3300042649 | Bacteria | 285871 |
| 3 | Ga0415639_006574 | 3300038395 | Bacteria | 19511 |
| 4 | Ga0123355_10017689 | 3300009826 | Bacteria | 11273 |
| 5 | Ga0123353_10030893 | 3300010167 | Bacteria | 8286 |
| 6 | Ga0123353_10462957 | 3300010167 | Bacteria | 1862 |
| 7 | JGI24695J34938_10000037 | 3300002450 | Bacteria | 100752 |
| 8 | Ga0072941_1062077 | 3300005201 | Bacteria | 1621 |
| 9 | Ga0102736_1006056 | 3300007052 | Bacteria | 1507 |
| 10 | Ga0466701_038908 | 3300042598 | Bacteria | 8630 |
| 11 | Ga0466700_398660 | 3300042600 | Bacteria | 2419 |
| 12 | Ga0466705_441857 | 3300042612 | Bacteria | 4195 |
| 13 | Ga0466730_071786 | 3300042625 | Bacteria | 741189 |
| 14 | Ga0466704_512733 | 3300042643 | Bacteria | 4662 |
| 15 | Ga0415639_019791 | 3300038395 | Bacteria | 9059 |
| 16 | Ga0466693_136784 | 3300042592 | Bacteria | 3337 |
| 17 | Ga0123356_10523166 | 3300010049 | Bacteria | 1344 |
| 18 | Ga0123353_10117987 | 3300010167 | Bacteria | 4268 |
| 19 | Ga0123353_10507282 | 3300010167 | Bacteria | 1755 |
| 20 | JGI24705J35276_12236920 | 3300002504 | Bacteria | 9274 |
| 21 | Ga0072941_1366973 | 3300005201 | Bacteria | 1311 |
| 22 | Ga0466733_117265 | 3300042659 | Bacteria | 18083 |
| 23 | Ga0466713_117047 | 3300042602 | Bacteria | 144191 |
| 24 | Ga0466714_074198 | 3300042603 | Bacteria | 829090 |
| 25 | Ga0466716_162586 | 3300042605 | Bacteria | 6012 |
| 26 | Ga0466719_090720 | 3300042606 | Bacteria | 4147 |
| 27 | Ga0415639_158152 | 3300038395 | Unclassified | 3128 |
| 28 | Ga0123357_10086554 | 3300009784 | Bacteria | 4100 |
| 29 | Ga0123355_10199649 | 3300009826 | Bacteria | 2925 |
| 30 | Ga0123356_10002569 | 3300010049 | Bacteria | 19382 |
| 31 | Ga0123353_10005961 | 3300010167 | Bacteria | 16132 |
| 32 | Ga0123353_10196887 | 3300010167 | Bacteria | 3175 |
| 33 | Ga0123354_10259634 | 3300010882 | Bacteria | 1738 |
| 34 | IMNBL1DRAFT_c0004056 | 3300000062 | Bacteria | 8984 |
| 35 | Ga0466707_091708 | 3300042601 | Bacteria | 4777 |
| 36 | Ga0466714_106711 | 3300042603 | Bacteria | 3208 |
| 37 | Ga0466720_223911 | 3300042607 | Bacteria | 1044 |
| 38 | Ga0466704_064412 | 3300042643 | Unclassified | 12861 |
| 39 | Ga0466725_332846 | 3300042654 | Bacteria | 33341 |
| 40 | Ga0160453_105906 | 3300012814 | Unclassified | 1886 |
| 41 | Ga0466690_386787 | 3300042590 | Bacteria | 1775 |
| 42 | Ga0466693_401018 | 3300042592 | Bacteria | 1688 |
| 43 | Ga0123356_10205590 | 3300010049 | Bacteria | 2013 |
| 44 | Ga0123353_10105182 | 3300010167 | Bacteria | 4548 |
| 45 | Ga0160464_101571 | 3300012805 | Bacteria | 7023 |
| 46 | Meta3P_1006087 | 3300002464 | Bacteria | 7153 |
| 47 | CVPL010W_10000064 | 3300002931 | Bacteria | 69184 |
