Protein Family IF10054
Metagenome
Isolate
184
Members
69
Samples
170
Scaffolds
146.36
Avg Length
Representative Sequence
- ID
- 3300042654|Ga0466725_116915|Ga0466725_116915_5272_5727
- Length
- 151 aa
- Sequence
- MKLILKEDIANLGYKDEIVSVKDGYGRNFLIPTGKAVIASEPAKKVLAENLRQRAHKLEKIKKDAQDIAARLDGVSLVIGAKTSSTGTIFGSVSNIQVAEELAKRGFEIDRKIIYIKDSVKEVGNYKAQVRLHKEVAVEIPFEVISENNPA
Sample Types
Isolate
7.6%
Metagenome
92.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
32.4%
Kalotermitidae
20.6%
Blattidae
14.7%
Unclassified
8.8%
Termopsidae
5.9%
Rhinotermitidae
5.9%
Passalidae
4.4%
Drosophilidae
4.4%
Hodotermitidae
1.5%
Tenebrionidae
1.5%
Taxonomy
Archaea
0
Bacteria
174
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 2 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 3 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 13 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 14 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 19 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 20 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 21 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 22 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 23 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 24 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 25 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 26 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 27 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 28 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 29 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 30 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 31 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 32 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 33 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 34 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 35 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 36 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 37 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 38 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 39 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 40 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 41 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 42 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 43 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 44 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 45 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 46 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 47 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 48 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 49 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 50 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 51 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 52 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 53 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 54 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 55 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 