Protein Family IF10060

Metagenome Metatranscriptome Isolate
146 Members
51 Samples
138 Scaffolds
120.14 Avg Length

🧬 Representative Sequence

ID
3300042654|Ga0466725_181049|Ga0466725_181049_438_821
Length
127 aa
Sequence
MAISLSHNKHTAARTKARLRRQVRGRKKIHGTAARPRLVVTRSARHIGVQVVDDDRGHTLVSASTMEAELRGMDGNKTAKAKRVGELVAERATSAGLVAVVFDRAGHKYHGRVAALAEGARSGGLSF

📊 Sample Types

Isolate 5.5%
Metagenome 88.4%
MAG 0.0%
Metatranscriptome 6.2%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 62.2%
Unclassified 20.0%
Kalotermitidae 13.3%
Rhinotermitidae 4.4%

🌳 Taxonomy

Archaea 0
Bacteria 132
Eukaryota 0
Viruses 0
Unclassified 14

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
2 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
3 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
4 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
5 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
6 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
7 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
8 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
9 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
10 3300022232 Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA Metatranscriptome Termitidae
11 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
12 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
13 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
14 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
15 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
16 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
17 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
18 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
19 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
20 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
21 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
22 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
23 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
24 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
25 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
26 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
27 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
28 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
29 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
30 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
31 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
32 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
33 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
34 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
35 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
36 3300021237 Termite gut microbial communities from nest from French Guiana -FG16_15_2 mRNA SA Metatranscriptome
37 3300021222 Termite gut microbial communities from nest from French Guiana - FG16_17b_4 mRNA SA Metatranscriptome
38 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
39 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
40 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
41 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
42 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
43 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
44 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
45 3300021231 Termite gut microbial communities from nest - French Guiana - 10-1 mRNA SA Metatranscriptome Termitidae
