Protein Family IF10060
Metagenome
Metatranscriptome
Isolate
146
Members
51
Samples
138
Scaffolds
120.14
Avg Length
Representative Sequence
- ID
- 3300042654|Ga0466725_181049|Ga0466725_181049_438_821
- Length
- 127 aa
- Sequence
- MAISLSHNKHTAARTKARLRRQVRGRKKIHGTAARPRLVVTRSARHIGVQVVDDDRGHTLVSASTMEAELRGMDGNKTAKAKRVGELVAERATSAGLVAVVFDRAGHKYHGRVAALAEGARSGGLSF
Sample Types
Isolate
5.5%
Metagenome
88.4%
MAG
0.0%
Metatranscriptome
6.2%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
62.2%
Unclassified
20.0%
Kalotermitidae
13.3%
Rhinotermitidae
4.4%
Taxonomy
Archaea
0
Bacteria
132
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 2 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 3 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 4 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 5 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 6 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 7 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 8 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 9 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 10 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 11 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 12 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 13 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 14 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 15 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 16 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 17 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 18 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 19 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 22 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 23 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 24 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 25 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 26 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 27 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 28 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 29 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 30 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 31 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 32 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 33 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 34 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 35 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 36 | 3300021237 | Termite gut microbial communities from nest from French Guiana -FG16_15_2 mRNA SA | Metatranscriptome | |
| 37 | 3300021222 | Termite gut microbial communities from nest from French Guiana - FG16_17b_4 mRNA SA | Metatranscriptome | |
| 38 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 39 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 40 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 41 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 42 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 43 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 44 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 45 | 3300021231 | Termite gut microbial communities from nest - French Guiana - 10-1 mRNA SA | Metatranscriptome | Termitidae |