| 48 | Ga0074306_1020443 | 3300005309 | Bacteria | 2967 |
| 49 | Ga0103268_1009975 | 3300007192 | Bacteria | 1976 |
| 50 | Ga0562377_0062 | 3300056842 | Bacteria | 463693 |
| 51 | Ga0466707_140127 | 3300042601 | Bacteria | 4878 |
| 52 | Ga0466715_125793 | 3300042616 | Bacteria | 1462 |
| 53 | Ga0466723_044181 | 3300042618 | Bacteria | 301962 |
| 54 | Ga0466703_357444 | 3300042636 | Bacteria | 6076 |
| 55 | Ga0123355_10484170 | 3300009826 | Bacteria | 1537 |
| 56 | Ga0123353_10357591 | 3300010167 | Bacteria | 2196 |
| 57 | JGI24702J35022_10004625 | 3300002462 | Bacteria | 8155 |
| 58 | Ga0123357_10000025 | 3300009784 | Bacteria | 131170 |
| 59 | Ga0466714_137832 | 3300042603 | Unclassified | 1916 |
| 60 | Ga0466711_224592 | 3300042615 | Bacteria | 117488 |
| 61 | Ga0466703_380031 | 3300042636 | Bacteria | 1445 |
| 62 | Ga0415639_131465 | 3300038395 | Bacteria | 5013 |
| 63 | Ga0466696_108528 | 3300042596 | Archaea | 2987 |
| 64 | Ga0123357_10011246 | 3300009784 | Bacteria | 11460 |
| 65 | Ga0072940_1397315 | 3300005200 | Bacteria | 3534 |
| 66 | Ga0466700_295192 | 3300042600 | Bacteria | 1172 |
| 67 | Ga0466722_112613 | 3300042609 | Bacteria | 1672 |
| 68 | Ga0466711_501172 | 3300042615 | Bacteria | 4808 |
| 69 | Ga0466715_209158 | 3300042616 | Bacteria | 2926 |
| 70 | Ga0415639_196033 | 3300038395 | Bacteria | 1288 |
| 71 | Ga0466693_360027 | 3300042592 | Bacteria | 3645 |
| 72 | Ga0466699_354518 | 3300042597 | Bacteria | 1827 |
| 73 | Ga0123357_10362332 | 3300009784 | Bacteria | 1371 |
| 74 | Ga0123355_10017678 | 3300009826 | Bacteria | 11279 |
| 75 | Ga0123356_10030897 | 3300010049 | Bacteria | 5011 |
| 76 | Ga0123356_10141898 | 3300010049 | Bacteria | 2371 |
| 77 | Ga0123353_10000362 | 3300010167 | Bacteria | 55430 |
| 78 | Ga0123353_10001076 | 3300010167 | Bacteria | 33242 |
| 79 | Ga0123353_10016173 | 3300010167 | Bacteria | 10888 |
| 80 | Ga0123353_10033809 | 3300010167 | Bacteria | 7966 |
| 81 | Ga0123353_10522802 | 3300010167 | Bacteria | 1721 |
| 82 | Ga0123353_10692436 | 3300010167 | Bacteria | 1433 |
| 83 | IMNBGM34_c001092 | 3300000036 | Bacteria | 5342 |
| 84 | JGI24705J35276_12209727 | 3300002504 | Bacteria | 1805 |
| 85 | Ga0052191_103274 | 3300003097 | Bacteria | 1718 |
| 86 | Ga0102734_1001147 | 3300007129 | Bacteria | 19702 |
| 87 | Ga0466701_064263 | 3300042598 | Bacteria | 8586 |
| 88 | Ga0466714_149316 | 3300042603 | Bacteria | 10795 |
| 89 | Ga0466719_060947 | 3300042606 | Bacteria | 103920 |
| 90 | Ga0466722_046153 | 3300042609 | Bacteria | 2458 |
| 91 | Ga0466718_061297 | 3300042617 | Bacteria | 1576 |
| 92 | Ga0466730_071971 | 3300042625 | Bacteria | 2714 |
| 93 | Ga0466727_177761 | 3300042655 | Bacteria | 12042 |