56 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 57 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 58 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 59 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 60 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 61 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 62 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 63 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 64 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 65 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 66 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 67 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 68 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 69 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_017489 | 3300042659 | Bacteria | 155887 |
| 2 | Ga0466729_043795 | 3300042621 | Bacteria | 2807 |
| 3 | Ga0466690_020975 | 3300042590 | Bacteria | 2774 |
| 4 | Ga0123353_10061850 | 3300010167 | Bacteria | 6005 |
| 5 | Ga0466735_005937 | 3300042624 | Bacteria | 1169 |
| 6 | Ga0466704_139245 | 3300042643 | Unclassified | 1002 |
| 7 | Ga0466727_285819 | 3300042655 | Bacteria | 6039 |
| 8 | Ga0466727_340459 | 3300042655 | Bacteria | 2023 |
| 9 | Ga0466701_029840 | 3300042598 | Bacteria | 102818 |
| 10 | Ga0466701_090115 | 3300042598 | Bacteria | 2898 |
| 11 | Ga0466706_160328 | 3300042599 | Bacteria | 14193 |
| 12 | Ga0466707_132127 | 3300042601 | Bacteria | 2203 |
| 13 | Ga0466713_009611 | 3300042602 | Bacteria | 50770 |
| 14 | Ga0466713_061076 | 3300042602 | Bacteria | 17239 |
| 15 | Ga0466714_096776 | 3300042603 | Bacteria | 2385 |
| 16 | Ga0466716_463717 | 3300042605 | Bacteria | 10422 |
| 17 | Ga0466698_104843 | 3300042610 | Bacteria | 1658 |
| 18 | IMNBL1DRAFT_c0000538 | 3300000062 | Bacteria | 30858 |
| 19 | JGI24702J35022_10009104 | 3300002462 | Bacteria | 5592 |
| 20 | Ga0466705_074663 | 3300042612 | Bacteria | 37612 |
| 21 | Ga0466705_262571 | 3300042612 | Bacteria | 2694 |
| 22 | Ga0466733_198138 | 3300042659 | Unclassified | 2726 |
| 23 | Ga0466710_153374 | 3300042613 | Bacteria | 1038 |
| 24 | Ga0466711_009696 | 3300042615 | Bacteria | 20268 |
| 25 | Ga0466711_309135 | 3300042615 | Bacteria | 9099 |
| 26 | Ga0466715_112197 | 3300042616 | Bacteria | 9305 |
| 27 | Ga0466726_126164 | 3300042619 | Unclassified | 3540 |
| 28 | Ga0466726_206941 | 3300042619 | Bacteria | 14737 |
| 29 | Ga0123354_10000023 | 3300010882 | Bacteria | 119226 |
| 30 | Ga0123354_10034239 | 3300010882 | Bacteria | 7943 |
| 31 | Ga0466735_021420 | 3300042624 | Bacteria | 1789 |
| 32 | Ga0466735_030544 | 3300042624 | Bacteria | 7884 |
| 33 | Ga0466735_065292 | 3300042624 | Bacteria | 1636 |
| 34 | Ga0466735_090176 | 3300042624 | Bacteria | 4205 |
| 35 | Ga0466703_190890 | 3300042636 | Bacteria | 3300 |
| 36 | Ga0466725_116915 | 3300042654 | Bacteria | 6271 |
| 37 | Ga0466707_364921 | 3300042601 | Bacteria | 2794 |
| 38 | Ga0466713_028910 | 3300042602 | Bacteria | 114900 |
| 39 | Ga0466713_058794 | 3300042602 | Bacteria | 46658 |