| 46 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 47 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 48 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3300021239 | Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA | Metatranscriptome | |
| 51 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_153482 | 3300042614 | Bacteria | 28564 |
| 2 | Ga0466715_054330 | 3300042616 | Bacteria | 75121 |
| 3 | Ga0466718_008773 | 3300042617 | Bacteria | 1750 |
| 4 | Ga0466731_112954 | 3300042622 | Bacteria | 1755 |
| 5 | Ga0466704_406505 | 3300042643 | Bacteria | 3111 |
| 6 | Ga0466709_307692 | 3300042648 | Bacteria | 2923 |
| 7 | Ga0123356_10009832 | 3300010049 | Bacteria | 9425 |
| 8 | Ga0123356_10031375 | 3300010049 | Bacteria | 4972 |
| 9 | Ga0123356_10552076 | 3300010049 | Bacteria | 1313 |
| 10 | Ga0123356_10906557 | 3300010049 | Bacteria | 1053 |
| 11 | Ga0123356_10977912 | 3300010049 | Bacteria | 1017 |
| 12 | Ga0123356_12500588 | 3300010049 | Bacteria | 646 |
| 13 | Ga0123353_10099513 | 3300010167 | Bacteria | 4686 |
| 14 | Ga0123353_12374315 | 3300010167 | Bacteria | 635 |
| 15 | Ga0466720_136390 | 3300042607 | Bacteria | 1135 |
| 16 | Ga0466721_132248 | 3300042608 | Bacteria | 1097 |
| 17 | Ga0255786_1010882 | 3300022815 | Bacteria | 1179 |
| 18 | Ga0415639_073203 | 3300038395 | Bacteria | 2389 |
| 19 | Ga0466693_293912 | 3300042592 | Bacteria | 55262 |
| 20 | JGI24695J34938_10000139 | 3300002450 | Bacteria | 65941 |
| 21 | JGI24695J34938_10009672 | 3300002450 | Bacteria | 5343 |
| 22 | JGI24697J35500_11129585 | 3300002507 | Bacteria | 1263 |
| 23 | Ga0466732_000936 | 3300042656 | Bacteria | 28842 |
| 24 | Ga0466732_372060 | 3300042656 | Unclassified | 1672 |
| 25 | Ga0466705_408099 | 3300042612 | Bacteria | 2253 |
| 26 | Ga0466718_020308 | 3300042617 | Bacteria | 1028 |
| 27 | Ga0466718_054171 | 3300042617 | Unclassified | 1490 |
| 28 | Ga0123356_10154132 | 3300010049 | Bacteria | 2285 |
| 29 | Ga0466700_402321 | 3300042600 | Bacteria | 7583 |
| 30 | Ga0466722_146373 | 3300042609 | Bacteria | 3526 |
| 31 | Ga0255809_1012423 | 3300022820 | Unclassified | 1007 |
| 32 | Ga0415639_020078 | 3300038395 | Bacteria | 9049 |
| 33 | Ga0466699_012121 | 3300042597 | Bacteria | 1404 |
| 34 | Ga0466699_044569 | 3300042597 | Bacteria | 1782 |
| 35 | JGI24695J34938_10044246 | 3300002450 | Bacteria | 1981 |
| 36 | Ga0466705_343361 | 3300042612 | Bacteria | 14966 |
| 37 | Ga0466712_231445 | 3300042614 | Bacteria | 33470 |
| 38 | Ga0466712_321348 | 3300042614 | Bacteria | 11713 |
| 39 | Ga0466715_183633 | 3300042616 | Bacteria | 1192 |
| 40 | Ga0466718_072389 | 3300042617 | Bacteria | 2064 |
| 41 | Ga0466731_120251 | 3300042622 | Bacteria | 7300 |
| 42 | Ga0123356_10000433 | 3300010049 | Bacteria | 47783 |
| 43 | Ga0123356_10579047 | 3300010049 | Bacteria | 1286 |
| 44 | Ga0123356_13820551 | 3300010049 | Bacteria | 520 |
| 45 | Ga0123353_12190352 | 3300010167 | Bacteria | 669 |
| 46 | Ga0466713_154840 | 3300042602 | Bacteria | 3314 |
| 47 | Ga0466720_164256 | 3300042607 | Bacteria | 1508 |
| 48 | Ga0466694_004118 | 3300042594 | Bacteria | 27680 |
| 49 | Ga0466694_053103 | 3300042594 | Bacteria | 3416 |
| 50 | Ga0466699_287202 | 3300042597 | Bacteria | 1456 |