| 94 | Ga0466696_194976 | 3300042596 | Bacteria | 6506 |
| 95 | Ga0123355_10001049 | 3300009826 | Bacteria | 38266 |
| 96 | Ga0123356_10003235 | 3300010049 | Bacteria | 17118 |
| 97 | Ga0123356_10127634 | 3300010049 | Bacteria | 2486 |
| 98 | Ga0123353_10007796 | 3300010167 | Bacteria | 14532 |
| 99 | Ga0123353_10082834 | 3300010167 | Bacteria | 5160 |
| 100 | 2211830559 | 2209111004 | Bacteria | 23886 |
| 101 | Ga0127649_100534 | 3300009460 | Bacteria | 84789 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300007129 | Ga0102734_1001147 | Ga0102734_100114713 | 277 |
| 2 | iso_pr_bacteria | 643886085 | 644683614 | 302 |
| 3 | iso_pr_bacteria | 643886091 | 644652490 | 302 |
| 4 | iso_pr_bacteria | 651324002 | 651579068 | 309 |
| 5 | 3300042602 | Ga0466713_117047 | Ga0466713_117047_40567_41529 | 310 |
| 6 | 3300012814 | Ga0160453_105906 | Ga0160453_1059062 | 313 |
| 7 | 3300042592 | Ga0466693_360027 | Ga0466693_360027_1755_2696 | 313 |
| 8 | 3300042600 | Ga0466700_398660 | Ga0466700_398660_97_1038 | 313 |
| 9 | 3300042601 | Ga0466707_091708 | Ga0466707_091708_3692_4633 | 313 |
| 10 | 3300042625 | Ga0466730_071971 | Ga0466730_071971_1746_2687 | 313 |
| 11 | 3300010167 | Ga0123353_10105182 | Ga0123353_101051822 | 314 |
| 12 | 3300042598 | Ga0466701_031837 | Ga0466701_031837_181_1125 | 314 |
| 13 | 3300042607 | Ga0466720_223911 | Ga0466720_223911_72_1016 | 314 |
| 14 | iso_pr_bacteria | 2731957677 | 2732689196 | 314 |
| 15 | 3300010167 | Ga0123353_10082834 | Ga0123353_100828344 | 315 |
| 16 | 3300010167 | Ga0123353_10462957 | Ga0123353_104629572 | 315 |
| 17 | 3300010882 | Ga0123354_10259634 | Ga0123354_102596342 | 315 |
| 18 | iso_pr_bacteria | 2841168549 | 2841171859 | 315 |
| 19 | 2209111004 | 2211830559 | 2211865799 | 316 |
| 20 | 3300002504 | JGI24705J35276_12209727 | JGI24705J35276_122097271 | 316 |
| 21 | 3300010049 | Ga0123356_10205590 | Ga0123356_102055901 | 316 |
| 22 | iso_pr_bacteria | 2820075487 | 2820077221 | 316 |
| 23 | iso_pr_bacteria | 2827179085 | 2827183903 | 316 |
| 24 | 3300009784 | Ga0123357_10362332 | Ga0123357_103623321 | 317 |
| 25 | 3300010049 | Ga0123356_10523166 | Ga0123356_105231661 | 317 |
| 26 | 3300010167 | Ga0123353_10033809 | Ga0123353_100338094 | 317 |
| 27 | 3300010167 | Ga0123353_10507282 | Ga0123353_105072822 | 317 |
| 28 | 3300010167 | Ga0123353_10692436 | Ga0123353_106924361 | 317 |
| 29 | 3300038395 | Ga0415639_019791 | Ga0415639_019791_1840_2793 | 317 |
| 30 | 3300042590 | Ga0466690_386787 | Ga0466690_386787_718_1671 | 317 |
| 31 | 3300042597 | Ga0466699_354518 | Ga0466699_354518_205_1158 | 317 |
| 32 | 3300042616 | Ga0466715_209158 | Ga0466715_209158_138_1091 | 317 |
| 33 | iso_pr_bacteria | 2767802234 | 2769329544 | 317 |