| 40 | Ga0466713_156423 | 3300042602 | Bacteria | 30043 |
| 41 | Ga0466722_084309 | 3300042609 | Bacteria | 46740 |
| 42 | Ga0466722_268903 | 3300042609 | Bacteria | 23415 |
| 43 | IMNBL1DRAFT_c0000136 | 3300000062 | Bacteria | 65757 |
| 44 | JGI24702J35022_10000802 | 3300002462 | Bacteria | 19416 |
| 45 | JGI24702J35022_10087608 | 3300002462 | Bacteria | 1691 |
| 46 | JGI24702J35022_10292229 | 3300002462 | Bacteria | 959 |
| 47 | Ga0123357_10000282 | 3300009784 | Bacteria | 48587 |
| 48 | Ga0466733_221141 | 3300042659 | Bacteria | 323281 |
| 49 | Ga0466729_078245 | 3300042621 | Bacteria | 1633 |
| 50 | Ga0466690_066224 | 3300042590 | Bacteria | 17174 |
| 51 | Ga0466690_255390 | 3300042590 | Bacteria | 4057 |
| 52 | Ga0123357_10004711 | 3300009784 | Bacteria | 16121 |
| 53 | Ga0466735_111771 | 3300042624 | Unclassified | 5879 |
| 54 | Ga0466735_141607 | 3300042624 | Bacteria | 5376 |
| 55 | Ga0466735_179583 | 3300042624 | Bacteria | 3408 |
| 56 | Ga0466704_020771 | 3300042643 | Bacteria | 3550 |
| 57 | Ga0466727_078492 | 3300042655 | Bacteria | 66886 |
| 58 | Ga0466713_132663 | 3300042602 | Bacteria | 3705 |
| 59 | Ga0466716_083080 | 3300042605 | Bacteria | 20057 |
| 60 | Ga0466722_098248 | 3300042609 | Bacteria | 9590 |
| 61 | 2227504031 | 2225789004 | Bacteria | 728 |
| 62 | IMNBL1DRAFT_c0014994 | 3300000062 | Bacteria | 3385 |
| 63 | Ga0466697_157644 | 3300042611 | Bacteria | 4430 |
| 64 | Ga0466705_153177 | 3300042612 | Bacteria | 2629 |
| 65 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 66 | Ga0466715_234090 | 3300042616 | Bacteria | 4905 |
| 67 | Ga0466723_092685 | 3300042618 | Bacteria | 5665 |
| 68 | Ga0466728_439410 | 3300042620 | Bacteria | 2942 |
| 69 | Ga0466656_091709 | 3300042550 | Bacteria | 5103 |
| 70 | Ga0466691_185147 | 3300042593 | Bacteria | 9900 |
| 71 | Ga0466696_020689 | 3300042596 | Bacteria | 4466 |
| 72 | Ga0123356_10032921 | 3300010049 | Bacteria | 4847 |
| 73 | Ga0123353_10057005 | 3300010167 | Bacteria | 6256 |
| 74 | Ga0123354_10609592 | 3300010882 | Bacteria | 796 |
| 75 | Ga0466735_058572 | 3300042624 | Bacteria | 3490 |
| 76 | Ga0466735_182600 | 3300042624 | Bacteria | 1146 |
| 77 | Ga0466730_092489 | 3300042625 | Unclassified | 4615 |
| 78 | Ga0466708_016462 | 3300042652 | Bacteria | 8436 |
| 79 | Ga0466725_245510 | 3300042654 | Bacteria | 11286 |
| 80 | Ga0466727_227211 | 3300042655 | Bacteria | 2983 |
| 81 | Ga0466706_273915 | 3300042599 | Bacteria | 1211 |
| 82 | Ga0466700_193551 | 3300042600 | Bacteria | 6836 |
| 83 | Ga0466713_002210 | 3300042602 | Bacteria | 6334 |
| 84 | Ga0466733_005186 | 3300042659 | Bacteria | 1260 |
| 85 | Ga0466733_101357 | 3300042659 | Bacteria | 7438 |
| 86 | Ga0466711_054367 | 3300042615 | Bacteria | 1901 |
| 87 | Ga0123357_10149572 | 3300009784 | Bacteria | 2839 |
| 88 | Ga0123356_10122646 | 3300010049 | Bacteria | 2531 |
| 89 | Ga0466735_062669 | 3300042624 | Bacteria | 1175 |
| 90 | Ga0466735_134358 | 3300042624 | Bacteria | 2847 |
| 91 | Ga0466735_174554 | 3300042624 | Bacteria | 1558 |
