Protein Family IF10085

Metagenome Isolate
235 Members
181 Samples
121 Scaffolds
335.41 Avg Length

🧬 Representative Sequence

ID
3300042654|Ga0466725_328244|Ga0466725_328244_319_1419
Length
366 aa
Sequence
MTKEKLRASHNPAPGRKSAAAGTQALWKADMEAAQTALWVVILLVVLALAFDFMNGFHDAANSIATVVSTGVLRPSQAVVFAAFFNLMALFVFHLSVAATVGKGIVEPGVVDTHVVFGALAGAITWNLITWYYGIPSSSSHALIGGIVGAVMAKSGASVLVAGGIIKTVAFIFISPLLGFLLGSLMMVAVAWICRRARPSRIDRWFRRLQLLSAGAYSLGHGGNDAQKTIGIIWMLLIATGHRAAADSAPPLWVIVSCYTAIGLGTMFGGWRIVKTMGQKITKLKPVGGFCAETGGALTLFFATVLGIPVSTTHTITGAIVGVGSTQRASAVRWGVAGNIVWAWVLTIPAAAFVAALAFWISFYLY

📊 Sample Types

Isolate 48.5%
Metagenome 51.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Coreidae 45.2%
Termitidae 10.2%
Unclassified 8.5%
Kalotermitidae 7.9%
Formicidae 6.2%
Culicidae 5.6%
Elmidae 5.1%
Curculionidae 1.7%
Termopsidae 1.7%
Hydrophilidae 1.1%
Rhinotermitidae 1.1%
Berytidae 1.1%
Largidae 1.1%
Alydidae 1.1%
Hodotermitidae 0.6%
Tenebrionidae 0.6%
Passalidae 0.6%
Armadillidiidae 0.6%

🌳 Taxonomy

Archaea 0
Bacteria 212
Eukaryota 0
Viruses 0
Unclassified 23

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820059968 Unclassified Proteobacteria Nt197P4bin23 Isolate Unclassified
2 2820170025 Unclassified Proteobacteria Co191P1bin43 Isolate Unclassified
3 2864826666 Acidovorax konjaci S00067 Isolate Elmidae
4 2873571580 Diaphorobacter sp. HDW4B Isolate Hydrophilidae
5 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
6 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
7 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
8 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
9 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
10 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
11 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
12 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
13 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
14 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
15 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
16 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
17 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
18 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
19 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
20 8025716094 Caballeronia zhejiangensis LZ028 Isolate Coreidae
21 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
22 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
23 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
24 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
25 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
26 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
27 8102251710 Caballeronia sp. LZ065 Isolate Coreidae
28 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
29 2820132692 Unclassified Proteobacteria Emb289P3bin76 Isolate Unclassified
30 2864870719 Comamonas odontotermitis S00124 Isolate Elmidae
31 2864937364 Acidovorax soli S00198 Isolate Elmidae
32 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
33 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
34 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
35 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
36 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
37 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
38 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
39 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
40 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
41 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
42 8025671076 Caballeronia cordobensis LZ034LL Isolate Coreidae
43 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
44 8102047609 Caballeronia sp. GACF5 Isolate Coreidae
45 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
46 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