| 34 | iso_pr_bacteria | 2820052737 | 2820053089 | 317 |
| 35 | iso_pr_bacteria | 2820096063 | 2820096338 | 317 |
| 36 | iso_pr_bacteria | 2820100407 | 2820100709 | 317 |
| 37 | iso_pr_bacteria | 2912849059 | 2912855054 | 317 |
| 38 | 3300000036 | IMNBGM34_c001092 | IMNBGM34_0010924 | 318 |
| 39 | 3300002462 | JGI24702J35022_10004625 | JGI24702J35022_100046253 | 318 |
| 40 | 3300009784 | Ga0123357_10000025 | Ga0123357_1000002589 | 318 |
| 41 | 3300010167 | Ga0123353_10000362 | Ga0123353_1000036249 | 318 |
| 42 | 3300042592 | Ga0466693_401018 | Ga0466693_401018_325_1281 | 318 |
| 43 | 3300042596 | Ga0466696_194976 | Ga0466696_194976_779_2119 | 318 |
| 44 | 3300042600 | Ga0466700_295192 | Ga0466700_295192_190_1146 | 318 |
| 45 | 3300042609 | Ga0466722_046153 | Ga0466722_046153_672_1628 | 318 |
| 46 | 3300042616 | Ga0466715_125793 | Ga0466715_125793_356_1312 | 318 |
| 47 | iso_pr_bacteria | 2852431164 | 2852435156 | 318 |
| 48 | iso_pr_bacteria | 8065497608 | 8065500029 | 318 |
| 49 | 3300002504 | JGI24705J35276_12236920 | JGI24705J35276_122369204 | 319 |
| 50 | 3300005201 | Ga0072941_1366973 | Ga0072941_13669731 | 319 |
| 51 | 3300010167 | Ga0123353_10522802 | Ga0123353_105228022 | 319 |
| 52 | 3300038395 | Ga0415639_196033 | Ga0415639_196033_162_1121 | 319 |
| 53 | 3300042605 | Ga0466716_162586 | Ga0466716_162586_2371_3330 | 319 |
| 54 | 3300042615 | Ga0466711_224592 | Ga0466711_224592_67849_68808 | 319 |
| 55 | 3300042618 | Ga0466723_044181 | Ga0466723_044181_166398_167357 | 319 |
| 56 | iso_pr_bacteria | 2820137450 | 2820139462 | 319 |
| 57 | iso_pr_bacteria | 2820141685 | 2820142529 | 319 |
| 58 | 3300010049 | Ga0123356_10002569 | Ga0123356_1000256923 | 320 |
| 59 | 3300010049 | Ga0123356_10030897 | Ga0123356_100308973 | 320 |
| 60 | iso_pr_bacteria | 2820457604 | 2820458164 | 320 |
| 61 | 3300009826 | Ga0123355_10199649 | Ga0123355_101996493 | 321 |
| 62 | 3300010167 | Ga0123353_10007796 | Ga0123353_100077965 | 321 |
| 63 | 3300042596 | Ga0466696_108528 | Ga0466696_108528_1089_2054 | 321 |
| 64 | iso_pr_bacteria | 2508501067 | 2508837528 | 321 |
| 65 | 3300009460 | Ga0127649_100534 | Ga0127649_1005347 | 322 |
| 66 | 3300042603 | Ga0466714_137832 | Ga0466714_137832_313_1281 | 322 |
| 67 | 3300009826 | Ga0123355_10017678 | Ga0123355_100176787 | 323 |
| 68 | 3300009826 | Ga0123355_10484170 | Ga0123355_104841702 | 323 |
| 69 | 3300010049 | Ga0123356_10127634 | Ga0123356_101276342 | 323 |
| 70 | 3300042606 | Ga0466719_060947 | Ga0466719_060947_24259_25230 | 323 |
| 71 | 3300042615 | Ga0466711_501172 | Ga0466711_501172_281_1252 | 323 |
| 72 | iso_pr_bacteria | 2837204985 | 2837205511 | 323 |
| 73 | 3300010167 | Ga0123353_10357591 | Ga0123353_103575912 | 324 |