| 92 | Ga0466704_134776 | 3300042643 | Unclassified | 42303 |
| 93 | Ga0466704_384166 | 3300042643 | Bacteria | 6102 |
| 94 | Ga0466709_326869 | 3300042648 | Bacteria | 10418 |
| 95 | Ga0466724_21962 | 3300042649 | Bacteria | 3257 |
| 96 | Ga0466700_294438 | 3300042600 | Bacteria | 3458 |
| 97 | Ga0466707_366232 | 3300042601 | Bacteria | 1082 |
| 98 | Ga0466713_120221 | 3300042602 | Bacteria | 3927 |
| 99 | 2227236659 | 2225789004 | Unclassified | 1351 |
| 100 | JGI24699J35502_11134011 | 3300002509 | Bacteria | 24103 |
| 101 | JGI24696J40584_12782410 | 3300002834 | Bacteria | 838 |
| 102 | Ga0068305_10002943 | 3300005083 | Bacteria | 5877 |
| 103 | Ga0068305_10289770 | 3300005083 | Unclassified | 3061 |
| 104 | Ga0104019_1215107 | 3300007150 | Unclassified | 518 |
| 105 | Ga0466733_020568 | 3300042659 | Bacteria | 1378 |
| 106 | Ga0466711_362104 | 3300042615 | Bacteria | 1242 |
| 107 | Ga0466715_332649 | 3300042616 | Bacteria | 3429 |
| 108 | Ga0466715_614816 | 3300042616 | Bacteria | 3529 |
| 109 | Ga0466692_056085 | 3300042591 | Bacteria | 4441 |
| 110 | Ga0466695_203091 | 3300042595 | Bacteria | 1591 |
| 111 | Ga0466731_282207 | 3300042622 | Bacteria | 1323 |
| 112 | Ga0466703_133738 | 3300042636 | Bacteria | 51235 |
| 113 | Ga0466725_297547 | 3300042654 | Bacteria | 2059 |
| 114 | Ga0466727_094394 | 3300042655 | Bacteria | 27539 |
| 115 | Ga0466706_248951 | 3300042599 | Bacteria | 16037 |
| 116 | Ga0466713_012036 | 3300042602 | Bacteria | 19801 |
| 117 | Ga0466713_024657 | 3300042602 | Bacteria | 28322 |
| 118 | Ga0466722_239940 | 3300042609 | Bacteria | 60486 |
| 119 | 2227065287 | 2225789003 | Bacteria | 697 |
| 120 | JGI24702J35022_10031648 | 3300002462 | Bacteria | 2834 |
| 121 | JGI24699J35502_11134001 | 3300002509 | Bacteria | 23818 |
| 122 | JGI24696J40584_12950697 | 3300002834 | Bacteria | 2174 |
| 123 | Ga0068302_10045437 | 3300005071 | Bacteria | 5633 |
| 124 | Ga0068305_10002946 | 3300005083 | Bacteria | 63588 |
| 125 | Ga0072941_1250699 | 3300005201 | Bacteria | 2166 |
| 126 | Ga0104042_1029739 | 3300007130 | Bacteria | 612 |
| 127 | Ga0466697_228795 | 3300042611 | Bacteria | 1422 |
| 128 | Ga0466715_051157 | 3300042616 | Bacteria | 50381 |
| 129 | Ga0466715_209777 | 3300042616 | Bacteria | 18334 |
| 130 | Ga0466726_029778 | 3300042619 | Bacteria | 38816 |
| 131 | Ga0466690_228138 | 3300042590 | Bacteria | 28377 |
| 132 | Ga0466696_039257 | 3300042596 | Bacteria | 21591 |
| 133 | Ga0466696_134020 | 3300042596 | Bacteria | 25576 |
| 134 | Ga0466735_033799 | 3300042624 | Bacteria | 1369 |
| 135 | Ga0466735_076428 | 3300042624 | Bacteria | 3758 |
| 136 | Ga0466704_122768 | 3300042643 | Bacteria | 2833 |
| 137 | Ga0466704_293123 | 3300042643 | Bacteria | 1439 |
| 138 | Ga0466704_562961 | 3300042643 | Bacteria | 5668 |
| 139 | Ga0466706_037708 | 3300042599 | Bacteria | 27371 |
| 140 | Ga0466700_425186 | 3300042600 | Bacteria | 1948 |
| 141 | Ga0466707_131517 | 3300042601 | Bacteria | 8781 |
| 142 | Ga0466713_152650 | 3300042602 | Bacteria | 6521 |
| 143 | Ga0466719_555931 | 3300042606 | Bacteria | 3226 |
