Protein Family IF10073

Metagenome Isolate
199 Members
64 Samples
187 Scaffolds
106.3 Avg Length

🧬 Representative Sequence

ID
3300042654|Ga0466725_255972|Ga0466725_255972_10828_11166
Length
112 aa
Sequence
MSKLHIKKGDIVYVNTGEDRGKTGRVLKVLVEEQRAIVEGINMVTKHAKPSTKSPQGGREKQEASVHISNLNPLDPKSGKPTRVGRKLAAAGSKKKAEKYVRYAKKSGEELK

📊 Sample Types

Isolate 6.0%
Metagenome 94.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 39.7%
Kalotermitidae 22.2%
Blattidae 15.9%
Termopsidae 6.3%
Unclassified 6.3%
Rhinotermitidae 4.8%
Passalidae 3.2%
Hodotermitidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 193
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
2 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
3 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
4 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
5 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
6 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
7 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
8 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
9 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
10 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
11 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
14 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
15 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
16 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
17 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
18 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
19 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
20 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
21 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
22 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
23 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
24 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
25 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
26 3004667792 Bacteroides sp. 519 Isolate Blattidae
27 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
28 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
29 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
30 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
31 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
32 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
33 2923982719 Parabacteroides sp. 52 Isolate Blattidae
34 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
35 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
36 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
37 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
38 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
39 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
40 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
41 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
42 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
43 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
44 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
45 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
46 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
47 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