46 3300022815 Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA Metatranscriptome Termitidae
47 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
48 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
49 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
50 3300021239 Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA Metatranscriptome
51 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_153482 3300042614 Bacteria 28564
2 Ga0466715_054330 3300042616 Bacteria 75121
3 Ga0466718_008773 3300042617 Bacteria 1750
4 Ga0466731_112954 3300042622 Bacteria 1755
5 Ga0466704_406505 3300042643 Bacteria 3111
6 Ga0466709_307692 3300042648 Bacteria 2923
7 Ga0123356_10009832 3300010049 Bacteria 9425
8 Ga0123356_10031375 3300010049 Bacteria 4972
9 Ga0123356_10552076 3300010049 Bacteria 1313
10 Ga0123356_10906557 3300010049 Bacteria 1053
11 Ga0123356_10977912 3300010049 Bacteria 1017
12 Ga0123356_12500588 3300010049 Bacteria 646
13 Ga0123353_10099513 3300010167 Bacteria 4686
14 Ga0123353_12374315 3300010167 Bacteria 635
15 Ga0466720_136390 3300042607 Bacteria 1135
16 Ga0466721_132248 3300042608 Bacteria 1097
17 Ga0255786_1010882 3300022815 Bacteria 1179
18 Ga0415639_073203 3300038395 Bacteria 2389
19 Ga0466693_293912 3300042592 Bacteria 55262
20 JGI24695J34938_10000139 3300002450 Bacteria 65941
21 JGI24695J34938_10009672 3300002450 Bacteria 5343
22 JGI24697J35500_11129585 3300002507 Bacteria 1263
23 Ga0466732_000936 3300042656 Bacteria 28842
24 Ga0466732_372060 3300042656 Unclassified 1672
25 Ga0466705_408099 3300042612 Bacteria 2253
26 Ga0466718_020308 3300042617 Bacteria 1028
27 Ga0466718_054171 3300042617 Unclassified 1490
28 Ga0123356_10154132 3300010049 Bacteria 2285
29 Ga0466700_402321 3300042600 Bacteria 7583
30 Ga0466722_146373 3300042609 Bacteria 3526
31 Ga0255809_1012423 3300022820 Unclassified 1007
32 Ga0415639_020078 3300038395 Bacteria 9049
33 Ga0466699_012121 3300042597 Bacteria 1404
34 Ga0466699_044569 3300042597 Bacteria 1782
35 JGI24695J34938_10044246 3300002450 Bacteria 1981
36 Ga0466705_343361 3300042612 Bacteria 14966
37 Ga0466712_231445 3300042614 Bacteria 33470
38 Ga0466712_321348 3300042614 Bacteria 11713
39 Ga0466715_183633 3300042616 Bacteria 1192
40 Ga0466718_072389 3300042617 Bacteria 2064
41 Ga0466731_120251 3300042622 Bacteria 7300
42 Ga0123356_10000433 3300010049 Bacteria 47783
43 Ga0123356_10579047 3300010049 Bacteria 1286
44 Ga0123356_13820551 3300010049 Bacteria 520
45 Ga0123353_12190352 3300010167 Bacteria 669
46 Ga0466713_154840 3300042602 Bacteria 3314
47 Ga0466720_164256 3300042607 Bacteria 1508
48 Ga0466694_004118 3300042594 Bacteria 27680
49 Ga0466694_053103 3300042594 Bacteria 3416
50 Ga0466699_287202 3300042597 Bacteria 1456
51 FAAS_10000071 3300001880 Bacteria 3854
52 JGI24698J34947_10042186 3300002449 Bacteria 2345
53 JGI24698J34947_10149345 3300002449 Unclassified 973
54 JGI24695J34938_10034945 3300002450 Bacteria 2302
55 JGI24695J34938_10043179 3300002450 Bacteria 2013
56 JGI24700J35501_10930895 3300002508 Bacteria 35929
57 Ga0072941_1020832 3300005201 Bacteria 3369
58 Ga0072941_1072581 3300005201 Bacteria 599
59 Ga0074263_102826 3300005485 Unclassified 2491
60 Ga0466705_387885 3300042612 Bacteria 1092
61 Ga0466729_293287 3300042621 Bacteria 6730
62 Ga0123356_10003129 3300010049 Bacteria 17446
63 Ga0123356_10392048 3300010049 Bacteria 1524
64 Ga0466720_228402 3300042607 Bacteria 2612
65 Ga0223682_1034220 3300021231 Bacteria 764
66 Ga0223675_1013615 3300021237 Unclassified 839