47 8102117041 Caballeronia sp. INML3 Isolate Coreidae
48 8102131453 Caballeronia sp. INML5 Isolate Coreidae
49 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
50 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
51 8102230706 Caballeronia sp. LZ035 Isolate Coreidae
52 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
53 2820168331 Unclassified Proteobacteria Co191P3bin57 Isolate Unclassified
54 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
55 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
56 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
57 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
58 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
59 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
60 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
61 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
62 8024014383 Caballeronia sp. SL2Y3 Isolate Berytidae
63 8025740903 Caballeronia zhejiangensis LZ008 Isolate Coreidae
64 8069748016 Caballeronia sp. LP003 Isolate Coreidae
65 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
66 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
67 8102109360 Caballeronia sp. INML2 Isolate Coreidae
68 8102145433 Caballeronia sp. LP006 Isolate Coreidae
69 8102186987 Caballeronia sp. LZ028 Isolate Coreidae
70 8102223607 Caballeronia sp. LZ034LL Isolate Coreidae
71 8102286609 Caballeronia sp. NCTM5 Isolate Coreidae
72 2864755708 Massilia timonae S00006 Isolate Elmidae
73 3003869270 Paraburkholderia sp. PGU16 Isolate Largidae
74 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
75 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
76 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
77 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
78 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
79 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
80 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
81 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
82 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
83 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
84 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
85 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
86 8025685901 Caballeronia fortuita LZ035 Isolate Coreidae
87 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
88 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
89 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
90 8100455565 Delftia sp. S67 Isolate Curculionidae
91 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
92 8102102351 Caballeronia sp. INML1 Isolate Coreidae
93 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
94 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
95 8102246966 Caballeronia sp. LZ050 Isolate Coreidae
96 2820103659 Unclassified Proteobacteria Emb289P4bin67 Isolate Unclassified
97 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
98 2820166269 Unclassified Proteobacteria Co191P4bin16 Isolate Unclassified
99 2848339753 Ephemeroptericola cinctiostellae F02 Isolate Unclassified
100 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
101 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
102 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
103 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
104 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
105 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
106 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
107 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
108 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
109 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
110 8025666332 Caballeronia grimmiae LZ050 Isolate Coreidae
111 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