| 74 | 3300042659 | Ga0466733_117265 | Ga0466733_117265_3172_4146 | 324 |
| 75 | iso_pr_bacteria | 2883683260 | 2883684371 | 324 |
| 76 | 3300002931 | CVPL010W_10000064 | CVPL010W_1000006432 | 325 |
| 77 | 3300007052 | Ga0102736_1006056 | Ga0102736_10060562 | 325 |
| 78 | 3300007192 | Ga0103268_1009975 | Ga0103268_10099753 | 325 |
| 79 | 3300042592 | Ga0466693_136784 | Ga0466693_136784_757_1734 | 325 |
| 80 | 3300042603 | Ga0466714_074198 | Ga0466714_074198_644075_645052 | 325 |
| 81 | 3300042606 | Ga0466719_090720 | Ga0466719_090720_2743_3795 | 325 |
| 82 | 3300042617 | Ga0466718_061297 | Ga0466718_061297_509_1486 | 325 |
| 83 | 3300010167 | Ga0123353_10001076 | Ga0123353_100010761 | 326 |
| 84 | iso_pr_bacteria | 2820673891 | 2820673932 | 326 |
| 85 | iso_pr_bacteria | 2820685979 | 2820686293 | 326 |
| 86 | 3300002450 | JGI24695J34938_10000037 | JGI24695J34938_1000003742 | 327 |
| 87 | 3300003097 | Ga0052191_103274 | Ga0052191_1032741 | 327 |
| 88 | 3300010167 | Ga0123353_10117987 | Ga0123353_101179873 | 327 |
| 89 | 3300042603 | Ga0466714_106711 | Ga0466714_106711_218_1201 | 327 |
| 90 | iso_pr_bacteria | 2820918931 | 2820919110 | 327 |
| 91 | 3300010049 | Ga0123356_10003235 | Ga0123356_100032357 | 328 |
| 92 | 3300010049 | Ga0123356_10141898 | Ga0123356_101418982 | 328 |
| 93 | iso_pr_bacteria | 2820602899 | 2820603261 | 328 |
| 94 | 3300009826 | Ga0123355_10001049 | Ga0123355_1000104931 | 329 |
| 95 | 3300010167 | Ga0123353_10030893 | Ga0123353_100308936 | 329 |
| 96 | 3300010167 | Ga0123353_10196887 | Ga0123353_101968872 | 330 |
| 97 | 3300042643 | Ga0466704_512733 | Ga0466704_512733_1138_2154 | 330 |
| 98 | iso_pr_bacteria | 2820111668 | 2820111880 | 330 |
| 99 | 3300005201 | Ga0072941_1062077 | Ga0072941_10620773 | 331 |
| 100 | 3300042601 | Ga0466707_140127 | Ga0466707_140127_889_1884 | 331 |
| 101 | 3300042609 | Ga0466722_112613 | Ga0466722_112613_47_1150 | 331 |
| 102 | 3300042612 | Ga0466705_441857 | Ga0466705_441857_2342_3403 | 331 |
| 103 | 3300009826 | Ga0123355_10017689 | Ga0123355_1001768917 | 332 |
| 104 | 3300000062 | IMNBL1DRAFT_c0004056 | IMNBL1DRAFT_00040562 | 333 |
| 105 | iso_pr_bacteria | 2706794701 | 2708050228 | 334 |
| 106 | 3300038395 | Ga0415639_006574 | Ga0415639_006574_8528_9535 | 335 |
| 107 | 3300042643 | Ga0466704_064412 | Ga0466704_064412_4828_5856 | 336 |
| 108 | 3300042636 | Ga0466703_357444 | Ga0466703_357444_2830_3843 | 337 |
| 109 | 3300009784 | Ga0123357_10086554 | Ga0123357_100865542 | 338 |
| 110 | 3300010167 | Ga0123353_10016173 | Ga0123353_100161734 | 338 |
| 111 | 3300042598 | Ga0466701_038908 | Ga0466701_038908_587_1609 | 340 |
| 112 | 3300042598 | Ga0466701_064263 | Ga0466701_064263_586_1608 | 340 |