67 Ga0223677_1000907 3300021239 Unclassified 714
68 Ga0264413_125375 3300024493 Unclassified 2978
69 Ga0415639_089930 3300038395 Bacteria 3946
70 Ga0466694_064595 3300042594 Bacteria 4154
71 Ga0466699_289246 3300042597 Bacteria 1651
72 JGI24698J34947_10035764 3300002449 Bacteria 2589
73 JGI24695J34938_10000818 3300002450 Bacteria 28924
74 JGI24695J34938_10003415 3300002450 Bacteria 11120
75 JGI24695J34938_10004249 3300002450 Bacteria 9497
76 Ga0072941_1011233 3300005201 Bacteria 7205
77 Ga0072941_1032776 3300005201 Bacteria 3285
78 Ga0123356_10000598 3300010049 Bacteria 40012
79 Ga0123356_11052291 3300010049 Bacteria 983
80 Ga0123356_12923350 3300010049 Bacteria 597
81 Ga0123353_10066167 3300010167 Bacteria 5801
82 Ga0466720_052834 3300042607 Bacteria 34427
83 Ga0466720_138434 3300042607 Bacteria 4453
84 JGI24695J34938_10029164 3300002450 Bacteria 2584
85 JGI24695J34938_10029556 3300002450 Bacteria 2562
86 Ga0072940_1003019 3300005200 Bacteria 2007
87 Ga0466732_415737 3300042656 Bacteria 1199
88 Ga0466712_214752 3300042614 Bacteria 2238
89 Ga0466718_026590 3300042617 Bacteria 1622
90 Ga0466718_098235 3300042617 Unclassified 3063
91 Ga0466702_067081 3300042635 Bacteria 1016
92 Ga0466704_582723 3300042643 Bacteria 43560
93 Ga0123356_12076813 3300010049 Bacteria 709
94 Ga0466717_054515 3300042604 Bacteria 2696
95 Ga0223678_1002656 3300021222 Unclassified 1711
96 Ga0255809_1004135 3300022820 Unclassified 621
97 Ga0255809_1004384 3300022820 Unclassified 532
98 Ga0264413_100174 3300024493 Bacteria 4553
99 Ga0466693_355294 3300042592 Bacteria 2919
100 Ga0466694_050440 3300042594 Bacteria 148325
101 Ga0466699_000591 3300042597 Bacteria 3323
102 FAAS_10428714 3300001880 Bacteria 573
103 JGI24695J34938_10000152 3300002450 Bacteria 63361
104 JGI24695J34938_10020321 3300002450 Bacteria 3269
105 JGI24695J34938_10022598 3300002450 Bacteria 3050
106 Ga0072941_1091682 3300005201 Bacteria 2260
107 Ga0466732_156174 3300042656 Unclassified 1696
108 Ga0466712_063622 3300042614 Bacteria 1291
109 Ga0466715_385330 3300042616 Bacteria 2265
110 Ga0466702_406967 3300042635 Bacteria 1947
111 Ga0466703_115413 3300042636 Bacteria 35262
112 Ga0466725_181049 3300042654 Bacteria 1064
113 Ga0123356_10028481 3300010049 Bacteria 5233
114 Ga0123356_10164875 3300010049 Bacteria 2219
115 Ga0123356_12533834 3300010049 Bacteria 642
116 Ga0123353_10493279 3300010167 Bacteria 1787
117 Ga0233288_1005377 3300022232 Bacteria 1872
118 Ga0264413_104466 3300024493 Unclassified 4897
119 Ga0415639_031914 3300038395 Bacteria 2539
120 Ga0466695_349199 3300042595 Bacteria 1144
121 JGI24698J34947_10034348 3300002449 Bacteria 2655
122 JGI24695J34938_10023779 3300002450 Bacteria 2950
123 Ga0466732_282125 3300042656 Bacteria 20348
124 Ga0466712_226938 3300042614 Bacteria 2073
125 Ga0466718_104422 3300042617 Bacteria 1331
126 Ga0123356_10003877 3300010049 Bacteria 15570
127 Ga0123356_10040076 3300010049 Bacteria 4364
128 Ga0466719_401320 3300042606 Bacteria 1479
129 Ga0466719_468537 3300042606 Bacteria 80797
130 Ga0466720_072633 3300042607 Bacteria 3144
131 Ga0264413_110489 3300024493 Bacteria 4561
132 Ga0415639_032424 3300038395 Bacteria 4052
133 Ga0466694_021665 3300042594 Bacteria 1370
134 Ga0466699_163700 3300042597 Bacteria 58200
135 FAAS_10005486 3300001880 Bacteria 760
136 JGI24698J34947_10045490 3300002449 Bacteria 2239
137 JGI24695J34938_10023093 3300002450 Bacteria 3004
138 JGI24702J35022_10635353 3300002462 Bacteria 662