112 8025701579 Caballeronia telluris LZ031 Isolate Coreidae
113 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
114 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
115 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
116 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
117 8102201977 Caballeronia sp. LZ031 Isolate Coreidae
118 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
119 2820134530 Unclassified Proteobacteria Emb289P3bin65 Isolate Unclassified
120 2864968865 Paucibacter oligotrophus S00239 Isolate Elmidae
121 2873565274 Diaphorobacter sp. HDW4A Isolate Hydrophilidae
122 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
123 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
124 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
125 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
126 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
127 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
128 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
129 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
130 8025658853 Caballeronia temeraria LZ065 Isolate Coreidae
131 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
132 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
133 8101994502 Caballeronia sp. ATUFL_F2_KS42 Isolate Coreidae
134 8102124461 Caballeronia sp. INML3B Isolate Coreidae
135 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
136 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae
137 2820111668 Unclassified Proteobacteria Emb289P4bin34 Isolate Unclassified
138 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
139 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
140 2864960361 Comamonas odontotermitis S00229 Isolate Elmidae
141 2868169047 Comamonas aquatica S00077 Isolate Elmidae
142 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
143 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
144 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
145 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
146 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
147 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
148 8023757577 Caballeronia peredens LP006 Isolate Coreidae
149 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
150 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
151 8025728939 Caballeronia telluris LZ024 Isolate Coreidae
152 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
153 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
154 8069775773 Caballeronia sp. LZ062 Isolate Coreidae
155 8100461708 Delftia sp. S65 Isolate Curculionidae
156 8101951471 Caballeronia sp. AAUFL_F1_KS45 Isolate Coreidae
157 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
158 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
159 8102020860 Caballeronia sp. AZ10_KS36 Isolate Coreidae
160 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
161 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae
162 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
163 2820071837 Unclassified Proteobacteria Nt197P3bin132 Isolate Unclassified
164 2820152154 Unclassified Proteobacteria Cu122P5bin47 Isolate Unclassified
165 2834230000 Pandoraea novymonadis E262 Isolate Unclassified
166 3003878002 Paraburkholderia sp. PGU19 Isolate Largidae
167 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
168 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
169 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
170 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
171 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
172 8023752828 Caballeronia grimmiae LZ062 Isolate Coreidae
173 8024019580 Caballeronia sp. Lep1P3 Isolate Coreidae