| 51 | FAAS_10000071 | 3300001880 | Bacteria | 3854 |
| 52 | JGI24698J34947_10042186 | 3300002449 | Bacteria | 2345 |
| 53 | JGI24698J34947_10149345 | 3300002449 | Unclassified | 973 |
| 54 | JGI24695J34938_10034945 | 3300002450 | Bacteria | 2302 |
| 55 | JGI24695J34938_10043179 | 3300002450 | Bacteria | 2013 |
| 56 | JGI24700J35501_10930895 | 3300002508 | Bacteria | 35929 |
| 57 | Ga0072941_1020832 | 3300005201 | Bacteria | 3369 |
| 58 | Ga0072941_1072581 | 3300005201 | Bacteria | 599 |
| 59 | Ga0074263_102826 | 3300005485 | Unclassified | 2491 |
| 60 | Ga0466705_387885 | 3300042612 | Bacteria | 1092 |
| 61 | Ga0466729_293287 | 3300042621 | Bacteria | 6730 |
| 62 | Ga0123356_10003129 | 3300010049 | Bacteria | 17446 |
| 63 | Ga0123356_10392048 | 3300010049 | Bacteria | 1524 |
| 64 | Ga0466720_228402 | 3300042607 | Bacteria | 2612 |
| 65 | Ga0223682_1034220 | 3300021231 | Bacteria | 764 |
| 66 | Ga0223675_1013615 | 3300021237 | Unclassified | 839 |
| 67 | Ga0223677_1000907 | 3300021239 | Unclassified | 714 |
| 68 | Ga0264413_125375 | 3300024493 | Unclassified | 2978 |
| 69 | Ga0415639_089930 | 3300038395 | Bacteria | 3946 |
| 70 | Ga0466694_064595 | 3300042594 | Bacteria | 4154 |
| 71 | Ga0466699_289246 | 3300042597 | Bacteria | 1651 |
| 72 | JGI24698J34947_10035764 | 3300002449 | Bacteria | 2589 |
| 73 | JGI24695J34938_10000818 | 3300002450 | Bacteria | 28924 |
| 74 | JGI24695J34938_10003415 | 3300002450 | Bacteria | 11120 |
| 75 | JGI24695J34938_10004249 | 3300002450 | Bacteria | 9497 |
| 76 | Ga0072941_1011233 | 3300005201 | Bacteria | 7205 |
| 77 | Ga0072941_1032776 | 3300005201 | Bacteria | 3285 |
| 78 | Ga0123356_10000598 | 3300010049 | Bacteria | 40012 |
| 79 | Ga0123356_11052291 | 3300010049 | Bacteria | 983 |
| 80 | Ga0123356_12923350 | 3300010049 | Bacteria | 597 |
| 81 | Ga0123353_10066167 | 3300010167 | Bacteria | 5801 |
| 82 | Ga0466720_052834 | 3300042607 | Bacteria | 34427 |
| 83 | Ga0466720_138434 | 3300042607 | Bacteria | 4453 |
| 84 | JGI24695J34938_10029164 | 3300002450 | Bacteria | 2584 |
| 85 | JGI24695J34938_10029556 | 3300002450 | Bacteria | 2562 |
| 86 | Ga0072940_1003019 | 3300005200 | Bacteria | 2007 |
| 87 | Ga0466732_415737 | 3300042656 | Bacteria | 1199 |
| 88 | Ga0466712_214752 | 3300042614 | Bacteria | 2238 |
| 89 | Ga0466718_026590 | 3300042617 | Bacteria | 1622 |
| 90 | Ga0466718_098235 | 3300042617 | Unclassified | 3063 |
| 91 | Ga0466702_067081 | 3300042635 | Bacteria | 1016 |
| 92 | Ga0466704_582723 | 3300042643 | Bacteria | 43560 |
| 93 | Ga0123356_12076813 | 3300010049 | Bacteria | 709 |
| 94 | Ga0466717_054515 | 3300042604 | Bacteria | 2696 |
| 95 | Ga0223678_1002656 | 3300021222 | Unclassified | 1711 |
| 96 | Ga0255809_1004135 | 3300022820 | Unclassified | 621 |
| 97 | Ga0255809_1004384 | 3300022820 | Unclassified | 532 |
| 98 | Ga0264413_100174 | 3300024493 | Bacteria | 4553 |
| 99 | Ga0466693_355294 | 3300042592 | Bacteria | 2919 |
| 100 | Ga0466694_050440 | 3300042594 | Bacteria | 148325 |
| 101 | Ga0466699_000591 | 3300042597 | Bacteria | 3323 |
| 102 | FAAS_10428714 | 3300001880 | Bacteria | 573 |
| 103 | JGI24695J34938_10000152 | 3300002450 | Bacteria | 63361 |