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2781125637 2781283122 105
2 3300005201 Ga0072941_1011233 Ga0072941_10112337 106
3 3300042595 Ga0466695_349199 Ga0466695_349199_448_798 116
4 3300042597 Ga0466699_000591 Ga0466699_000591_1104_1454 116
5 3300042597 Ga0466699_044569 Ga0466699_044569_781_1131 116
6 3300042609 Ga0466722_146373 Ga0466722_146373_1503_1853 116
7 3300042622 Ga0466731_120251 Ga0466731_120251_594_944 116
8 3300002450 JGI24695J34938_10023779 JGI24695J34938_100237795 117
9 3300010049 Ga0123356_11052291 Ga0123356_110522911 117
10 3300010049 Ga0123356_12533834 Ga0123356_125338341 117
11 3300010167 Ga0123353_10066167 Ga0123353_100661678 117
12 3300010167 Ga0123353_12374315 Ga0123353_123743152 117
13 3300042602 Ga0466713_154840 Ga0466713_154840_1232_1591 119
14 3300042606 Ga0466719_401320 Ga0466719_401320_222_581 119
15 3300042606 Ga0466719_468537 Ga0466719_468537_12450_12809 119
16 3300042612 Ga0466705_387885 Ga0466705_387885_275_634 119
17 3300042612 Ga0466705_408099 Ga0466705_408099_1729_2088 119
18 3300042616 Ga0466715_054330 Ga0466715_054330_42061_42420 119
19 3300021222 Ga0223678_1002656 Ga0223678_10026562 120
20 3300021231 Ga0223682_1034220 Ga0223682_10342201 120
21 3300021237 Ga0223675_1013615 Ga0223675_10136152 120
22 3300021239 Ga0223677_1000907 Ga0223677_10009072 120
23 3300022232 Ga0233288_1005377 Ga0233288_10053773 120
24 3300022815 Ga0255786_1010882 Ga0255786_10108823 120
25 3300022820 Ga0255809_1004135 Ga0255809_10041352 120
26 3300022820 Ga0255809_1004384 Ga0255809_10043842 120
27 3300022820 Ga0255809_1012423 Ga0255809_10124232 120
28 3300024493 Ga0264413_100174 Ga0264413_1001746 120
29 3300024493 Ga0264413_104466 Ga0264413_1044669 120
30 3300024493 Ga0264413_110489 Ga0264413_1104895 120
31 3300024493 Ga0264413_125375 Ga0264413_1253754 120
32 3300038395 Ga0415639_020078 Ga0415639_020078_4981_5343 120
33 3300038395 Ga0415639_031914 Ga0415639_031914_614_976 120
34 3300038395 Ga0415639_032424 Ga0415639_032424_2806_3168 120
35 3300038395 Ga0415639_073203 Ga0415639_073203_1288_1650 120
36 3300038395 Ga0415639_089930 Ga0415639_089930_2769_3131 120
37 3300042592 Ga0466693_293912 Ga0466693_293912_175_537 120
38 3300042592 Ga0466693_355294 Ga0466693_355294_1255_1617 120
39 3300042594 Ga0466694_004118 Ga0466694_004118_16337_16699 120
40 3300042594 Ga0466694_021665 Ga0466694_021665_51_413 120
41 3300042594 Ga0466694_050440 Ga0466694_050440_62475_62837 120
42 3300042594 Ga0466694_053103 Ga0466694_053103_3004_3366 120
43 3300042594 Ga0466694_064595 Ga0466694_064595_2833_3195 120
44 3300042597 Ga0466699_012121 Ga0466699_012121_476_838 120
45 3300042597 Ga0466699_163700 Ga0466699_163700_27492_27854 120
46 3300042597 Ga0466699_287202 Ga0466699_287202_416_778 120
47 3300042597 Ga0466699_289246 Ga0466699_289246_982_1344 120
48 3300042600 Ga0466700_402321 Ga0466700_402321_3309_3671 120
49 3300042604 Ga0466717_054515 Ga0466717_054515_1322_1684 120
50 3300042607 Ga0466720_052834 Ga0466720_052834_1392_1754 120