174 8024031916 Cupriavidus pauculus BHJ32i Isolate Alydidae
175 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
176 8069763219 Caballeronia sp. LZ008 Isolate Coreidae
177 8100449422 Delftia sp. S66 Isolate Curculionidae
178 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
179 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
180 8102181083 Caballeronia sp. LZ025 Isolate Coreidae
181 8102271933 Caballeronia sp. NCF4 Isolate Coreidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_098838 3300042659 Bacteria 4304
2 Ga0466704_569178 3300042643 Unclassified 2218
3 Ga0466708_051044 3300042652 Bacteria 7590
4 Ga0103268_1000097 3300007192 Bacteria 27557
5 Ga0466719_262077 3300042606 Bacteria 2285
6 Ga0466715_212143 3300042616 Bacteria 1398
7 Ga0160448_115446 3300012854 Bacteria 1380
8 Ga0466691_199153 3300042593 Bacteria 2656
9 Ga0466697_229685 3300042611 Bacteria 3954
10 Ga0102734_1010973 3300007129 Unclassified 3447
11 Ga0102740_1001744 3300007140 Bacteria 5320
12 Ga0466697_012415 3300042611 Bacteria 5331
13 Ga0123354_10022287 3300010882 Unclassified 9985
14 Ga0466710_104398 3300042613 Bacteria 2488
15 Ga0466710_176070 3300042613 Bacteria 17789
16 Ga0466657_053073 3300042582 Bacteria 114727
17 Ga0466701_004419 3300042598 Bacteria 102474
18 Ga0466703_371953 3300042636 Bacteria 6543
19 Ga0466709_395224 3300042648 Bacteria 3492
20 JGI24695J34938_10000649 3300002450 Bacteria 33230
21 JGI24705J35276_12237438 3300002504 Unclassified 11141
22 CVPL005L_10004666 3300002938 Bacteria 14569
23 Ga0102737_1006165 3300007142 Unclassified 2313
24 Ga0123357_10001417 3300009784 Unclassified 25394
25 Ga0466707_149542 3300042601 Bacteria 11249
26 Ga0466713_052888 3300042602 Bacteria 2320
27 Ga0123354_10257532 3300010882 Bacteria 1751
28 Ga0466705_499862 3300042612 Bacteria 3970
29 Ga0160470_101637 3300012813 Bacteria 5150
30 Ga0160458_102286 3300012832 Bacteria 2668
31 Ga0160446_101487 3300012835 Bacteria 4983
32 Ga0160460_101745 3300012845 Bacteria 6351
33 Ga0160435_1002070 3300012857 Unclassified 4927
34 Ga0466690_149836 3300042590 Bacteria 1437
35 Ga0466696_179603 3300042596 Bacteria 2942
36 Ga0466696_429262 3300042596 Bacteria 13084
37 Ga0466731_124687 3300042622 Bacteria 1552
38 Ga0466704_187304 3300042643 Bacteria 32344
39 Ga0466725_285254 3300042654 Bacteria 86814
40 Ga0466727_335426 3300042655 Unclassified 4233
41 Ga0466701_044926 3300042598 Bacteria 108752
42 Ga0466713_070202 3300042602 Bacteria 33229
43 Ga0466717_243495 3300042604 Unclassified 10085
44 Ga0466716_154458 3300042605 Bacteria 4092
45 Ga0466716_494308 3300042605 Bacteria 4150
46 Ga0123357_10197409 3300009784 Bacteria 2300
47 Ga0466710_361536 3300042613 Bacteria 65742
48 Ga0466726_001250 3300042619 Bacteria 5250
49 Ga0466728_210745 3300042620 Bacteria 5799
50 Ga0160468_101242 3300012819 Bacteria 6806
51 Ga0466657_385965 3300042582 Bacteria 1975
52 Ga0466734_010466 3300042623 Bacteria 2402
53 Ga0466734_060661 3300042623 Bacteria 37945
54 Ga0466734_107537 3300042623 Bacteria 6001
55 Ga0466730_009867 3300042625 Bacteria 12667
56 Ga0466730_078413 3300042625 Unclassified 3564
57 Ga0466704_526217 3300042643 Bacteria 23009
58 Ga0466725_096048 3300042654 Bacteria 4605
59 Ga0466725_179777 3300042654 Bacteria 1402
60 Ga0466725_292043 3300042654 Bacteria 3203
61 Ga0466725_335827 3300042654 Bacteria 8573
62 CVPL010W_10000798 3300002931 Bacteria 35439
63 Ga0103263_100176 3300007042 Unclassified 10534
64 Ga0102738_1007775 3300007141 Bacteria 1477
65 Ga0123357_10000005 3300009784 Bacteria 295874
66 Ga0466701_058339 3300042598 Bacteria 35267
67 Ga0466717_088379 3300042604 Unclassified 9432
68 Ga0466722_002343 3300042609 Bacteria 14494
69 Ga0123354_10208673 3300010882 Bacteria 2119
70 Ga0160471_100410 3300012812 Unclassified 12636
71 Ga0466715_199167 3300042616 Bacteria 2176