| 144 | Ga0466722_138774 | 3300042609 | Bacteria | 9563 |
| 145 | 2227068297 | 2225789003 | Unclassified | 2989 |
| 146 | IMNBL1DRAFT_c0000189 | 3300000062 | Bacteria | 53989 |
| 147 | Ga0068305_10129428 | 3300005083 | Bacteria | 3965 |
| 148 | Ga0104048_1185622 | 3300007143 | Bacteria | 625 |
| 149 | Ga0466705_283148 | 3300042612 | Bacteria | 3968 |
| 150 | Ga0466712_042330 | 3300042614 | Bacteria | 1646 |
| 151 | Ga0466711_238013 | 3300042615 | Bacteria | 4567 |
| 152 | Ga0466711_437006 | 3300042615 | Bacteria | 50743 |
| 153 | Ga0466726_108987 | 3300042619 | Bacteria | 2435 |
| 154 | Ga0466729_096704 | 3300042621 | Bacteria | 15068 |
| 155 | Ga0466690_153315 | 3300042590 | Bacteria | 11350 |
| 156 | Ga0466692_011147 | 3300042591 | Bacteria | 45326 |
| 157 | Ga0466693_309468 | 3300042592 | Bacteria | 1047 |
| 158 | Ga0466696_217363 | 3300042596 | Bacteria | 1287 |
| 159 | Ga0123356_12920692 | 3300010049 | Bacteria | 597 |
| 160 | Ga0466735_091054 | 3300042624 | Bacteria | 1079 |
| 161 | Ga0466730_013193 | 3300042625 | Bacteria | 1424 |
| 162 | Ga0466703_149048 | 3300042636 | Bacteria | 1675 |
| 163 | Ga0466709_169139 | 3300042648 | Bacteria | 148698 |
| 164 | Ga0466727_128780 | 3300042655 | Bacteria | 1496 |
| 165 | Ga0466727_344118 | 3300042655 | Bacteria | 13362 |
| 166 | Ga0466713_127245 | 3300042602 | Bacteria | 1884 |
| 167 | Ga0466713_148609 | 3300042602 | Bacteria | 76381 |
| 168 | Ga0466722_093688 | 3300042609 | Bacteria | 7651 |
| 169 | Ga0466722_157838 | 3300042609 | Bacteria | 26726 |
| 170 | JGI24702J35022_10294748 | 3300002462 | Bacteria | 956 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042659 | Ga0466733_005186 | Ga0466733_005186_223_669 | 121 |
| 2 | 3300042598 | Ga0466701_090115 | Ga0466701_090115_1093_1536 | 123 |
| 3 | 3300042605 | Ga0466716_463717 | Ga0466716_463717_5880_6323 | 123 |
| 4 | 3300042612 | Ga0466705_262571 | Ga0466705_262571_1229_1672 | 123 |
| 5 | 3300042590 | Ga0466690_153315 | Ga0466690_153315_1760_2203 | 124 |
| 6 | 2225789003 | 2227065287 | 2227422088 | 131 |
| 7 | 2225789004 | 2227504031 | 2227989698 | 131 |
| 8 | 3300002462 | JGI24702J35022_10031648 | JGI24702J35022_100316483 | 136 |
| 9 | 3300042619 | Ga0466726_108987 | Ga0466726_108987_931_1374 | 137 |
| 10 | 3300002462 | JGI24702J35022_10000802 | JGI24702J35022_100008023 | 138 |
| 11 | 3300010167 | Ga0123353_10061850 | Ga0123353_100618503 | 138 |
| 12 | 3300042599 | Ga0466706_273915 | Ga0466706_273915_58_477 | 139 |
| 13 | 3300000062 | IMNBL1DRAFT_c0000136 | IMNBL1DRAFT_000013646 | 144 |
| 14 | 2225789003 | 2227068297 | 2227427844 | 147 |
| 15 | 2225789004 | 2227236659 | 2227674704 | 147 |
| 16 | 3300042550 | Ga0466656_091709 | Ga0466656_091709_3776_4219 | 147 |
| 17 | 3300042590 | Ga0466690_020975 | Ga0466690_020975_2134_2577 | 147 |
| 18 | 3300042590 | Ga0466690_066224 | Ga0466690_066224_1339_1782 | 147 |
| 19 | 3300042590 | Ga0466690_228138 | Ga0466690_228138_2640_3083 | 147 |
| 20 | 3300042590 | Ga0466690_255390 | Ga0466690_255390_1497_1940 | 147 |