48 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
49 2922326829 Bacteroides sp. 224 Isolate Blattidae
50 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
51 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
52 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
53 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
54 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
55 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
56 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
57 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
58 3004672520 Bacteroides sp. 51 Isolate Blattidae
59 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
60 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
61 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
62 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
63 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
64 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_089766 3300042612 Bacteria 11993
2 Ga0466705_111418 3300042612 Bacteria 19183
3 Ga0466727_349423 3300042655 Bacteria 30219
4 Ga0466732_257409 3300042656 Bacteria 6667
5 Ga0466731_324753 3300042622 Bacteria 1336
6 Ga0466734_046575 3300042623 Bacteria 1614
7 Ga0466704_601523 3300042643 Bacteria 55044
8 Ga0466709_060190 3300042648 Bacteria 23292
9 Ga0466708_254314 3300042652 Bacteria 24323
10 Ga0466725_037990 3300042654 Bacteria 18222
11 Ga0466725_255972 3300042654 Bacteria 39464
12 Ga0466690_176909 3300042590 Unclassified 2744
13 Ga0466693_118156 3300042592 Bacteria 1058
14 Ga0466691_066359 3300042593 Bacteria 26336
15 Ga0123353_11673505 3300010167 Bacteria 799
16 Ga0466711_095236 3300042615 Bacteria 15743
17 Ga0466711_120016 3300042615 Bacteria 45710
18 Ga0466711_226259 3300042615 Bacteria 4193
19 Ga0466715_025469 3300042616 Bacteria 20577
20 Ga0466718_105474 3300042617 Bacteria 1253
21 Ga0466726_242160 3300042619 Bacteria 13880
22 Ga0466728_396202 3300042620 Bacteria 2581
23 Ga0466701_036012 3300042598 Bacteria 5947
24 Ga0466713_002076 3300042602 Bacteria 1197
25 Ga0466713_027800 3300042602 Bacteria 40167
26 Ga0466713_035081 3300042602 Bacteria 6541
27 Ga0466720_147391 3300042607 Bacteria 1195
28 Ga0466698_294665 3300042610 Bacteria 1732
29 2227160800 2225789004 Bacteria 1554
30 IMNBL1DRAFT_c0007574 3300000062 Bacteria 5682
31 IMNBL1DRAFT_c0012380 3300000062 Bacteria 3905
32 JGI24698J34947_10009875 3300002449 Bacteria 5232
33 Ga0068302_10164744 3300005071 Bacteria 1908
34 Ga0466697_233826 3300042611 Bacteria 2096
35 Ga0466705_019476 3300042612 Bacteria 24974
36 Ga0466705_038128 3300042612 Bacteria 49408
37 Ga0466733_132245 3300042659 Bacteria 2692
38 Ga0466735_177951 3300042624 Bacteria 10162
39 Ga0466703_019525 3300042636 Bacteria 29012
40 Ga0466704_472759 3300042643 Bacteria 20123
41 Ga0466704_552057 3300042643 Bacteria 6449
42 Ga0466709_235305 3300042648 Bacteria 3321
43 Ga0466727_029649 3300042655 Bacteria 1876
44 Ga0466656_127609 3300042550 Bacteria 23908
45 Ga0466691_204814 3300042593 Bacteria 23707
46 Ga0466696_323477 3300042596 Bacteria 3373
47 Ga0466705_405321 3300042612 Unclassified 1477
48 Ga0466715_016723 3300042616 Bacteria 13247
