Protein Family IF10087

Metagenome Isolate
143 Members
92 Samples
101 Scaffolds
326.93 Avg Length

🧬 Representative Sequence

ID
3300042654|Ga0466725_332846|Ga0466725_332846_27347_28456
Length
369 aa
Sequence
VLLNWYRNLQNLNKKMNYLITGGSGFIGSHLAEHLLKSGHFVINIDNFDDFYDYKIKIENTLESIGKSPKFQYSDKETDIQKLISETKSDNYILYYQDIRDIFGLRKIFENHKIDLIIHLAALAGVRPSIQKPLEYEEVNIRGSMNLWELCKEFNIKKFVCSSSSSVYGNNEKIPFSETDNVDKPISPYAATKKCGEILGHVYHHLYKIDMVQLRFFTVYGPRQRPDLAIHKFSKLILENREIPFYGDGSTSRDYTFIDDIIDGVLKSIKYLEQHENVYEIINLGENEVINLNQMLSEIEENLGKKAKKNILPMQAGDVPKTNADITKAEKIIDYRPNTKFNIGIKKFMAWFLEKTDNVQRKGFLPNLE

📊 Sample Types

Isolate 29.4%
Metagenome 70.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 25.0%
Unclassified 20.5%
Kalotermitidae 12.5%
Elmidae 8.0%
Culicidae 5.7%
Scarabaeidae 4.5%
Formicidae 4.5%
Pyralidae 3.4%
Drosophilidae 2.3%
Apidae 2.3%
Passalidae 2.3%
Rhinotermitidae 2.3%
Calliphoridae 1.1%
Cambaridae 1.1%
Tenebrionidae 1.1%
Aphididae 1.1%
Termopsidae 1.1%
Noctuidae 1.1%

🌳 Taxonomy

Archaea 1
Bacteria 138
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864831662 Chryseobacterium sediminis S00068 Isolate Elmidae
2 2508501067 Opitutaceae bacterium TAV1 Isolate Unclassified
3 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
6 8020009074 Elizabethkingia anophelis MSU001 Isolate Culicidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
9 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
10 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
11 2864948220 Elizabethkingia anophelis S00205 Isolate Elmidae
12 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
13 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
14 2820096063 Unclassified Proteobacteria Lab288P3bin136 Isolate Unclassified
15 2820106212 Unclassified Proteobacteria Emb289P4bin44 Isolate Unclassified
16 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
17 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
18 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
19 651324002 Acetonema longum APO-1, DSM 6540 Isolate Kalotermitidae
20 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
21 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
22 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
23 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
24 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
25 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
26 8114076984 Elizabethkingia anophelis R26 Isolate Culicidae
27 2827179085 Paenibacillus alvei DSM 29 Isolate Apidae
28 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
29 2864788197 Elizabethkingia anophelis S00027 Isolate Elmidae
30 2864822740 Chryseobacterium shigense S00064 Isolate Elmidae
31 2912849059 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
32 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
33 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
34 2820457604 Unclassified Firmicutes Lab288P3bin15 Isolate Unclassified
35 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
36 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
37 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
38 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
39 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
40 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
41 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