| 21 | 3300042591 | Ga0466692_011147 | Ga0466692_011147_15150_15593 | 147 |
| 22 | 3300042591 | Ga0466692_056085 | Ga0466692_056085_1651_2094 | 147 |
| 23 | 3300042593 | Ga0466691_185147 | Ga0466691_185147_964_1407 | 147 |
| 24 | 3300042595 | Ga0466695_203091 | Ga0466695_203091_150_593 | 147 |
| 25 | 3300042596 | Ga0466696_217363 | Ga0466696_217363_693_1136 | 147 |
| 26 | 3300042598 | Ga0466701_029840 | Ga0466701_029840_53116_53559 | 147 |
| 27 | 3300042599 | Ga0466706_248951 | Ga0466706_248951_14996_15439 | 147 |
| 28 | 3300042600 | Ga0466700_193551 | Ga0466700_193551_1008_1451 | 147 |
| 29 | 3300042600 | Ga0466700_425186 | Ga0466700_425186_1305_1748 | 147 |
| 30 | 3300042601 | Ga0466707_131517 | Ga0466707_131517_8021_8464 | 147 |
| 31 | 3300042601 | Ga0466707_132127 | Ga0466707_132127_318_761 | 147 |
| 32 | 3300042601 | Ga0466707_364921 | Ga0466707_364921_1676_2119 | 147 |
| 33 | 3300042601 | Ga0466707_366232 | Ga0466707_366232_121_564 | 147 |
| 34 | 3300042602 | Ga0466713_012036 | Ga0466713_012036_4988_5431 | 147 |
| 35 | 3300042602 | Ga0466713_024657 | Ga0466713_024657_23071_23514 | 147 |
| 36 | 3300042602 | Ga0466713_028910 | Ga0466713_028910_22536_22979 | 147 |
| 37 | 3300042602 | Ga0466713_058794 | Ga0466713_058794_13652_14095 | 147 |
| 38 | 3300042602 | Ga0466713_061076 | Ga0466713_061076_9824_10267 | 147 |
| 39 | 3300042602 | Ga0466713_120221 | Ga0466713_120221_1583_2026 | 147 |
| 40 | 3300042602 | Ga0466713_127245 | Ga0466713_127245_1008_1451 | 147 |
| 41 | 3300042602 | Ga0466713_148609 | Ga0466713_148609_24027_24470 | 147 |
| 42 | 3300042602 | Ga0466713_152650 | Ga0466713_152650_2851_3294 | 147 |
| 43 | 3300042602 | Ga0466713_156423 | Ga0466713_156423_9359_9802 | 147 |
| 44 | 3300042603 | Ga0466714_096776 | Ga0466714_096776_1427_1870 | 147 |
| 45 | 3300042605 | Ga0466716_083080 | Ga0466716_083080_592_1035 | 147 |
| 46 | 3300042606 | Ga0466719_555931 | Ga0466719_555931_336_779 | 147 |
| 47 | 3300042609 | Ga0466722_084309 | Ga0466722_084309_18257_18700 | 147 |
| 48 | 3300042609 | Ga0466722_093688 | Ga0466722_093688_7050_7493 | 147 |
| 49 | 3300042609 | Ga0466722_098248 | Ga0466722_098248_1717_2160 | 147 |
| 50 | 3300042609 | Ga0466722_138774 | Ga0466722_138774_5953_6396 | 147 |
| 51 | 3300042609 | Ga0466722_157838 | Ga0466722_157838_19172_19615 | 147 |
| 52 | 3300042609 | Ga0466722_239940 | Ga0466722_239940_54971_55414 | 147 |
| 53 | 3300042609 | Ga0466722_268903 | Ga0466722_268903_16676_17119 | 147 |
| 54 | 3300042611 | Ga0466697_157644 | Ga0466697_157644_3118_3561 | 147 |
| 55 | 3300042611 | Ga0466697_228795 | Ga0466697_228795_583_1026 | 147 |
| 56 | 3300042612 | Ga0466705_074663 | Ga0466705_074663_27191_27634 | 147 |
| 57 | 3300042612 | Ga0466705_153177 | Ga0466705_153177_2127_2570 | 147 |
| 58 | 3300042612 | Ga0466705_283148 | Ga0466705_283148_258_701 | 147 |
| 59 | 3300042613 | Ga0466710_153374 | Ga0466710_153374_442_885 | 147 |
| 60 | 3300042614 | Ga0466712_042330 | Ga0466712_042330_358_801 | 147 |
| 61 | 3300042615 | Ga0466711_009696 | Ga0466711_009696_8553_8996 | 147 |