49 Ga0466723_058528 3300042618 Bacteria 28595
50 Ga0466706_065455 3300042599 Bacteria 2096
51 Ga0466706_264266 3300042599 Bacteria 6035
52 Ga0466716_483438 3300042605 Bacteria 16673
53 Ga0466722_161726 3300042609 Bacteria 14778
54 2227507944 2225789004 Bacteria 72999
55 2227667134 2225789004 Bacteria 1917
56 IMNBL1DRAFT_c0002479 3300000062 Bacteria 12828
57 JGI24696J40584_12659745 3300002834 Unclassified 701
58 Ga0466733_028819 3300042659 Bacteria 27870
59 Ga0466731_180586 3300042622 Bacteria 2122
60 Ga0466735_032961 3300042624 Bacteria 1310
61 Ga0466703_109702 3300042636 Bacteria 21153
62 Ga0466703_259701 3300042636 Bacteria 11196
63 Ga0466703_348714 3300042636 Bacteria 36764
64 Ga0466709_083357 3300042648 Bacteria 39489
65 Ga0466708_143755 3300042652 Bacteria 8647
66 Ga0466727_289772 3300042655 Bacteria 14123
67 Ga0466690_136616 3300042590 Bacteria 29160
68 Ga0466696_145947 3300042596 Unclassified 1027
69 Ga0466710_347724 3300042613 Bacteria 2111
70 Ga0466715_128269 3300042616 Bacteria 2365
71 Ga0466723_040344 3300042618 Bacteria 37666
72 Ga0466723_184116 3300042618 Bacteria 30069
73 Ga0466726_064923 3300042619 Bacteria 35500
74 Ga0466726_144476 3300042619 Bacteria 21004
75 Ga0466726_146380 3300042619 Bacteria 1549
76 Ga0466706_222694 3300042599 Bacteria 1811
77 Ga0466719_064833 3300042606 Bacteria 2202
78 Ga0466719_292822 3300042606 Bacteria 42754
79 2227107214 2225789004 Bacteria 1761
80 IMNBL1DRAFT_c0139215 3300000062 Bacteria 628
81 JGI24702J35022_10008763 3300002462 Bacteria 5711
82 JGI24705J35276_12186013 3300002504 Bacteria 1415
83 Ga0466703_249699 3300042636 Bacteria 47455
84 Ga0466708_135787 3300042652 Bacteria 29737
85 Ga0466696_236491 3300042596 Bacteria 25393
86 Ga0466696_367210 3300042596 Bacteria 9324
87 Ga0123353_12321014 3300010167 Bacteria 644
88 Ga0466711_092510 3300042615 Bacteria 9915
89 Ga0466711_212221 3300042615 Bacteria 10563
90 Ga0466715_643493 3300042616 Bacteria 6621
91 Ga0466723_257794 3300042618 Bacteria 2192
92 Ga0466723_373256 3300042618 Bacteria 33738
93 Ga0466726_462884 3300042619 Bacteria 2272
94 Ga0466728_346878 3300042620 Bacteria 2999
95 Ga0466707_398960 3300042601 Bacteria 15809
96 Ga0466713_137499 3300042602 Bacteria 46639
97 2227555189 2225789004 Bacteria 2799
98 IMNBL1DRAFT_c0000082 3300000062 Bacteria 85768
99 IMNBL1DRAFT_c0003005 3300000062 Bacteria 11178
100 JGI24698J34947_10051090 3300002449 Bacteria 2081
101 JGI24698J34947_10205859 3300002449 Bacteria 766
102 Ga0068302_10271211 3300005071 Bacteria 888
103 Ga0068305_10015112 3300005083 Bacteria 28238
104 Ga0072941_1219958 3300005201 Bacteria 2247
105 Ga0466735_035357 3300042624 Bacteria 1167
106 Ga0466702_025284 3300042635 Bacteria 1089
107 Ga0466703_374219 3300042636 Bacteria 24808
108 Ga0466704_004444 3300042643 Bacteria 24992
109 Ga0466704_609706 3300042643 Bacteria 1171
110 Ga0466709_400546 3300042648 Bacteria 20980
111 Ga0466656_294116 3300042550 Bacteria 2279
112 Ga0466690_170288 3300042590 Bacteria 25098
113 Ga0466690_248799 3300042590 Bacteria 9265
114 Ga0466695_284312 3300042595 Bacteria 2104
115 Ga0466696_396970 3300042596 Bacteria 18436
116 Ga0123356_10687077 3300010049 Unclassified 1192