42 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
43 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
44 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
45 3300005309 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut Metagenome Drosophilidae
46 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
47 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
48 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
49 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
50 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
51 2921902974 Chryseobacterium sp. cx-624 Isolate Cambaridae
52 2820052737 Unclassified Proteobacteria Th196P3bin127 Isolate Unclassified
53 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
54 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
55 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
56 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
57 2847090942 Elizabethkingia anophelis Ag1 Isolate Culicidae
58 2864882932 Chryseobacterium shingense S00136 Isolate Elmidae
59 2864891731 Chryseobacterium defluvii S00151 Isolate Elmidae
60 2687453786 Chryseobacterium culicis DSM 23031 Isolate Unclassified
61 2820100407 Unclassified Proteobacteria Lab288P1bin48 Isolate Unclassified
62 2820137450 Unclassified Proteobacteria Emb289P3bin120 Isolate Unclassified
63 646311952 Sebaldella termitidis ATCC 33386 Isolate Unclassified
64 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
65 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
66 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
67 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
68 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
69 2841168549 Agromyces protaetiae FW100M-8 Isolate Scarabaeidae
70 2529292732 Elizabethkingia anophelis R26 Isolate Culicidae
71 2820075487 Unclassified Proteobacteria Nt197P3bin122 Isolate Unclassified
72 2820111668 Unclassified Proteobacteria Emb289P4bin34 Isolate Unclassified
73 2820141685 Unclassified Proteobacteria Emb289P3bin118 Isolate Unclassified
74 2998929858 Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 Isolate Aphididae
75 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
76 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
77 2883683260 Protaetiibacter larvae KACC 19322 Isolate Scarabaeidae
78 2706794701 Opitutaceae bacterium TSB47 Isolate Rhinotermitidae
79 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
80 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
81 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
82 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
83 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
84 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
85 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
86 3300003097 Cutworm gut microbial communities from Hangzhou, China Metagenome Noctuidae
87 2864923010 Elizabethkingia anophelis S00177 Isolate Elmidae
88 2820918931 Unclassified Actinobacteria Emb289P3bin56 Isolate Unclassified
89 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
90 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
91 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
92 3300009460 Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov Metagenome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466701_031837 3300042598 Bacteria 1220