| 62 | 3300042615 | Ga0466711_054367 | Ga0466711_054367_705_1148 | 147 |
| 63 | 3300042615 | Ga0466711_309135 | Ga0466711_309135_1888_2331 | 147 |
| 64 | 3300042615 | Ga0466711_362104 | Ga0466711_362104_341_784 | 147 |
| 65 | 3300042615 | Ga0466711_437006 | Ga0466711_437006_444_887 | 147 |
| 66 | 3300042616 | Ga0466715_051157 | Ga0466715_051157_18311_18754 | 147 |
| 67 | 3300042616 | Ga0466715_112197 | Ga0466715_112197_8431_8874 | 147 |
| 68 | 3300042616 | Ga0466715_209777 | Ga0466715_209777_4201_4644 | 147 |
| 69 | 3300042616 | Ga0466715_332649 | Ga0466715_332649_1619_2062 | 147 |
| 70 | 3300042619 | Ga0466726_029778 | Ga0466726_029778_37597_38040 | 147 |
| 71 | 3300042619 | Ga0466726_206941 | Ga0466726_206941_3675_4118 | 147 |
| 72 | 3300042620 | Ga0466728_439410 | Ga0466728_439410_1854_2297 | 147 |
| 73 | 3300042621 | Ga0466729_043795 | Ga0466729_043795_1576_2019 | 147 |
| 74 | 3300042621 | Ga0466729_078245 | Ga0466729_078245_521_964 | 147 |
| 75 | 3300042621 | Ga0466729_096704 | Ga0466729_096704_13951_14394 | 147 |
| 76 | 3300042622 | Ga0466731_282207 | Ga0466731_282207_113_556 | 147 |
| 77 | 3300042624 | Ga0466735_005937 | Ga0466735_005937_212_655 | 147 |
| 78 | 3300042624 | Ga0466735_021420 | Ga0466735_021420_784_1227 | 147 |
| 79 | 3300042624 | Ga0466735_030544 | Ga0466735_030544_937_1380 | 147 |
| 80 | 3300042624 | Ga0466735_033799 | Ga0466735_033799_25_468 | 147 |
| 81 | 3300042624 | Ga0466735_058572 | Ga0466735_058572_34_477 | 147 |
| 82 | 3300042624 | Ga0466735_062669 | Ga0466735_062669_259_702 | 147 |
| 83 | 3300042624 | Ga0466735_065292 | Ga0466735_065292_49_492 | 147 |
| 84 | 3300042624 | Ga0466735_076428 | Ga0466735_076428_2064_2507 | 147 |
| 85 | 3300042624 | Ga0466735_090176 | Ga0466735_090176_3712_4155 | 147 |
| 86 | 3300042624 | Ga0466735_091054 | Ga0466735_091054_34_477 | 147 |
| 87 | 3300042624 | Ga0466735_111771 | Ga0466735_111771_5017_5460 | 147 |
| 88 | 3300042624 | Ga0466735_134358 | Ga0466735_134358_999_1442 | 147 |
| 89 | 3300042624 | Ga0466735_141607 | Ga0466735_141607_712_1155 | 147 |
| 90 | 3300042624 | Ga0466735_174554 | Ga0466735_174554_149_592 | 147 |
| 91 | 3300042624 | Ga0466735_179583 | Ga0466735_179583_55_498 | 147 |
| 92 | 3300042624 | Ga0466735_182600 | Ga0466735_182600_219_662 | 147 |
| 93 | 3300042625 | Ga0466730_013193 | Ga0466730_013193_219_662 | 147 |
| 94 | 3300042625 | Ga0466730_092489 | Ga0466730_092489_1282_1725 | 147 |
| 95 | 3300042636 | Ga0466703_133738 | Ga0466703_133738_16213_16656 | 147 |
| 96 | 3300042636 | Ga0466703_149048 | Ga0466703_149048_1186_1629 | 147 |
| 97 | 3300042636 | Ga0466703_190890 | Ga0466703_190890_1151_1594 | 147 |
| 98 | 3300042643 | Ga0466704_020771 | Ga0466704_020771_279_722 | 147 |
| 99 | 3300042643 | Ga0466704_134776 | Ga0466704_134776_4235_4678 | 147 |
| 100 | 3300042643 | Ga0466704_139245 | Ga0466704_139245_279_722 | 147 |
| 101 | 3300042643 | Ga0466704_293123 | Ga0466704_293123_646_1089 | 147 |
| 102 | 3300042643 | Ga0466704_384166 | Ga0466704_384166_3364_3807 | 147 |
| 103 | 3300042643 | Ga0466704_562961 | Ga0466704_562961_4521_4964 | 147 |