117 Ga0466715_024383 3300042616 Bacteria 26866
118 Ga0466715_275548 3300042616 Bacteria 29682
119 Ga0466726_293348 3300042619 Bacteria 4805
120 Ga0466728_117468 3300042620 Bacteria 23405
121 Ga0466706_064416 3300042599 Bacteria 22081
122 Ga0466707_310750 3300042601 Unclassified 2171
123 Ga0466716_397647 3300042605 Bacteria 6519
124 Ga0466719_025390 3300042606 Bacteria 13141
125 Ga0466719_218070 3300042606 Bacteria 19356
126 Ga0466719_424805 3300042606 Bacteria 1163
127 IMNBL1DRAFT_c0028980 3300000062 Bacteria 2055
128 Ga0068302_10253966 3300005071 Bacteria 1523
129 Ga0068305_10401000 3300005083 Bacteria 1125
130 Ga0466705_375741 3300042612 Bacteria 24449
131 Ga0466735_152196 3300042624 Bacteria 3972
132 Ga0466704_300588 3300042643 Bacteria 28806
133 Ga0466690_287618 3300042590 Bacteria 16965
134 Ga0466691_045847 3300042593 Bacteria 49393
135 Ga0466712_134727 3300042614 Bacteria 1454
136 Ga0466711_137993 3300042615 Bacteria 2912
137 Ga0466711_159176 3300042615 Bacteria 1748
138 Ga0466726_097429 3300042619 Bacteria 22374
139 Ga0466728_018673 3300042620 Bacteria 22808
140 Ga0466719_504884 3300042606 Bacteria 4012
141 IMNBL1DRAFT_c0111627 3300000062 Bacteria 725
142 IMNBL1DRAFT_c0170624 3300000062 Bacteria 552
143 JGI24702J35022_10000547 3300002462 Bacteria 22726
144 JGI24696J40584_12946585 3300002834 Bacteria 1905
145 Ga0068305_10005585 3300005083 Bacteria 21211
146 Ga0068305_10026156 3300005083 Bacteria 20761
147 Ga0466705_023652 3300042612 Bacteria 16774
148 Ga0466702_018603 3300042635 Bacteria 2106
149 Ga0466703_073446 3300042636 Bacteria 8423
150 Ga0466704_415186 3300042643 Bacteria 17633
151 Ga0466709_223255 3300042648 Bacteria 9867
152 Ga0466708_169565 3300042652 Bacteria 34312
153 Ga0466727_099262 3300042655 Bacteria 17474
154 Ga0466696_053373 3300042596 Bacteria 10309
155 Ga0466705_502503 3300042612 Bacteria 16070
156 Ga0466711_007105 3300042615 Bacteria 19648
157 Ga0466715_119604 3300042616 Bacteria 22555
158 Ga0466723_093881 3300042618 Bacteria 35007
159 Ga0466700_337138 3300042600 Bacteria 1239
160 Ga0466716_335360 3300042605 Bacteria 11224
161 Ga0466719_102248 3300042606 Bacteria 3149
162 Ga0466698_327264 3300042610 Bacteria 8551
163 JGI24699J35502_11134150 3300002509 Bacteria 37878
164 Ga0068305_10002911 3300005083 Bacteria 2876
165 Ga0466735_082221 3300042624 Bacteria 1100
166 Ga0466703_325817 3300042636 Bacteria 5487
167 Ga0466704_477103 3300042643 Bacteria 9640
168 Ga0466708_340350 3300042652 Bacteria 78722
169 Ga0466727_040337 3300042655 Bacteria 31698
170 Ga0466727_050462 3300042655 Bacteria 20965
171 Ga0466727_212656 3300042655 Bacteria 11289
172 Ga0466690_032772 3300042590 Bacteria 29534
173 Ga0466690_175771 3300042590 Bacteria 56622
174 Ga0466690_261027 3300042590 Bacteria 17850
175 Ga0466690_306168 3300042590 Bacteria 1804
176 Ga0466692_015583 3300042591 Bacteria 1005
177 Ga0466691_039529 3300042593 Bacteria 29822
178 Ga0123356_10782185 3300010049 Bacteria 1125
179 Ga0123353_10659237 3300010167 Bacteria 1479
180 Ga0466711_248472 3300042615 Bacteria 12038
181 Ga0466715_586714 3300042616 Bacteria 57830
182 Ga0466726_494833 3300042619 Bacteria 4829
183 Ga0466706_029356 3300042599 Bacteria 3415