2 Ga0466724_07109 3300042649 Bacteria 285871
3 Ga0415639_006574 3300038395 Bacteria 19511
4 Ga0123355_10017689 3300009826 Bacteria 11273
5 Ga0123353_10030893 3300010167 Bacteria 8286
6 Ga0123353_10462957 3300010167 Bacteria 1862
7 JGI24695J34938_10000037 3300002450 Bacteria 100752
8 Ga0072941_1062077 3300005201 Bacteria 1621
9 Ga0102736_1006056 3300007052 Bacteria 1507
10 Ga0466701_038908 3300042598 Bacteria 8630
11 Ga0466700_398660 3300042600 Bacteria 2419
12 Ga0466705_441857 3300042612 Bacteria 4195
13 Ga0466730_071786 3300042625 Bacteria 741189
14 Ga0466704_512733 3300042643 Bacteria 4662
15 Ga0415639_019791 3300038395 Bacteria 9059
16 Ga0466693_136784 3300042592 Bacteria 3337
17 Ga0123356_10523166 3300010049 Bacteria 1344
18 Ga0123353_10117987 3300010167 Bacteria 4268
19 Ga0123353_10507282 3300010167 Bacteria 1755
20 JGI24705J35276_12236920 3300002504 Bacteria 9274
21 Ga0072941_1366973 3300005201 Bacteria 1311
22 Ga0466733_117265 3300042659 Bacteria 18083
23 Ga0466713_117047 3300042602 Bacteria 144191
24 Ga0466714_074198 3300042603 Bacteria 829090
25 Ga0466716_162586 3300042605 Bacteria 6012
26 Ga0466719_090720 3300042606 Bacteria 4147
27 Ga0415639_158152 3300038395 Unclassified 3128
28 Ga0123357_10086554 3300009784 Bacteria 4100
29 Ga0123355_10199649 3300009826 Bacteria 2925
30 Ga0123356_10002569 3300010049 Bacteria 19382
31 Ga0123353_10005961 3300010167 Bacteria 16132
32 Ga0123353_10196887 3300010167 Bacteria 3175
33 Ga0123354_10259634 3300010882 Bacteria 1738
34 IMNBL1DRAFT_c0004056 3300000062 Bacteria 8984
35 Ga0466707_091708 3300042601 Bacteria 4777
36 Ga0466714_106711 3300042603 Bacteria 3208
37 Ga0466720_223911 3300042607 Bacteria 1044
38 Ga0466704_064412 3300042643 Unclassified 12861
39 Ga0466725_332846 3300042654 Bacteria 33341
40 Ga0160453_105906 3300012814 Unclassified 1886
41 Ga0466690_386787 3300042590 Bacteria 1775
42 Ga0466693_401018 3300042592 Bacteria 1688
43 Ga0123356_10205590 3300010049 Bacteria 2013
44 Ga0123353_10105182 3300010167 Bacteria 4548
45 Ga0160464_101571 3300012805 Bacteria 7023
46 Meta3P_1006087 3300002464 Bacteria 7153
47 CVPL010W_10000064 3300002931 Bacteria 69184
48 Ga0074306_1020443 3300005309 Bacteria 2967
49 Ga0103268_1009975 3300007192 Bacteria 1976
50 Ga0562377_0062 3300056842 Bacteria 463693
51 Ga0466707_140127 3300042601 Bacteria 4878
52 Ga0466715_125793 3300042616 Bacteria 1462
53 Ga0466723_044181 3300042618 Bacteria 301962
54 Ga0466703_357444 3300042636 Bacteria 6076
55 Ga0123355_10484170 3300009826 Bacteria 1537
56 Ga0123353_10357591 3300010167 Bacteria 2196
57 JGI24702J35022_10004625 3300002462 Bacteria 8155
58 Ga0123357_10000025 3300009784 Bacteria 131170
59 Ga0466714_137832 3300042603 Unclassified 1916
60 Ga0466711_224592 3300042615 Bacteria 117488
61 Ga0466703_380031 3300042636 Bacteria 1445
62 Ga0415639_131465 3300038395 Bacteria 5013
63 Ga0466696_108528 3300042596 Archaea 2987
64 Ga0123357_10011246 3300009784 Bacteria 11460
65 Ga0072940_1397315 3300005200 Bacteria 3534
66 Ga0466700_295192 3300042600 Bacteria 1172
67 Ga0466722_112613 3300042609 Bacteria 1672
68 Ga0466711_501172 3300042615 Bacteria 4808
69 Ga0466715_209158 3300042616 Bacteria 2926
70 Ga0415639_196033 3300038395 Bacteria 1288
71 Ga0466693_360027 3300042592 Bacteria 3645