| 113 | iso_pr_bacteria | 2864822740 | 2864825005 | 340 |
| 114 | iso_pr_bacteria | 2864882932 | 2864885196 | 340 |
| 115 | iso_pr_bacteria | 2864891731 | 2864894356 | 340 |
| 116 | iso_pr_bacteria | 2921902974 | 2921904661 | 340 |
| 117 | 3300005200 | Ga0072940_1397315 | Ga0072940_13973154 | 342 |
| 118 | 3300042625 | Ga0466730_071786 | Ga0466730_071786_5837_6865 | 342 |
| 119 | iso_pr_bacteria | 2687453786 | 2690173077 | 342 |
| 120 | iso_pr_bacteria | 2864831662 | 2864835383 | 342 |
| 121 | iso_pr_bacteria | 646311952 | 646430125 | 342 |
| 122 | 3300005309 | Ga0074306_1020443 | Ga0074306_10204433 | 343 |
| 123 | iso_pr_bacteria | 2820106212 | 2820109849 | 343 |
| 124 | 3300009784 | Ga0123357_10011246 | Ga0123357_100112464 | 344 |
| 125 | 3300038395 | Ga0415639_131465 | Ga0415639_131465_581_1615 | 344 |
| 126 | 3300042603 | Ga0466714_149316 | Ga0466714_149316_6564_7598 | 344 |
| 127 | iso_pr_bacteria | 2847090942 | 2847093406 | 344 |
| 128 | iso_pr_bacteria | 2864788197 | 2864791161 | 344 |
| 129 | iso_pr_bacteria | 2864923010 | 2864925975 | 344 |
| 130 | iso_pr_bacteria | 2864948220 | 2864951183 | 344 |
| 131 | 3300010167 | Ga0123353_10005961 | Ga0123353_1000596114 | 346 |
| 132 | 3300042655 | Ga0466727_177761 | Ga0466727_177761_1751_2791 | 346 |
| 133 | 3300056842 | Ga0562377_0062 | Ga0562377_0062_372971_374011 | 346 |
| 134 | iso_pr_bacteria | 2998929858 | 2998930455 | 349 |
| 135 | 3300038395 | Ga0415639_158152 | Ga0415639_158152_1714_2778 | 354 |
| 136 | 3300012805 | Ga0160464_101571 | Ga0160464_1015714 | 355 |
| 137 | 3300042636 | Ga0466703_380031 | Ga0466703_380031_280_1347 | 355 |
| 138 | iso_pr_bacteria | 2529292732 | 2529759212 | 358 |
| 139 | iso_pr_bacteria | 8020009074 | 8020010203 | 358 |
| 140 | iso_pr_bacteria | 8114076984 | 8114078904 | 358 |
| 141 | 3300002464 | Meta3P_1006087 | Meta3P_10060875 | 359 |
| 142 | 3300042649 | Ga0466724_07109 | Ga0466724_07109_121075_122160 | 361 |
| 143 | 3300042654 | Ga0466725_332846 | Ga0466725_332846_27347_28456 | 369 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01370 | Epimerase | NAD dependent epimerase/dehydratase family | 19 | 285 | 0.94 |
| PF04321 | RmlD_sub_bind | RmlD substrate binding domain | 16 | 321 | 0.89 |
| PF16363 | GDP_Man_Dehyd | GDP-mannose 4,6 dehydratase | 77 | 347 | 0.86 |
| PF01073 | 3Beta_HSD | 3-beta hydroxysteroid dehydrogenase/isomerase family | 19 | 275 | 0.8 |
| PF07993 | NAD_binding_4 | Male sterility protein | 112 | 210 | 0.78 |
| PF02719 | Polysacc_synt_2 | Polysaccharide biosynthesis protein | 19 | 286 | 0.72 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.93 | 0.95 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.