184 Ga0466706_183911 3300042599 Bacteria 19618
185 2227131383 2225789004 Bacteria 1658
186 JGI24702J35022_10000840 3300002462 Bacteria 18966
187 Ga0123357_10000330 3300009784 Bacteria 44905

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042611 Ga0466697_233826 Ga0466697_233826_1683_1958 91
2 3300002509 JGI24699J35502_11134150 JGI24699J35502_1113415033 92
3 3300042655 Ga0466727_029649 Ga0466727_029649_49_360 93
4 3300042593 Ga0466691_039529 Ga0466691_039529_20147_20482 95
5 3300000062 IMNBL1DRAFT_c0139215 IMNBL1DRAFT_01392151 97
6 3300042593 Ga0466691_045847 Ga0466691_045847_22964_23290 97
7 3300000062 IMNBL1DRAFT_c0111627 IMNBL1DRAFT_01116272 98
8 3300042602 Ga0466713_002076 Ga0466713_002076_457_771 104
9 3300042602 Ga0466713_137499 Ga0466713_137499_16670_16984 104
10 3300042606 Ga0466719_292822 Ga0466719_292822_24487_24801 104
11 3300042606 Ga0466719_424805 Ga0466719_424805_786_1100 104
12 3300042612 Ga0466705_111418 Ga0466705_111418_8872_9186 104
13 3300042615 Ga0466711_120016 Ga0466711_120016_23446_23760 104
14 3300042616 Ga0466715_586714 Ga0466715_586714_31609_31923 104
15 3300042616 Ga0466715_643493 Ga0466715_643493_406_720 104
16 3300042618 Ga0466723_257794 Ga0466723_257794_466_780 104
17 3300042619 Ga0466726_293348 Ga0466726_293348_2911_3225 104
18 3300042619 Ga0466726_462884 Ga0466726_462884_1927_2241 104
19 3300042619 Ga0466726_494833 Ga0466726_494833_4113_4427 104
20 3300042636 Ga0466703_249699 Ga0466703_249699_36232_36546 104
21 3300042636 Ga0466703_259701 Ga0466703_259701_312_626 104
22 3300042643 Ga0466704_300588 Ga0466704_300588_9096_9410 104
23 3300042643 Ga0466704_472759 Ga0466704_472759_8211_8525 104
24 3300042648 Ga0466709_400546 Ga0466709_400546_14145_14459 104
25 3300042652 Ga0466708_169565 Ga0466708_169565_23428_23742 104
26 3300042652 Ga0466708_254314 Ga0466708_254314_11404_11718 104
27 3300042655 Ga0466727_040337 Ga0466727_040337_18172_18486 104
28 3300042655 Ga0466727_349423 Ga0466727_349423_9193_9507 104
29 2225789004 2227160800 2227570253 105
30 3300005071 Ga0068302_10271211 Ga0068302_102712112 105
31 3300005083 Ga0068305_10005585 Ga0068305_1000558515 105
32 3300005083 Ga0068305_10015112 Ga0068305_1001511221 105
33 3300005083 Ga0068305_10401000 Ga0068305_104010002 105
34 3300042550 Ga0466656_127609 Ga0466656_127609_16796_17113 105
35 3300042550 Ga0466656_294116 Ga0466656_294116_888_1205 105
36 3300042590 Ga0466690_287618 Ga0466690_287618_12334_12651 105
37 3300042596 Ga0466696_053373 Ga0466696_053373_680_997 105
38 3300042598 Ga0466701_036012 Ga0466701_036012_877_1194 105
39 3300042599 Ga0466706_064416 Ga0466706_064416_18219_18536 105
40 3300042601 Ga0466707_398960 Ga0466707_398960_3884_4201 105
41 3300042606 Ga0466719_025390 Ga0466719_025390_320_637 105
42 3300042607 Ga0466720_147391 Ga0466720_147391_144_461 105
43 3300042610 Ga0466698_327264 Ga0466698_327264_3528_3845 105
44 3300042612 Ga0466705_405321 Ga0466705_405321_668_985 105
45 3300042616 Ga0466715_016723 Ga0466715_016723_370_687 105
46 3300042624 Ga0466735_177951 Ga0466735_177951_5140_5457 105
47 3300042635 Ga0466702_018603 Ga0466702_018603_1448_1765 105
48 3300042643 Ga0466704_609706 Ga0466704_609706_297_614 105