| 104 | JGI24695J34938_10020321 | 3300002450 | Bacteria | 3269 |
| 105 | JGI24695J34938_10022598 | 3300002450 | Bacteria | 3050 |
| 106 | Ga0072941_1091682 | 3300005201 | Bacteria | 2260 |
| 107 | Ga0466732_156174 | 3300042656 | Unclassified | 1696 |
| 108 | Ga0466712_063622 | 3300042614 | Bacteria | 1291 |
| 109 | Ga0466715_385330 | 3300042616 | Bacteria | 2265 |
| 110 | Ga0466702_406967 | 3300042635 | Bacteria | 1947 |
| 111 | Ga0466703_115413 | 3300042636 | Bacteria | 35262 |
| 112 | Ga0466725_181049 | 3300042654 | Bacteria | 1064 |
| 113 | Ga0123356_10028481 | 3300010049 | Bacteria | 5233 |
| 114 | Ga0123356_10164875 | 3300010049 | Bacteria | 2219 |
| 115 | Ga0123356_12533834 | 3300010049 | Bacteria | 642 |
| 116 | Ga0123353_10493279 | 3300010167 | Bacteria | 1787 |
| 117 | Ga0233288_1005377 | 3300022232 | Bacteria | 1872 |
| 118 | Ga0264413_104466 | 3300024493 | Unclassified | 4897 |
| 119 | Ga0415639_031914 | 3300038395 | Bacteria | 2539 |
| 120 | Ga0466695_349199 | 3300042595 | Bacteria | 1144 |
| 121 | JGI24698J34947_10034348 | 3300002449 | Bacteria | 2655 |
| 122 | JGI24695J34938_10023779 | 3300002450 | Bacteria | 2950 |
| 123 | Ga0466732_282125 | 3300042656 | Bacteria | 20348 |
| 124 | Ga0466712_226938 | 3300042614 | Bacteria | 2073 |
| 125 | Ga0466718_104422 | 3300042617 | Bacteria | 1331 |
| 126 | Ga0123356_10003877 | 3300010049 | Bacteria | 15570 |
| 127 | Ga0123356_10040076 | 3300010049 | Bacteria | 4364 |
| 128 | Ga0466719_401320 | 3300042606 | Bacteria | 1479 |
| 129 | Ga0466719_468537 | 3300042606 | Bacteria | 80797 |
| 130 | Ga0466720_072633 | 3300042607 | Bacteria | 3144 |
| 131 | Ga0264413_110489 | 3300024493 | Bacteria | 4561 |
| 132 | Ga0415639_032424 | 3300038395 | Bacteria | 4052 |
| 133 | Ga0466694_021665 | 3300042594 | Bacteria | 1370 |
| 134 | Ga0466699_163700 | 3300042597 | Bacteria | 58200 |
| 135 | FAAS_10005486 | 3300001880 | Bacteria | 760 |
| 136 | JGI24698J34947_10045490 | 3300002449 | Bacteria | 2239 |
| 137 | JGI24695J34938_10023093 | 3300002450 | Bacteria | 3004 |
| 138 | JGI24702J35022_10635353 | 3300002462 | Bacteria | 662 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | iso_pr_bacteria | 2781125637 | 2781283122 | 105 |
| 2 | 3300005201 | Ga0072941_1011233 | Ga0072941_10112337 | 106 |
| 3 | 3300042595 | Ga0466695_349199 | Ga0466695_349199_448_798 | 116 |
| 4 | 3300042597 | Ga0466699_000591 | Ga0466699_000591_1104_1454 | 116 |
| 5 | 3300042597 | Ga0466699_044569 | Ga0466699_044569_781_1131 | 116 |
| 6 | 3300042609 | Ga0466722_146373 | Ga0466722_146373_1503_1853 | 116 |
| 7 | 3300042622 | Ga0466731_120251 | Ga0466731_120251_594_944 | 116 |
| 8 | 3300002450 | JGI24695J34938_10023779 | JGI24695J34938_100237795 | 117 |
| 9 | 3300010049 | Ga0123356_11052291 | Ga0123356_110522911 | 117 |
| 10 | 3300010049 | Ga0123356_12533834 | Ga0123356_125338341 | 117 |
| 11 | 3300010167 | Ga0123353_10066167 | Ga0123353_100661678 | 117 |
| 12 | 3300010167 | Ga0123353_12374315 | Ga0123353_123743152 | 117 |
| 13 | 3300042602 | Ga0466713_154840 | Ga0466713_154840_1232_1591 | 119 |
| 14 | 3300042606 | Ga0466719_401320 | Ga0466719_401320_222_581 | 119 |
| 15 | 3300042606 | Ga0466719_468537 | Ga0466719_468537_12450_12809 | 119 |
| 16 | 3300042612 | Ga0466705_387885 | Ga0466705_387885_275_634 | 119 |