72 Ga0160452_100268 3300012834 Bacteria 49951
73 Ga0160436_1003016 3300012861 Bacteria 4180
74 Ga0466657_351241 3300042582 Bacteria 2254
75 Ga0466691_047970 3300042593 Bacteria 6985
76 Ga0466705_113034 3300042612 Unclassified 11887
77 IMNBL1DRAFT_c0001041 3300000062 Bacteria 21490
78 Ga0466701_060740 3300042598 Bacteria 107748
79 Ga0466706_093682 3300042599 Bacteria 8644
80 Ga0466721_045198 3300042608 Bacteria 2484
81 Ga0466722_017244 3300042609 Bacteria 14275
82 Ga0123356_10029175 3300010049 Bacteria 5169
83 Ga0160466_100007 3300012809 Bacteria 474135
84 Ga0466711_043222 3300042615 Bacteria 5250
85 Ga0466715_140653 3300042616 Bacteria 2197
86 Ga0160447_101161 3300012849 Unclassified 10545
87 Ga0466692_049502 3300042591 Bacteria 26947
88 Ga0466734_009964 3300042623 Bacteria 4156
89 Ga0466734_029276 3300042623 Bacteria 8193
90 Ga0466734_170622 3300042623 Bacteria 1780
91 Ga0466735_004190 3300042624 Bacteria 7635
92 Ga0466724_23079 3300042649 Bacteria 108720
93 Ga0466725_193463 3300042654 Bacteria 19885
94 Ga0102735_1000077 3300007080 Bacteria 25727
95 Ga0102734_1000611 3300007129 Bacteria 10323
96 Ga0103267_1000094 3300007190 Unclassified 45572
97 Ga0466697_041003 3300042611 Unclassified 4311
98 Ga0123356_10058246 3300010049 Bacteria 3602
99 Ga0123353_10211829 3300010167 Bacteria 3039
100 Ga0466726_089611 3300042619 Bacteria 3039
101 Ga0160447_114608 3300012849 Bacteria 1490
102 Ga0530661_001273 3300056564 Bacteria 13450
103 Ga0466730_096004 3300042625 Bacteria 122670
104 Ga0466709_055681 3300042648 Unclassified 2157
105 Ga0466724_03562 3300042649 Bacteria 118958
106 Ga0466724_24594 3300042649 Bacteria 16397
107 Ga0466724_29472 3300042649 Bacteria 417400
108 Ga0466708_100452 3300042652 Bacteria 3175
109 Ga0466725_328244 3300042654 Bacteria 2114
110 Ga0103266_1000029 3300007067 Bacteria 65942
111 Ga0102734_1000342 3300007129 Unclassified 17206
112 Ga0123357_10000467 3300009784 Bacteria 39326
113 Ga0466701_077295 3300042598 Bacteria 4028
114 Ga0466717_151928 3300042604 Bacteria 3458
115 Ga0123356_10000941 3300010049 Bacteria 32233
116 Ga0160454_101414 3300012798 Unclassified 3548
117 Ga0466723_113926 3300042618 Bacteria 26979
118 Ga0160434_108707 3300012850 Unclassified 1665
119 Ga0160430_102221 3300012852 Unclassified 6309
120 Ga0466692_026327 3300042591 Bacteria 2229
121 Ga0466696_182462 3300042596 Unclassified 2568

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042616 Ga0466715_212143 Ga0466715_212143_28_876 282
2 3300042623 Ga0466734_009964 Ga0466734_009964_2358_3368 303
3 3300042605 Ga0466716_494308 Ga0466716_494308_1623_2630 307
4 3300012809 Ga0160466_100007 Ga0160466_100007406 308
5 3300012834 Ga0160452_100268 Ga0160452_1002682 308
6 3300012852 Ga0160430_102221 Ga0160430_1022219 308
7 3300042582 Ga0466657_351241 Ga0466657_351241_700_1710 315
8 3300042623 Ga0466734_170622 Ga0466734_170622_129_1082 317
9 3300012813 Ga0160470_101637 Ga0160470_1016378 318
10 3300012857 Ga0160435_1002070 Ga0160435_10020705 318
11 3300042654 Ga0466725_193463 Ga0466725_193463_13341_14336 320
12 3300042648 Ga0466709_395224 Ga0466709_395224_1879_2886 321
13 3300042609 Ga0466722_017244 Ga0466722_017244_3244_4251 322
14 3300042648 Ga0466709_055681 Ga0466709_055681_209_1216 322
15 3300042652 Ga0466708_051044 Ga0466708_051044_1838_2848 322
16 3300042649 Ga0466724_24594 Ga0466724_24594_772_1782 323
17 3300007129 Ga0102734_1000342 Ga0102734_100034213 329
18 3300007142 Ga0102737_1006165 Ga0102737_10061651 329
19 3300012845 Ga0160460_101745 Ga0160460_1017455 329
20 3300042654 Ga0466725_292043 Ga0466725_292043_1939_2949 329
21 3300042582 Ga0466657_385965 Ga0466657_385965_771_1763 330
22 3300012832 Ga0160458_102286 Ga0160458_1022863 331
23 3300056564 Ga0530661_001273 Ga0530661_001273_7900_8913 331