49 3300042654 Ga0466725_037990 Ga0466725_037990_5266_5583 105
50 3300042659 Ga0466733_132245 Ga0466733_132245_800_1117 105
51 iso_pr_bacteria 2940244548 2940244780 105
52 iso_pr_bacteria 2940248789 2940249020 105
53 iso_pr_bacteria 2940253009 2940253254 105
54 iso_pr_bacteria 2940257232 2940257694 105
55 2225789004 2227131383 2227528635 106
56 2225789004 2227667134 2228270697 106
57 3300002449 JGI24698J34947_10051090 JGI24698J34947_100510902 106
58 3300002462 JGI24702J35022_10000547 JGI24702J35022_1000054715 106
59 3300002504 JGI24705J35276_12186013 JGI24705J35276_121860131 106
60 3300005201 Ga0072941_1219958 Ga0072941_12199582 106
61 3300010049 Ga0123356_10687077 Ga0123356_106870772 106
62 3300042590 Ga0466690_136616 Ga0466690_136616_19808_20128 106
63 3300042590 Ga0466690_175771 Ga0466690_175771_44987_45307 106
64 3300042590 Ga0466690_176909 Ga0466690_176909_351_671 106
65 3300042590 Ga0466690_261027 Ga0466690_261027_7459_7779 106
66 3300042590 Ga0466690_306168 Ga0466690_306168_652_972 106
67 3300042593 Ga0466691_066359 Ga0466691_066359_13546_13866 106
68 3300042595 Ga0466695_284312 Ga0466695_284312_876_1196 106
69 3300042596 Ga0466696_367210 Ga0466696_367210_1312_1632 106
70 3300042599 Ga0466706_029356 Ga0466706_029356_784_1104 106
71 3300042599 Ga0466706_065455 Ga0466706_065455_784_1104 106
72 3300042599 Ga0466706_222694 Ga0466706_222694_554_874 106
73 3300042599 Ga0466706_264266 Ga0466706_264266_2152_2472 106
74 3300042601 Ga0466707_310750 Ga0466707_310750_1023_1343 106
75 3300042605 Ga0466716_397647 Ga0466716_397647_5787_6107 106
76 3300042606 Ga0466719_064833 Ga0466719_064833_1815_2135 106
77 3300042612 Ga0466705_089766 Ga0466705_089766_8793_9113 106
78 3300042612 Ga0466705_375741 Ga0466705_375741_14340_14660 106
79 3300042613 Ga0466710_347724 Ga0466710_347724_1195_1515 106
80 3300042615 Ga0466711_092510 Ga0466711_092510_581_901 106
81 3300042615 Ga0466711_095236 Ga0466711_095236_9538_9858 106
82 3300042615 Ga0466711_137993 Ga0466711_137993_1426_1746 106
83 3300042615 Ga0466711_159176 Ga0466711_159176_918_1238 106
84 3300042615 Ga0466711_212221 Ga0466711_212221_4359_4679 106
85 3300042615 Ga0466711_226259 Ga0466711_226259_1329_1649 106
86 3300042616 Ga0466715_025469 Ga0466715_025469_9803_10123 106
87 3300042616 Ga0466715_119604 Ga0466715_119604_11573_11893 106
88 3300042618 Ga0466723_184116 Ga0466723_184116_4681_5001 106
89 3300042619 Ga0466726_064923 Ga0466726_064923_5732_6052 106
90 3300042619 Ga0466726_146380 Ga0466726_146380_495_815 106
91 3300042620 Ga0466728_117468 Ga0466728_117468_9866_10186 106
92 3300042620 Ga0466728_346878 Ga0466728_346878_1953_2273 106
93 3300042622 Ga0466731_180586 Ga0466731_180586_1136_1456 106
94 3300042623 Ga0466734_046575 Ga0466734_046575_306_626 106
95 3300042624 Ga0466735_032961 Ga0466735_032961_579_899 106
96 3300042624 Ga0466735_035357 Ga0466735_035357_631_951 106
97 3300042624 Ga0466735_082221 Ga0466735_082221_188_508 106
98 3300042624 Ga0466735_152196 Ga0466735_152196_2605_2925 106
99 3300042635 Ga0466702_025284 Ga0466702_025284_683_1003 106
100 3300042636 Ga0466703_073446 Ga0466703_073446_1365_1685 106