| 17 | 3300042612 | Ga0466705_408099 | Ga0466705_408099_1729_2088 | 119 |
| 18 | 3300042616 | Ga0466715_054330 | Ga0466715_054330_42061_42420 | 119 |
| 19 | 3300021222 | Ga0223678_1002656 | Ga0223678_10026562 | 120 |
| 20 | 3300021231 | Ga0223682_1034220 | Ga0223682_10342201 | 120 |
| 21 | 3300021237 | Ga0223675_1013615 | Ga0223675_10136152 | 120 |
| 22 | 3300021239 | Ga0223677_1000907 | Ga0223677_10009072 | 120 |
| 23 | 3300022232 | Ga0233288_1005377 | Ga0233288_10053773 | 120 |
| 24 | 3300022815 | Ga0255786_1010882 | Ga0255786_10108823 | 120 |
| 25 | 3300022820 | Ga0255809_1004135 | Ga0255809_10041352 | 120 |
| 26 | 3300022820 | Ga0255809_1004384 | Ga0255809_10043842 | 120 |
| 27 | 3300022820 | Ga0255809_1012423 | Ga0255809_10124232 | 120 |
| 28 | 3300024493 | Ga0264413_100174 | Ga0264413_1001746 | 120 |
| 29 | 3300024493 | Ga0264413_104466 | Ga0264413_1044669 | 120 |
| 30 | 3300024493 | Ga0264413_110489 | Ga0264413_1104895 | 120 |
| 31 | 3300024493 | Ga0264413_125375 | Ga0264413_1253754 | 120 |
| 32 | 3300038395 | Ga0415639_020078 | Ga0415639_020078_4981_5343 | 120 |
| 33 | 3300038395 | Ga0415639_031914 | Ga0415639_031914_614_976 | 120 |
| 34 | 3300038395 | Ga0415639_032424 | Ga0415639_032424_2806_3168 | 120 |
| 35 | 3300038395 | Ga0415639_073203 | Ga0415639_073203_1288_1650 | 120 |
| 36 | 3300038395 | Ga0415639_089930 | Ga0415639_089930_2769_3131 | 120 |
| 37 | 3300042592 | Ga0466693_293912 | Ga0466693_293912_175_537 | 120 |
| 38 | 3300042592 | Ga0466693_355294 | Ga0466693_355294_1255_1617 | 120 |
| 39 | 3300042594 | Ga0466694_004118 | Ga0466694_004118_16337_16699 | 120 |
| 40 | 3300042594 | Ga0466694_021665 | Ga0466694_021665_51_413 | 120 |
| 41 | 3300042594 | Ga0466694_050440 | Ga0466694_050440_62475_62837 | 120 |
| 42 | 3300042594 | Ga0466694_053103 | Ga0466694_053103_3004_3366 | 120 |
| 43 | 3300042594 | Ga0466694_064595 | Ga0466694_064595_2833_3195 | 120 |
| 44 | 3300042597 | Ga0466699_012121 | Ga0466699_012121_476_838 | 120 |
| 45 | 3300042597 | Ga0466699_163700 | Ga0466699_163700_27492_27854 | 120 |
| 46 | 3300042597 | Ga0466699_287202 | Ga0466699_287202_416_778 | 120 |
| 47 | 3300042597 | Ga0466699_289246 | Ga0466699_289246_982_1344 | 120 |
| 48 | 3300042600 | Ga0466700_402321 | Ga0466700_402321_3309_3671 | 120 |
| 49 | 3300042604 | Ga0466717_054515 | Ga0466717_054515_1322_1684 | 120 |
| 50 | 3300042607 | Ga0466720_052834 | Ga0466720_052834_1392_1754 | 120 |
| 51 | 3300042607 | Ga0466720_072633 | Ga0466720_072633_2673_3035 | 120 |
| 52 | 3300042607 | Ga0466720_136390 | Ga0466720_136390_752_1114 | 120 |
| 53 | 3300042607 | Ga0466720_138434 | Ga0466720_138434_2391_2753 | 120 |
| 54 | 3300042607 | Ga0466720_164256 | Ga0466720_164256_650_1012 | 120 |
| 55 | 3300042607 | Ga0466720_228402 | Ga0466720_228402_1860_2222 | 120 |
| 56 | 3300042608 | Ga0466721_132248 | Ga0466721_132248_187_549 | 120 |
| 57 | 3300042614 | Ga0466712_063622 | Ga0466712_063622_356_718 | 120 |
| 58 | 3300042614 | Ga0466712_153482 | Ga0466712_153482_12029_12391 | 120 |
| 59 | 3300042614 | Ga0466712_214752 | Ga0466712_214752_989_1351 | 120 |
| 60 | 3300042614 | Ga0466712_226938 | Ga0466712_226938_1332_1694 | 120 |