24 3300042591 Ga0466692_026327 Ga0466692_026327_420_1448 332
25 3300042643 Ga0466704_526217 Ga0466704_526217_1854_2852 332
26 3300007080 Ga0102735_1000077 Ga0102735_10000774 333
27 3300009784 Ga0123357_10000005 Ga0123357_1000000570 333
28 3300042593 Ga0466691_047970 Ga0466691_047970_3903_4904 333
29 3300042612 Ga0466705_499862 Ga0466705_499862_714_1715 333
30 3300042623 Ga0466734_060661 Ga0466734_060661_32822_33823 333
31 iso_pr_bacteria 2820103659 2820104706 333
32 iso_pr_bacteria 2864870719 2864872648 333
33 iso_pr_bacteria 2864968865 2864971308 333
34 3300007129 Ga0102734_1000611 Ga0102734_10006115 334
35 3300042643 Ga0466704_569178 Ga0466704_569178_861_1865 334
36 3300007190 Ga0103267_1000094 Ga0103267_10000949 335
37 3300042582 Ga0466657_053073 Ga0466657_053073_46758_47765 335
38 3300042590 Ga0466690_149836 Ga0466690_149836_167_1174 335
39 3300042591 Ga0466692_049502 Ga0466692_049502_9656_10663 335
40 3300042593 Ga0466691_199153 Ga0466691_199153_474_1481 335
41 3300042596 Ga0466696_179603 Ga0466696_179603_1686_2693 335
42 3300042596 Ga0466696_182462 Ga0466696_182462_124_1131 335
43 3300042596 Ga0466696_429262 Ga0466696_429262_3601_4608 335
44 3300042599 Ga0466706_093682 Ga0466706_093682_4963_5970 335
45 3300042601 Ga0466707_149542 Ga0466707_149542_5534_6541 335
46 3300042602 Ga0466713_052888 Ga0466713_052888_326_1333 335
47 3300042605 Ga0466716_154458 Ga0466716_154458_592_1599 335
48 3300042606 Ga0466719_262077 Ga0466719_262077_875_1882 335
49 3300042612 Ga0466705_113034 Ga0466705_113034_1125_2132 335
50 3300042613 Ga0466710_361536 Ga0466710_361536_62457_63464 335
51 3300042615 Ga0466711_043222 Ga0466711_043222_3931_4938 335
52 3300042616 Ga0466715_140653 Ga0466715_140653_555_1562 335
53 3300042618 Ga0466723_113926 Ga0466723_113926_18364_19371 335
54 3300042619 Ga0466726_001250 Ga0466726_001250_895_1902 335
55 3300042619 Ga0466726_089611 Ga0466726_089611_1084_2091 335
56 3300042623 Ga0466734_107537 Ga0466734_107537_489_1496 335
57 3300042624 Ga0466735_004190 Ga0466735_004190_657_1664 335
58 3300042636 Ga0466703_371953 Ga0466703_371953_4358_5365 335
59 3300042643 Ga0466704_187304 Ga0466704_187304_3956_4963 335
60 3300042652 Ga0466708_100452 Ga0466708_100452_472_1479 335
61 3300042654 Ga0466725_285254 Ga0466725_285254_21311_22318 335
62 3300042655 Ga0466727_335426 Ga0466727_335426_150_1157 335
63 iso_pr_bacteria 2820071837 2820072672 335
64 iso_pr_bacteria 2820132692 2820133930 335
65 iso_pr_bacteria 2820152154 2820153740 335
66 iso_pr_bacteria 2848339753 2848341477 335
67 3300000062 IMNBL1DRAFT_c0001041 IMNBL1DRAFT_000104110 336
68 3300010049 Ga0123356_10058246 Ga0123356_100582463 336
69 3300042598 Ga0466701_004419 Ga0466701_004419_86183_87193 336
70 3300042598 Ga0466701_044926 Ga0466701_044926_90189_91199 336
71 3300042598 Ga0466701_058339 Ga0466701_058339_13775_14785 336
72 3300042598 Ga0466701_077295 Ga0466701_077295_2926_3936 336
73 3300042604 Ga0466717_151928 Ga0466717_151928_116_1126 336
74 3300042604 Ga0466717_243495 Ga0466717_243495_894_1904 336
75 3300042608 Ga0466721_045198 Ga0466721_045198_876_1886 336
76 3300042611 Ga0466697_012415 Ga0466697_012415_2694_3704 336
77 3300042611 Ga0466697_041003 Ga0466697_041003_1247_2257 336
78 3300042611 Ga0466697_229685 Ga0466697_229685_34_1044 336
79 3300042613 Ga0466710_104398 Ga0466710_104398_1337_2347 336
80 3300042613 Ga0466710_176070 Ga0466710_176070_2389_3399 336
81 3300042620 Ga0466728_210745 Ga0466728_210745_970_1980 336
82 3300042622 Ga0466731_124687 Ga0466731_124687_73_1083 336
83 3300042623 Ga0466734_010466 Ga0466734_010466_304_1314 336
84 3300042623 Ga0466734_029276 Ga0466734_029276_6986_7996 336
85 3300042625 Ga0466730_009867 Ga0466730_009867_9205_10215 336
86 3300042625 Ga0466730_078413 Ga0466730_078413_2309_3319 336