72 Ga0466699_354518 3300042597 Bacteria 1827
73 Ga0123357_10362332 3300009784 Bacteria 1371
74 Ga0123355_10017678 3300009826 Bacteria 11279
75 Ga0123356_10030897 3300010049 Bacteria 5011
76 Ga0123356_10141898 3300010049 Bacteria 2371
77 Ga0123353_10000362 3300010167 Bacteria 55430
78 Ga0123353_10001076 3300010167 Bacteria 33242
79 Ga0123353_10016173 3300010167 Bacteria 10888
80 Ga0123353_10033809 3300010167 Bacteria 7966
81 Ga0123353_10522802 3300010167 Bacteria 1721
82 Ga0123353_10692436 3300010167 Bacteria 1433
83 IMNBGM34_c001092 3300000036 Bacteria 5342
84 JGI24705J35276_12209727 3300002504 Bacteria 1805
85 Ga0052191_103274 3300003097 Bacteria 1718
86 Ga0102734_1001147 3300007129 Bacteria 19702
87 Ga0466701_064263 3300042598 Bacteria 8586
88 Ga0466714_149316 3300042603 Bacteria 10795
89 Ga0466719_060947 3300042606 Bacteria 103920
90 Ga0466722_046153 3300042609 Bacteria 2458
91 Ga0466718_061297 3300042617 Bacteria 1576
92 Ga0466730_071971 3300042625 Bacteria 2714
93 Ga0466727_177761 3300042655 Bacteria 12042
94 Ga0466696_194976 3300042596 Bacteria 6506
95 Ga0123355_10001049 3300009826 Bacteria 38266
96 Ga0123356_10003235 3300010049 Bacteria 17118
97 Ga0123356_10127634 3300010049 Bacteria 2486
98 Ga0123353_10007796 3300010167 Bacteria 14532
99 Ga0123353_10082834 3300010167 Bacteria 5160
100 2211830559 2209111004 Bacteria 23886
101 Ga0127649_100534 3300009460 Bacteria 84789

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300007129 Ga0102734_1001147 Ga0102734_100114713 277
2 iso_pr_bacteria 643886085 644683614 302
3 iso_pr_bacteria 643886091 644652490 302
4 iso_pr_bacteria 651324002 651579068 309
5 3300042602 Ga0466713_117047 Ga0466713_117047_40567_41529 310
6 3300012814 Ga0160453_105906 Ga0160453_1059062 313
7 3300042592 Ga0466693_360027 Ga0466693_360027_1755_2696 313
8 3300042600 Ga0466700_398660 Ga0466700_398660_97_1038 313
9 3300042601 Ga0466707_091708 Ga0466707_091708_3692_4633 313
10 3300042625 Ga0466730_071971 Ga0466730_071971_1746_2687 313
11 3300010167 Ga0123353_10105182 Ga0123353_101051822 314
12 3300042598 Ga0466701_031837 Ga0466701_031837_181_1125 314
13 3300042607 Ga0466720_223911 Ga0466720_223911_72_1016 314
14 iso_pr_bacteria 2731957677 2732689196 314
15 3300010167 Ga0123353_10082834 Ga0123353_100828344 315
16 3300010167 Ga0123353_10462957 Ga0123353_104629572 315
17 3300010882 Ga0123354_10259634 Ga0123354_102596342 315
18 iso_pr_bacteria 2841168549 2841171859 315
19 2209111004 2211830559 2211865799 316
20 3300002504 JGI24705J35276_12209727 JGI24705J35276_122097271 316
21 3300010049 Ga0123356_10205590 Ga0123356_102055901 316
22 iso_pr_bacteria 2820075487 2820077221 316
23 iso_pr_bacteria 2827179085 2827183903 316
24 3300009784 Ga0123357_10362332 Ga0123357_103623321 317
25 3300010049 Ga0123356_10523166 Ga0123356_105231661 317
26 3300010167 Ga0123353_10033809 Ga0123353_100338094 317
27 3300010167 Ga0123353_10507282 Ga0123353_105072822 317
28 3300010167 Ga0123353_10692436 Ga0123353_106924361 317
29 3300038395 Ga0415639_019791 Ga0415639_019791_1840_2793 317
30 3300042590 Ga0466690_386787 Ga0466690_386787_718_1671 317
31 3300042597 Ga0466699_354518 Ga0466699_354518_205_1158 317
32 3300042616 Ga0466715_209158 Ga0466715_209158_138_1091 317
33 iso_pr_bacteria 2767802234 2769329544 317
34 iso_pr_bacteria 2820052737 2820053089 317