101 3300042636 Ga0466703_374219 Ga0466703_374219_15402_15722 106
102 3300042643 Ga0466704_004444 Ga0466704_004444_11671_11991 106
103 3300042648 Ga0466709_083357 Ga0466709_083357_18878_19198 106
104 3300042648 Ga0466709_235305 Ga0466709_235305_1333_1653 106
105 3300042652 Ga0466708_143755 Ga0466708_143755_3127_3447 106
106 3300042652 Ga0466708_340350 Ga0466708_340350_63646_63966 106
107 3300042659 Ga0466733_028819 Ga0466733_028819_18498_18818 106
108 iso_pr_bacteria 2922326829 2922327962 106
109 iso_pr_bacteria 2923982719 2923983209 106
110 iso_pr_bacteria 2940202316 2940204404 106
111 iso_pr_bacteria 2940371297 2940373362 106
112 iso_pr_bacteria 3004667792 3004671192 106
113 iso_pr_bacteria 3004672520 3004672638 106
114 2225789004 2227507944 2227997712 107
115 2225789004 2227555189 2228087946 107
116 3300000062 IMNBL1DRAFT_c0003005 IMNBL1DRAFT_00030056 107
117 3300000062 IMNBL1DRAFT_c0012380 IMNBL1DRAFT_00123807 107
118 3300002834 JGI24696J40584_12659745 JGI24696J40584_126597452 107
119 3300002834 JGI24696J40584_12946585 JGI24696J40584_129465853 107
120 3300005071 Ga0068302_10253966 Ga0068302_102539663 107
121 3300005083 Ga0068305_10002911 Ga0068305_100029116 107
122 3300009784 Ga0123357_10000330 Ga0123357_1000033026 107
123 3300010167 Ga0123353_11673505 Ga0123353_116735052 107
124 3300010167 Ga0123353_12321014 Ga0123353_123210142 107
125 3300042590 Ga0466690_170288 Ga0466690_170288_4624_4947 107
126 3300042590 Ga0466690_248799 Ga0466690_248799_8194_8517 107
127 3300042592 Ga0466693_118156 Ga0466693_118156_107_430 107
128 3300042593 Ga0466691_204814 Ga0466691_204814_11964_12287 107
129 3300042596 Ga0466696_145947 Ga0466696_145947_500_823 107
130 3300042596 Ga0466696_236491 Ga0466696_236491_11293_11616 107
131 3300042596 Ga0466696_323477 Ga0466696_323477_1760_2083 107
132 3300042596 Ga0466696_396970 Ga0466696_396970_5122_5445 107
133 3300042599 Ga0466706_183911 Ga0466706_183911_18757_19080 107
134 3300042600 Ga0466700_337138 Ga0466700_337138_462_785 107
135 3300042605 Ga0466716_483438 Ga0466716_483438_10753_11076 107
136 3300042606 Ga0466719_218070 Ga0466719_218070_9461_9784 107
137 3300042610 Ga0466698_294665 Ga0466698_294665_727_1050 107
138 3300042612 Ga0466705_038128 Ga0466705_038128_24745_25068 107
139 3300042612 Ga0466705_502503 Ga0466705_502503_6038_6361 107
140 3300042614 Ga0466712_134727 Ga0466712_134727_108_476 107
141 3300042615 Ga0466711_007105 Ga0466711_007105_9670_9993 107
142 3300042615 Ga0466711_248472 Ga0466711_248472_10253_10576 107
143 3300042616 Ga0466715_024383 Ga0466715_024383_6419_6742 107
144 3300042616 Ga0466715_275548 Ga0466715_275548_10794_11117 107
145 3300042618 Ga0466723_040344 Ga0466723_040344_196_519 107
146 3300042618 Ga0466723_093881 Ga0466723_093881_10075_10398 107
147 3300042619 Ga0466726_097429 Ga0466726_097429_8990_9313 107
148 3300042620 Ga0466728_396202 Ga0466728_396202_1039_1362 107
149 3300042622 Ga0466731_324753 Ga0466731_324753_53_376 107
150 3300042636 Ga0466703_325817 Ga0466703_325817_1834_2157 107
151 3300042636 Ga0466703_348714 Ga0466703_348714_12889_13212 107
152 3300042643 Ga0466704_415186 Ga0466704_415186_6084_6407 107
153 3300042643 Ga0466704_601523 Ga0466704_601523_22044_22367 107