51 3300042607 Ga0466720_072633 Ga0466720_072633_2673_3035 120
52 3300042607 Ga0466720_136390 Ga0466720_136390_752_1114 120
53 3300042607 Ga0466720_138434 Ga0466720_138434_2391_2753 120
54 3300042607 Ga0466720_164256 Ga0466720_164256_650_1012 120
55 3300042607 Ga0466720_228402 Ga0466720_228402_1860_2222 120
56 3300042608 Ga0466721_132248 Ga0466721_132248_187_549 120
57 3300042614 Ga0466712_063622 Ga0466712_063622_356_718 120
58 3300042614 Ga0466712_153482 Ga0466712_153482_12029_12391 120
59 3300042614 Ga0466712_214752 Ga0466712_214752_989_1351 120
60 3300042614 Ga0466712_226938 Ga0466712_226938_1332_1694 120
61 3300042614 Ga0466712_231445 Ga0466712_231445_1022_1384 120
62 3300042614 Ga0466712_321348 Ga0466712_321348_3047_3409 120
63 3300042616 Ga0466715_385330 Ga0466715_385330_1421_1783 120
64 3300042617 Ga0466718_008773 Ga0466718_008773_647_1009 120
65 3300042617 Ga0466718_020308 Ga0466718_020308_246_608 120
66 3300042617 Ga0466718_026590 Ga0466718_026590_1197_1559 120
67 3300042617 Ga0466718_054171 Ga0466718_054171_663_1025 120
68 3300042617 Ga0466718_072389 Ga0466718_072389_1127_1489 120
69 3300042617 Ga0466718_098235 Ga0466718_098235_2521_2883 120
70 3300042617 Ga0466718_104422 Ga0466718_104422_843_1205 120
71 3300042621 Ga0466729_293287 Ga0466729_293287_2125_2487 120
72 3300042622 Ga0466731_112954 Ga0466731_112954_1174_1536 120
73 3300042635 Ga0466702_067081 Ga0466702_067081_190_552 120
74 3300042635 Ga0466702_406967 Ga0466702_406967_1500_1862 120
75 3300042648 Ga0466709_307692 Ga0466709_307692_1164_1526 120
76 3300042656 Ga0466732_000936 Ga0466732_000936_26010_26372 120
77 3300042656 Ga0466732_156174 Ga0466732_156174_686_1048 120
78 3300042656 Ga0466732_282125 Ga0466732_282125_3099_3461 120
79 3300042656 Ga0466732_372060 Ga0466732_372060_490_852 120
80 3300042656 Ga0466732_415737 Ga0466732_415737_161_523 120
81 iso_pr_bacteria 2781125644 2781297107 120
82 iso_pr_bacteria 2781125650 2781308731 120
83 iso_pr_bacteria 2781125657 2781323464 120
84 iso_pr_bacteria 2781125659 2781327433 120
85 iso_pr_bacteria 2781125660 2781331438 120
86 iso_pr_bacteria 2781125663 2781338064 120
87 iso_pr_bacteria 2819994798 2819998107 120
88 3300001880 FAAS_10000071 FAAS_100000717 121
89 3300001880 FAAS_10005486 FAAS_100054862 121
90 3300001880 FAAS_10428714 FAAS_104287141 121
91 3300002449 JGI24698J34947_10034348 JGI24698J34947_100343485 121
92 3300002449 JGI24698J34947_10035764 JGI24698J34947_100357644 121
93 3300002449 JGI24698J34947_10042186 JGI24698J34947_100421863 121
94 3300002449 JGI24698J34947_10045490 JGI24698J34947_100454902 121
95 3300002449 JGI24698J34947_10149345 JGI24698J34947_101493452 121
96 3300002450 JGI24695J34938_10000139 JGI24695J34938_1000013956 121
97 3300002450 JGI24695J34938_10000152 JGI24695J34938_1000015239 121
98 3300002450 JGI24695J34938_10000818 JGI24695J34938_1000081831 121
99 3300002450 JGI24695J34938_10003415 JGI24695J34938_100034155 121
100 3300002450 JGI24695J34938_10004249 JGI24695J34938_1000424910 121