35 iso_pr_bacteria 2820096063 2820096338 317
36 iso_pr_bacteria 2820100407 2820100709 317
37 iso_pr_bacteria 2912849059 2912855054 317
38 3300000036 IMNBGM34_c001092 IMNBGM34_0010924 318
39 3300002462 JGI24702J35022_10004625 JGI24702J35022_100046253 318
40 3300009784 Ga0123357_10000025 Ga0123357_1000002589 318
41 3300010167 Ga0123353_10000362 Ga0123353_1000036249 318
42 3300042592 Ga0466693_401018 Ga0466693_401018_325_1281 318
43 3300042596 Ga0466696_194976 Ga0466696_194976_779_2119 318
44 3300042600 Ga0466700_295192 Ga0466700_295192_190_1146 318
45 3300042609 Ga0466722_046153 Ga0466722_046153_672_1628 318
46 3300042616 Ga0466715_125793 Ga0466715_125793_356_1312 318
47 iso_pr_bacteria 2852431164 2852435156 318
48 iso_pr_bacteria 8065497608 8065500029 318
49 3300002504 JGI24705J35276_12236920 JGI24705J35276_122369204 319
50 3300005201 Ga0072941_1366973 Ga0072941_13669731 319
51 3300010167 Ga0123353_10522802 Ga0123353_105228022 319
52 3300038395 Ga0415639_196033 Ga0415639_196033_162_1121 319
53 3300042605 Ga0466716_162586 Ga0466716_162586_2371_3330 319
54 3300042615 Ga0466711_224592 Ga0466711_224592_67849_68808 319
55 3300042618 Ga0466723_044181 Ga0466723_044181_166398_167357 319
56 iso_pr_bacteria 2820137450 2820139462 319
57 iso_pr_bacteria 2820141685 2820142529 319
58 3300010049 Ga0123356_10002569 Ga0123356_1000256923 320
59 3300010049 Ga0123356_10030897 Ga0123356_100308973 320
60 iso_pr_bacteria 2820457604 2820458164 320
61 3300009826 Ga0123355_10199649 Ga0123355_101996493 321
62 3300010167 Ga0123353_10007796 Ga0123353_100077965 321
63 3300042596 Ga0466696_108528 Ga0466696_108528_1089_2054 321
64 iso_pr_bacteria 2508501067 2508837528 321
65 3300009460 Ga0127649_100534 Ga0127649_1005347 322
66 3300042603 Ga0466714_137832 Ga0466714_137832_313_1281 322
67 3300009826 Ga0123355_10017678 Ga0123355_100176787 323
68 3300009826 Ga0123355_10484170 Ga0123355_104841702 323
69 3300010049 Ga0123356_10127634 Ga0123356_101276342 323
70 3300042606 Ga0466719_060947 Ga0466719_060947_24259_25230 323
71 3300042615 Ga0466711_501172 Ga0466711_501172_281_1252 323
72 iso_pr_bacteria 2837204985 2837205511 323
73 3300010167 Ga0123353_10357591 Ga0123353_103575912 324
74 3300042659 Ga0466733_117265 Ga0466733_117265_3172_4146 324
75 iso_pr_bacteria 2883683260 2883684371 324
76 3300002931 CVPL010W_10000064 CVPL010W_1000006432 325
77 3300007052 Ga0102736_1006056 Ga0102736_10060562 325
78 3300007192 Ga0103268_1009975 Ga0103268_10099753 325
79 3300042592 Ga0466693_136784 Ga0466693_136784_757_1734 325
80 3300042603 Ga0466714_074198 Ga0466714_074198_644075_645052 325
81 3300042606 Ga0466719_090720 Ga0466719_090720_2743_3795 325
82 3300042617 Ga0466718_061297 Ga0466718_061297_509_1486 325
83 3300010167 Ga0123353_10001076 Ga0123353_100010761 326
84 iso_pr_bacteria 2820673891 2820673932 326
85 iso_pr_bacteria 2820685979 2820686293 326
86 3300002450 JGI24695J34938_10000037 JGI24695J34938_1000003742 327
87 3300003097 Ga0052191_103274 Ga0052191_1032741 327
88 3300010167 Ga0123353_10117987 Ga0123353_101179873 327
89 3300042603 Ga0466714_106711 Ga0466714_106711_218_1201 327
90 iso_pr_bacteria 2820918931 2820919110 327
91 3300010049 Ga0123356_10003235 Ga0123356_100032357 328
92 3300010049 Ga0123356_10141898 Ga0123356_101418982 328
93 iso_pr_bacteria 2820602899 2820603261 328