87 3300042625 Ga0466730_096004 Ga0466730_096004_23848_24858 336
88 3300042649 Ga0466724_03562 Ga0466724_03562_64564_65574 336
89 3300042649 Ga0466724_23079 Ga0466724_23079_52693_53703 336
90 3300042654 Ga0466725_096048 Ga0466725_096048_1555_2565 336
91 3300042654 Ga0466725_335827 Ga0466725_335827_5403_6413 336
92 3300042659 Ga0466733_098838 Ga0466733_098838_1595_2605 336
93 iso_pr_bacteria 2597489944 2598057396 336
94 iso_pr_bacteria 2820059968 2820061796 336
95 iso_pr_bacteria 2834230000 2834230027 336
96 iso_pr_bacteria 2864755708 2864760139 336
97 iso_pr_bacteria 2864826666 2864828199 336
98 iso_pr_bacteria 2864937364 2864942914 336
99 iso_pr_bacteria 2864960361 2864962296 336
100 iso_pr_bacteria 2868169047 2868169049 336
101 iso_pr_bacteria 3003869270 3003871031 336
102 iso_pr_bacteria 3003878002 3003880031 336
103 iso_pr_bacteria 3003878002 3003884654 336
104 iso_pr_bacteria 8023724303 8023729514 336
105 iso_pr_bacteria 8023747282 8023752512 336
106 iso_pr_bacteria 8023752828 8023755213 336
107 iso_pr_bacteria 8023757577 8023762788 336
108 iso_pr_bacteria 8023764196 8023771443 336
109 iso_pr_bacteria 8024001094 8024002515 336
110 iso_pr_bacteria 8024014383 8024015589 336
111 iso_pr_bacteria 8024019580 8024021164 336
112 iso_pr_bacteria 8024025509 8024026971 336
113 iso_pr_bacteria 8024031916 8024033638 336
114 iso_pr_bacteria 8024037630 8024038971 336
115 iso_pr_bacteria 8024044713 8024046024 336
116 iso_pr_bacteria 8025650824 8025652114 336
117 iso_pr_bacteria 8025658853 8025660440 336
118 iso_pr_bacteria 8025666332 8025667577 336
119 iso_pr_bacteria 8025671076 8025672334 336
120 iso_pr_bacteria 8025678175 8025679439 336
121 iso_pr_bacteria 8025685901 8025687563 336
122 iso_pr_bacteria 8025694439 8025695790 336
123 iso_pr_bacteria 8025701579 8025704608 336
124 iso_pr_bacteria 8025708040 8025709375 336
125 iso_pr_bacteria 8025716094 8025717719 336
126 iso_pr_bacteria 8025723035 8025724254 336
127 iso_pr_bacteria 8025728939 8025730385 336
128 iso_pr_bacteria 8025735396 8025737709 336
129 iso_pr_bacteria 8025740903 8025742147 336
130 iso_pr_bacteria 8025747911 8025749172 336
131 iso_pr_bacteria 8025756023 8025757284 336
132 iso_pr_bacteria 8069748016 8069750623 336
133 iso_pr_bacteria 8069755105 8069756366 336
134 iso_pr_bacteria 8069763219 8069764463 336
135 iso_pr_bacteria 8069770227 8069775457 336
136 iso_pr_bacteria 8069775773 8069778158 336
137 iso_pr_bacteria 8078130113 8078131445 336
138 iso_pr_bacteria 8100449422 8100451424 336
139 iso_pr_bacteria 8100455565 8100461394 336
140 iso_pr_bacteria 8100461708 8100461737 336
141 iso_pr_bacteria 8101951471 8101952808 336
142 iso_pr_bacteria 8101960468 8101961804 336
143 iso_pr_bacteria 8101967387 8101968720 336
144 iso_pr_bacteria 8101974301 8101975624 336
145 iso_pr_bacteria 8101981714 8101983049 336
146 iso_pr_bacteria 8101988189 8101989605 336
147 iso_pr_bacteria 8101994502 8101996047 336
148 iso_pr_bacteria 8102001125 8102002315 336
149 iso_pr_bacteria 8102007614 8102008898 336
150 iso_pr_bacteria 8102014801 8102016133 336
151 iso_pr_bacteria 8102020860 8102022460 336
152 iso_pr_bacteria 8102026984 8102028370 336
153 iso_pr_bacteria 8102033761 8102035347 336
154 iso_pr_bacteria 8102041249 8102042607 336
155 iso_pr_bacteria 8102047609 8102049039 336
156 iso_pr_bacteria 8102054868 8102056151 336
157 iso_pr_bacteria 8102060671 8102062232 336
158 iso_pr_bacteria 8102067727 8102069076 336
159 iso_pr_bacteria 8102074813 8102076287 336
160 iso_pr_bacteria 8102081745 8102083155 336
161 iso_pr_bacteria 8102087471 8102088847 336
162 iso_pr_bacteria 8102094248 8102095793 336
163 iso_pr_bacteria 8102102351 8102103615 336
164 iso_pr_bacteria 8102109360 8102110714 336
165 iso_pr_bacteria 8102117041 8102118294 336
166 iso_pr_bacteria 8102124461 8102125916 336