101 3300002450 JGI24695J34938_10009672 JGI24695J34938_100096728 121
102 3300002450 JGI24695J34938_10020321 JGI24695J34938_100203211 121
103 3300002450 JGI24695J34938_10022598 JGI24695J34938_100225984 121
104 3300002450 JGI24695J34938_10023093 JGI24695J34938_100230935 121
105 3300002450 JGI24695J34938_10029164 JGI24695J34938_100291644 121
106 3300002450 JGI24695J34938_10029556 JGI24695J34938_100295564 121
107 3300002450 JGI24695J34938_10034945 JGI24695J34938_100349454 121
108 3300002450 JGI24695J34938_10043179 JGI24695J34938_100431793 121
109 3300002450 JGI24695J34938_10044246 JGI24695J34938_100442463 121
110 3300002507 JGI24697J35500_11129585 JGI24697J35500_111295852 121
111 3300002508 JGI24700J35501_10930895 JGI24700J35501_1093089517 121
112 3300005200 Ga0072940_1003019 Ga0072940_10030192 121
113 3300005201 Ga0072941_1020832 Ga0072941_10208323 121
114 3300005201 Ga0072941_1032776 Ga0072941_10327762 121
115 3300005201 Ga0072941_1072581 Ga0072941_10725812 121
116 3300005201 Ga0072941_1091682 Ga0072941_10916824 121
117 3300005485 Ga0074263_102826 Ga0074263_1028264 121
118 3300010049 Ga0123356_10000433 Ga0123356_1000043325 121
119 3300010049 Ga0123356_10000598 Ga0123356_1000059826 121
120 3300010049 Ga0123356_10003129 Ga0123356_1000312918 121
121 3300010049 Ga0123356_10003877 Ga0123356_1000387718 121
122 3300010049 Ga0123356_10009832 Ga0123356_100098322 121
123 3300010049 Ga0123356_10028481 Ga0123356_100284815 121
124 3300010049 Ga0123356_10031375 Ga0123356_100313753 121
125 3300010049 Ga0123356_10040076 Ga0123356_100400762 121
126 3300010049 Ga0123356_10154132 Ga0123356_101541323 121
127 3300010049 Ga0123356_10164875 Ga0123356_101648753 121
128 3300010049 Ga0123356_10392048 Ga0123356_103920483 121
129 3300010049 Ga0123356_10552076 Ga0123356_105520762 121
130 3300010049 Ga0123356_10579047 Ga0123356_105790472 121
131 3300010049 Ga0123356_10906557 Ga0123356_109065572 121
132 3300010049 Ga0123356_10977912 Ga0123356_109779122 121
133 3300010049 Ga0123356_12076813 Ga0123356_120768132 121
134 3300010049 Ga0123356_12500588 Ga0123356_125005881 121
135 3300010049 Ga0123356_12923350 Ga0123356_129233501 121
136 3300010049 Ga0123356_13820551 Ga0123356_138205511 121
137 3300010167 Ga0123353_10099513 Ga0123353_100995133 121
138 3300010167 Ga0123353_10493279 Ga0123353_104932794 121
139 3300010167 Ga0123353_12190352 Ga0123353_121903522 121
140 3300042643 Ga0466704_406505 Ga0466704_406505_1895_2260 121
141 3300002462 JGI24702J35022_10635353 JGI24702J35022_106353532 122
142 3300042612 Ga0466705_343361 Ga0466705_343361_67_450 127
143 3300042616 Ga0466715_183633 Ga0466715_183633_445_828 127
144 3300042636 Ga0466703_115413 Ga0466703_115413_20993_21376 127
145 3300042643 Ga0466704_582723 Ga0466704_582723_28263_28646 127
146 3300042654 Ga0466725_181049 Ga0466725_181049_438_821 127

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast 13 127 0.99

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.71 0.81 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.