| 61 | 3300042614 | Ga0466712_231445 | Ga0466712_231445_1022_1384 | 120 |
| 62 | 3300042614 | Ga0466712_321348 | Ga0466712_321348_3047_3409 | 120 |
| 63 | 3300042616 | Ga0466715_385330 | Ga0466715_385330_1421_1783 | 120 |
| 64 | 3300042617 | Ga0466718_008773 | Ga0466718_008773_647_1009 | 120 |
| 65 | 3300042617 | Ga0466718_020308 | Ga0466718_020308_246_608 | 120 |
| 66 | 3300042617 | Ga0466718_026590 | Ga0466718_026590_1197_1559 | 120 |
| 67 | 3300042617 | Ga0466718_054171 | Ga0466718_054171_663_1025 | 120 |
| 68 | 3300042617 | Ga0466718_072389 | Ga0466718_072389_1127_1489 | 120 |
| 69 | 3300042617 | Ga0466718_098235 | Ga0466718_098235_2521_2883 | 120 |
| 70 | 3300042617 | Ga0466718_104422 | Ga0466718_104422_843_1205 | 120 |
| 71 | 3300042621 | Ga0466729_293287 | Ga0466729_293287_2125_2487 | 120 |
| 72 | 3300042622 | Ga0466731_112954 | Ga0466731_112954_1174_1536 | 120 |
| 73 | 3300042635 | Ga0466702_067081 | Ga0466702_067081_190_552 | 120 |
| 74 | 3300042635 | Ga0466702_406967 | Ga0466702_406967_1500_1862 | 120 |
| 75 | 3300042648 | Ga0466709_307692 | Ga0466709_307692_1164_1526 | 120 |
| 76 | 3300042656 | Ga0466732_000936 | Ga0466732_000936_26010_26372 | 120 |
| 77 | 3300042656 | Ga0466732_156174 | Ga0466732_156174_686_1048 | 120 |
| 78 | 3300042656 | Ga0466732_282125 | Ga0466732_282125_3099_3461 | 120 |
| 79 | 3300042656 | Ga0466732_372060 | Ga0466732_372060_490_852 | 120 |
| 80 | 3300042656 | Ga0466732_415737 | Ga0466732_415737_161_523 | 120 |
| 81 | iso_pr_bacteria | 2781125644 | 2781297107 | 120 |
| 82 | iso_pr_bacteria | 2781125650 | 2781308731 | 120 |
| 83 | iso_pr_bacteria | 2781125657 | 2781323464 | 120 |
| 84 | iso_pr_bacteria | 2781125659 | 2781327433 | 120 |
| 85 | iso_pr_bacteria | 2781125660 | 2781331438 | 120 |
| 86 | iso_pr_bacteria | 2781125663 | 2781338064 | 120 |
| 87 | iso_pr_bacteria | 2819994798 | 2819998107 | 120 |
| 88 | 3300001880 | FAAS_10000071 | FAAS_100000717 | 121 |
| 89 | 3300001880 | FAAS_10005486 | FAAS_100054862 | 121 |
| 90 | 3300001880 | FAAS_10428714 | FAAS_104287141 | 121 |
| 91 | 3300002449 | JGI24698J34947_10034348 | JGI24698J34947_100343485 | 121 |
| 92 | 3300002449 | JGI24698J34947_10035764 | JGI24698J34947_100357644 | 121 |
| 93 | 3300002449 | JGI24698J34947_10042186 | JGI24698J34947_100421863 | 121 |
| 94 | 3300002449 | JGI24698J34947_10045490 | JGI24698J34947_100454902 | 121 |
| 95 | 3300002449 | JGI24698J34947_10149345 | JGI24698J34947_101493452 | 121 |
| 96 | 3300002450 | JGI24695J34938_10000139 | JGI24695J34938_1000013956 | 121 |
| 97 | 3300002450 | JGI24695J34938_10000152 | JGI24695J34938_1000015239 | 121 |
| 98 | 3300002450 | JGI24695J34938_10000818 | JGI24695J34938_1000081831 | 121 |
| 99 | 3300002450 | JGI24695J34938_10003415 | JGI24695J34938_100034155 | 121 |
| 100 | 3300002450 | JGI24695J34938_10004249 | JGI24695J34938_1000424910 | 121 |
| 101 | 3300002450 | JGI24695J34938_10009672 | JGI24695J34938_100096728 | 121 |
| 102 | 3300002450 | JGI24695J34938_10020321 | JGI24695J34938_100203211 | 121 |
| 103 | 3300002450 | JGI24695J34938_10022598 | JGI24695J34938_100225984 | 121 |
| 104 | 3300002450 | JGI24695J34938_10023093 | JGI24695J34938_100230935 | 121 |
| 105 | 3300002450 | JGI24695J34938_10029164 | JGI24695J34938_100291644 | 121 |