154 3300042648 Ga0466709_060190 Ga0466709_060190_13361_13684 107
155 3300042652 Ga0466708_135787 Ga0466708_135787_19369_19692 107
156 3300042655 Ga0466727_212656 Ga0466727_212656_7662_7985 107
157 iso_pr_bacteria 2609459943 2610740922 107
158 iso_pr_bacteria 2830041218 2830044064 107
159 2225789004 2227107214 2227493416 108
160 3300000062 IMNBL1DRAFT_c0000082 IMNBL1DRAFT_000008234 108
161 3300000062 IMNBL1DRAFT_c0002479 IMNBL1DRAFT_000247919 108
162 3300000062 IMNBL1DRAFT_c0007574 IMNBL1DRAFT_000757411 108
163 3300000062 IMNBL1DRAFT_c0028980 IMNBL1DRAFT_00289804 108
164 3300000062 IMNBL1DRAFT_c0170624 IMNBL1DRAFT_01706241 108
165 3300002449 JGI24698J34947_10009875 JGI24698J34947_100098755 108
166 3300002449 JGI24698J34947_10205859 JGI24698J34947_102058592 108
167 3300002462 JGI24702J35022_10000840 JGI24702J35022_1000084014 108
168 3300002462 JGI24702J35022_10008763 JGI24702J35022_100087639 108
169 3300010049 Ga0123356_10782185 Ga0123356_107821852 108
170 3300010167 Ga0123353_10659237 Ga0123353_106592372 109
171 3300042591 Ga0466692_015583 Ga0466692_015583_364_693 109
172 3300042606 Ga0466719_102248 Ga0466719_102248_2576_2908 110
173 3300042606 Ga0466719_504884 Ga0466719_504884_2539_2871 110
174 3300042616 Ga0466715_128269 Ga0466715_128269_1296_1628 110
175 3300042617 Ga0466718_105474 Ga0466718_105474_378_710 110
176 3300042618 Ga0466723_058528 Ga0466723_058528_18966_19298 110
177 3300042619 Ga0466726_144476 Ga0466726_144476_10306_10638 110
178 3300042636 Ga0466703_109702 Ga0466703_109702_9033_9365 110
179 3300042643 Ga0466704_477103 Ga0466704_477103_6151_6483 110
180 3300042655 Ga0466727_099262 Ga0466727_099262_8971_9303 110
181 3300042656 Ga0466732_257409 Ga0466732_257409_3166_3498 110
182 3300042590 Ga0466690_032772 Ga0466690_032772_23141_23476 111
183 3300042602 Ga0466713_027800 Ga0466713_027800_13132_13467 111
184 3300042602 Ga0466713_035081 Ga0466713_035081_2528_2863 111
185 3300042605 Ga0466716_335360 Ga0466716_335360_3994_4329 111
186 3300042612 Ga0466705_019476 Ga0466705_019476_5207_5542 111
187 3300042612 Ga0466705_023652 Ga0466705_023652_5216_5551 111
188 3300042618 Ga0466723_373256 Ga0466723_373256_9564_9899 111
189 3300042619 Ga0466726_242160 Ga0466726_242160_4804_5139 111
190 3300042620 Ga0466728_018673 Ga0466728_018673_10332_10667 111
191 3300042636 Ga0466703_019525 Ga0466703_019525_23289_23624 111
192 3300042643 Ga0466704_552057 Ga0466704_552057_6059_6394 111
193 3300042648 Ga0466709_223255 Ga0466709_223255_9429_9764 111
194 3300042655 Ga0466727_050462 Ga0466727_050462_9664_9999 111
195 3300042655 Ga0466727_289772 Ga0466727_289772_4801_5136 111
196 3300005071 Ga0068302_10164744 Ga0068302_101647445 112
197 3300005083 Ga0068305_10026156 Ga0068305_1002615616 112
198 3300042609 Ga0466722_161726 Ga0466722_161726_7404_7742 112
199 3300042654 Ga0466725_255972 Ga0466725_255972_10828_11166 112

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00467 KOW KOW motif 8 39 0.97
PF17136 ribosomal_L24 Ribosomal proteins 50S L24/mitochondrial 39S L24 41 111 0.92

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.75 0.79 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.