167 iso_pr_bacteria 8102131453 8102137142 336
168 iso_pr_bacteria 8102138357 8102139694 336
169 iso_pr_bacteria 8102145433 8102150644 336
170 iso_pr_bacteria 8102152052 8102159299 336
171 iso_pr_bacteria 8102161003 8102166074 336
172 iso_pr_bacteria 8102169119 8102171432 336
173 iso_pr_bacteria 8102174626 8102176072 336
174 iso_pr_bacteria 8102181083 8102182302 336
175 iso_pr_bacteria 8102186987 8102188612 336
176 iso_pr_bacteria 8102193924 8102195258 336
177 iso_pr_bacteria 8102201977 8102205006 336
178 iso_pr_bacteria 8102208438 8102209728 336
179 iso_pr_bacteria 8102216467 8102217818 336
180 iso_pr_bacteria 8102223607 8102224865 336
181 iso_pr_bacteria 8102230706 8102232368 336
182 iso_pr_bacteria 8102239244 8102240507 336
183 iso_pr_bacteria 8102246966 8102248211 336
184 iso_pr_bacteria 8102251710 8102253297 336
185 iso_pr_bacteria 8102264549 8102265971 336
186 iso_pr_bacteria 8102271933 8102273432 336
187 iso_pr_bacteria 8102279326 8102280621 336
188 iso_pr_bacteria 8102286609 8102288110 336
189 iso_pr_bacteria 8102312426 8102313767 336
190 3300002504 JGI24705J35276_12237438 JGI24705J35276_122374385 337
191 3300002938 CVPL005L_10004666 CVPL005L_100046662 337
192 3300007129 Ga0102734_1010973 Ga0102734_10109735 337
193 3300007140 Ga0102740_1001744 Ga0102740_10017444 337
194 3300009784 Ga0123357_10000467 Ga0123357_100004677 337
195 3300009784 Ga0123357_10197409 Ga0123357_101974094 337
196 3300010049 Ga0123356_10029175 Ga0123356_100291753 337
197 3300010167 Ga0123353_10211829 Ga0123353_102118292 337
198 3300010882 Ga0123354_10022287 Ga0123354_100222876 337
199 3300010882 Ga0123354_10208673 Ga0123354_102086731 337
200 3300010882 Ga0123354_10257532 Ga0123354_102575321 337
201 3300012798 Ga0160454_101414 Ga0160454_1014144 337
202 3300012812 Ga0160471_100410 Ga0160471_1004107 337
203 3300012819 Ga0160468_101242 Ga0160468_1012421 337
204 3300012835 Ga0160446_101487 Ga0160446_1014877 337
205 3300012849 Ga0160447_101161 Ga0160447_1011611 337
206 3300012849 Ga0160447_114608 Ga0160447_1146082 337
207 3300012850 Ga0160434_108707 Ga0160434_1087072 337
208 3300012854 Ga0160448_115446 Ga0160448_1154461 337
209 3300012861 Ga0160436_1003016 Ga0160436_10030164 337
210 3300042598 Ga0466701_060740 Ga0466701_060740_92689_93702 337
211 3300042649 Ga0466724_29472 Ga0466724_29472_387720_388733 337
212 iso_pr_bacteria 2873565274 2873568859 337
213 iso_pr_bacteria 2873571580 2873572799 337
214 3300042609 Ga0466722_002343 Ga0466722_002343_7980_8996 338
215 3300042616 Ga0466715_199167 Ga0466715_199167_243_1259 338
216 3300042602 Ga0466713_070202 Ga0466713_070202_22034_23053 339
217 iso_pr_bacteria 2820111668 2820114525 339
218 iso_pr_bacteria 2820134530 2820135630 339
219 iso_pr_bacteria 2820166269 2820166927 339
220 iso_pr_bacteria 2820168331 2820168462 339
221 iso_pr_bacteria 2820170025 2820170236 339
222 3300002450 JGI24695J34938_10000649 JGI24695J34938_1000064932 340
223 3300002931 CVPL010W_10000798 CVPL010W_1000079830 340
224 3300007042 Ga0103263_100176 Ga0103263_1001767 340
225 3300007067 Ga0103266_1000029 Ga0103266_100002920 340
226 3300007141 Ga0102738_1007775 Ga0102738_10077751 340
227 3300007192 Ga0103268_1000097 Ga0103268_100009722 340
228 3300009784 Ga0123357_10001417 Ga0123357_100014175 340
229 3300010049 Ga0123356_10000941 Ga0123356_1000094130 340
230 3300042604 Ga0466717_088379 Ga0466717_088379_2845_3867 340
231 iso_pr_bacteria 2820123897 2820124287 340
232 3300042654 Ga0466725_179777 Ga0466725_179777_63_1088 341
233 3300042654 Ga0466725_328244 Ga0466725_328244_319_1419 366
234 iso_pr_bacteria 2864878056 2864881509 443
235 iso_pr_bacteria 2864886855 2864890309 443

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01384 PHO4 Phosphate transporter family 55 355 0.93

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.