| 106 | 3300002450 | JGI24695J34938_10029556 | JGI24695J34938_100295564 | 121 |
| 107 | 3300002450 | JGI24695J34938_10034945 | JGI24695J34938_100349454 | 121 |
| 108 | 3300002450 | JGI24695J34938_10043179 | JGI24695J34938_100431793 | 121 |
| 109 | 3300002450 | JGI24695J34938_10044246 | JGI24695J34938_100442463 | 121 |
| 110 | 3300002507 | JGI24697J35500_11129585 | JGI24697J35500_111295852 | 121 |
| 111 | 3300002508 | JGI24700J35501_10930895 | JGI24700J35501_1093089517 | 121 |
| 112 | 3300005200 | Ga0072940_1003019 | Ga0072940_10030192 | 121 |
| 113 | 3300005201 | Ga0072941_1020832 | Ga0072941_10208323 | 121 |
| 114 | 3300005201 | Ga0072941_1032776 | Ga0072941_10327762 | 121 |
| 115 | 3300005201 | Ga0072941_1072581 | Ga0072941_10725812 | 121 |
| 116 | 3300005201 | Ga0072941_1091682 | Ga0072941_10916824 | 121 |
| 117 | 3300005485 | Ga0074263_102826 | Ga0074263_1028264 | 121 |
| 118 | 3300010049 | Ga0123356_10000433 | Ga0123356_1000043325 | 121 |
| 119 | 3300010049 | Ga0123356_10000598 | Ga0123356_1000059826 | 121 |
| 120 | 3300010049 | Ga0123356_10003129 | Ga0123356_1000312918 | 121 |
| 121 | 3300010049 | Ga0123356_10003877 | Ga0123356_1000387718 | 121 |
| 122 | 3300010049 | Ga0123356_10009832 | Ga0123356_100098322 | 121 |
| 123 | 3300010049 | Ga0123356_10028481 | Ga0123356_100284815 | 121 |
| 124 | 3300010049 | Ga0123356_10031375 | Ga0123356_100313753 | 121 |
| 125 | 3300010049 | Ga0123356_10040076 | Ga0123356_100400762 | 121 |
| 126 | 3300010049 | Ga0123356_10154132 | Ga0123356_101541323 | 121 |
| 127 | 3300010049 | Ga0123356_10164875 | Ga0123356_101648753 | 121 |
| 128 | 3300010049 | Ga0123356_10392048 | Ga0123356_103920483 | 121 |
| 129 | 3300010049 | Ga0123356_10552076 | Ga0123356_105520762 | 121 |
| 130 | 3300010049 | Ga0123356_10579047 | Ga0123356_105790472 | 121 |
| 131 | 3300010049 | Ga0123356_10906557 | Ga0123356_109065572 | 121 |
| 132 | 3300010049 | Ga0123356_10977912 | Ga0123356_109779122 | 121 |
| 133 | 3300010049 | Ga0123356_12076813 | Ga0123356_120768132 | 121 |
| 134 | 3300010049 | Ga0123356_12500588 | Ga0123356_125005881 | 121 |
| 135 | 3300010049 | Ga0123356_12923350 | Ga0123356_129233501 | 121 |
| 136 | 3300010049 | Ga0123356_13820551 | Ga0123356_138205511 | 121 |
| 137 | 3300010167 | Ga0123353_10099513 | Ga0123353_100995133 | 121 |
| 138 | 3300010167 | Ga0123353_10493279 | Ga0123353_104932794 | 121 |
| 139 | 3300010167 | Ga0123353_12190352 | Ga0123353_121903522 | 121 |
| 140 | 3300042643 | Ga0466704_406505 | Ga0466704_406505_1895_2260 | 121 |
| 141 | 3300002462 | JGI24702J35022_10635353 | JGI24702J35022_106353532 | 122 |
| 142 | 3300042612 | Ga0466705_343361 | Ga0466705_343361_67_450 | 127 |
| 143 | 3300042616 | Ga0466715_183633 | Ga0466715_183633_445_828 | 127 |
| 144 | 3300042636 | Ga0466703_115413 | Ga0466703_115413_20993_21376 | 127 |
| 145 | 3300042643 | Ga0466704_582723 | Ga0466704_582723_28263_28646 | 127 |
| 146 | 3300042654 | Ga0466725_181049 | Ga0466725_181049_438_821 | 127 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00861 | Ribosomal_L18p | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast | 13 | 127 | 0.99 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.71 | 0.81 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.