94 3300009826 Ga0123355_10001049 Ga0123355_1000104931 329
95 3300010167 Ga0123353_10030893 Ga0123353_100308936 329
96 3300010167 Ga0123353_10196887 Ga0123353_101968872 330
97 3300042643 Ga0466704_512733 Ga0466704_512733_1138_2154 330
98 iso_pr_bacteria 2820111668 2820111880 330
99 3300005201 Ga0072941_1062077 Ga0072941_10620773 331
100 3300042601 Ga0466707_140127 Ga0466707_140127_889_1884 331
101 3300042609 Ga0466722_112613 Ga0466722_112613_47_1150 331
102 3300042612 Ga0466705_441857 Ga0466705_441857_2342_3403 331
103 3300009826 Ga0123355_10017689 Ga0123355_1001768917 332
104 3300000062 IMNBL1DRAFT_c0004056 IMNBL1DRAFT_00040562 333
105 iso_pr_bacteria 2706794701 2708050228 334
106 3300038395 Ga0415639_006574 Ga0415639_006574_8528_9535 335
107 3300042643 Ga0466704_064412 Ga0466704_064412_4828_5856 336
108 3300042636 Ga0466703_357444 Ga0466703_357444_2830_3843 337
109 3300009784 Ga0123357_10086554 Ga0123357_100865542 338
110 3300010167 Ga0123353_10016173 Ga0123353_100161734 338
111 3300042598 Ga0466701_038908 Ga0466701_038908_587_1609 340
112 3300042598 Ga0466701_064263 Ga0466701_064263_586_1608 340
113 iso_pr_bacteria 2864822740 2864825005 340
114 iso_pr_bacteria 2864882932 2864885196 340
115 iso_pr_bacteria 2864891731 2864894356 340
116 iso_pr_bacteria 2921902974 2921904661 340
117 3300005200 Ga0072940_1397315 Ga0072940_13973154 342
118 3300042625 Ga0466730_071786 Ga0466730_071786_5837_6865 342
119 iso_pr_bacteria 2687453786 2690173077 342
120 iso_pr_bacteria 2864831662 2864835383 342
121 iso_pr_bacteria 646311952 646430125 342
122 3300005309 Ga0074306_1020443 Ga0074306_10204433 343
123 iso_pr_bacteria 2820106212 2820109849 343
124 3300009784 Ga0123357_10011246 Ga0123357_100112464 344
125 3300038395 Ga0415639_131465 Ga0415639_131465_581_1615 344
126 3300042603 Ga0466714_149316 Ga0466714_149316_6564_7598 344
127 iso_pr_bacteria 2847090942 2847093406 344
128 iso_pr_bacteria 2864788197 2864791161 344
129 iso_pr_bacteria 2864923010 2864925975 344
130 iso_pr_bacteria 2864948220 2864951183 344
131 3300010167 Ga0123353_10005961 Ga0123353_1000596114 346
132 3300042655 Ga0466727_177761 Ga0466727_177761_1751_2791 346
133 3300056842 Ga0562377_0062 Ga0562377_0062_372971_374011 346
134 iso_pr_bacteria 2998929858 2998930455 349
135 3300038395 Ga0415639_158152 Ga0415639_158152_1714_2778 354
136 3300012805 Ga0160464_101571 Ga0160464_1015714 355
137 3300042636 Ga0466703_380031 Ga0466703_380031_280_1347 355
138 iso_pr_bacteria 2529292732 2529759212 358
139 iso_pr_bacteria 8020009074 8020010203 358
140 iso_pr_bacteria 8114076984 8114078904 358
141 3300002464 Meta3P_1006087 Meta3P_10060875 359
142 3300042649 Ga0466724_07109 Ga0466724_07109_121075_122160 361
143 3300042654 Ga0466725_332846 Ga0466725_332846_27347_28456 369

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01370 Epimerase NAD dependent epimerase/dehydratase family 19 285 0.94
PF04321 RmlD_sub_bind RmlD substrate binding domain 16 321 0.89
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 77 347 0.86
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 19 275 0.8
PF07993 NAD_binding_4 Male sterility protein 112 210 0.78
PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein 19 286 0.72

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.93 0.95 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.