| 104 | 3300042648 | Ga0466709_169139 | Ga0466709_169139_99451_99894 | 147 |
| 105 | 3300042648 | Ga0466709_326869 | Ga0466709_326869_6198_6641 | 147 |
| 106 | 3300042649 | Ga0466724_21962 | Ga0466724_21962_2504_2947 | 147 |
| 107 | 3300042652 | Ga0466708_016462 | Ga0466708_016462_6361_6804 | 147 |
| 108 | 3300042654 | Ga0466725_297547 | Ga0466725_297547_1267_1710 | 147 |
| 109 | 3300042655 | Ga0466727_078492 | Ga0466727_078492_55904_56347 | 147 |
| 110 | 3300042655 | Ga0466727_128780 | Ga0466727_128780_200_643 | 147 |
| 111 | 3300042655 | Ga0466727_227211 | Ga0466727_227211_2461_2904 | 147 |
| 112 | 3300042655 | Ga0466727_340459 | Ga0466727_340459_612_1055 | 147 |
| 113 | 3300042655 | Ga0466727_344118 | Ga0466727_344118_7669_8112 | 147 |
| 114 | 3300042659 | Ga0466733_020568 | Ga0466733_020568_472_915 | 147 |
| 115 | 3300042659 | Ga0466733_101357 | Ga0466733_101357_6041_6484 | 147 |
| 116 | 3300042659 | Ga0466733_198138 | Ga0466733_198138_1245_1688 | 147 |
| 117 | 3300042659 | Ga0466733_221141 | Ga0466733_221141_89974_90417 | 147 |
| 118 | 3300056842 | Ga0562377_0004 | Ga0562377_0004_94087_94530 | 147 |
| 119 | iso_pr_bacteria | 2695420314 | 2695471706 | 147 |
| 120 | iso_pr_bacteria | 2695420931 | 2698109569 | 147 |
| 121 | iso_pr_bacteria | 2910926975 | 2910929271 | 147 |
| 122 | iso_pr_bacteria | 2910942425 | 2910942938 | 147 |
| 123 | iso_pr_bacteria | 2910949487 | 2910951935 | 147 |
| 124 | iso_pr_bacteria | 2910959314 | 2910960857 | 147 |
| 125 | iso_pr_bacteria | 2923982719 | 2923984987 | 147 |
| 126 | iso_pr_bacteria | 2940195863 | 2940197491 | 147 |
| 127 | iso_pr_bacteria | 2940216256 | 2940216850 | 147 |
| 128 | iso_pr_bacteria | 2940371297 | 2940373013 | 147 |
| 129 | iso_pr_bacteria | 2967483437 | 2967484426 | 147 |
| 130 | iso_pr_bacteria | 3004667792 | 3004667921 | 147 |
| 131 | iso_pr_bacteria | 3004677695 | 3004679163 | 147 |
| 132 | iso_pr_bacteria | 8100166142 | 8100167025 | 147 |
| 133 | 3300000062 | IMNBL1DRAFT_c0000189 | IMNBL1DRAFT_000018939 | 148 |
| 134 | 3300000062 | IMNBL1DRAFT_c0000538 | IMNBL1DRAFT_000053829 | 148 |
| 135 | 3300000062 | IMNBL1DRAFT_c0014994 | IMNBL1DRAFT_00149946 | 148 |
| 136 | 3300002462 | JGI24702J35022_10292229 | JGI24702J35022_102922292 | 148 |
| 137 | 3300002462 | JGI24702J35022_10294748 | JGI24702J35022_102947482 | 148 |
| 138 | 3300002509 | JGI24699J35502_11134001 | JGI24699J35502_111340015 | 148 |
| 139 | 3300002509 | JGI24699J35502_11134011 | JGI24699J35502_1113401112 | 148 |
| 140 | 3300002834 | JGI24696J40584_12782410 | JGI24696J40584_127824102 | 148 |
| 141 | 3300002834 | JGI24696J40584_12950697 | JGI24696J40584_129506974 | 148 |
| 142 | 3300005083 | Ga0068305_10129428 | Ga0068305_101294283 | 148 |
| 143 | 3300005083 | Ga0068305_10289770 | Ga0068305_102897703 | 148 |
| 144 | 3300007130 | Ga0104042_1029739 | Ga0104042_10297392 | 148 |
| 145 | 3300007143 | Ga0104048_1185622 | Ga0104048_11856221 | 148 |
| 146 | 3300007150 | Ga0104019_1215107 | Ga0104019_12151071 | 148 |
| 147 | 3300009784 | Ga0123357_10000282 | Ga0123357_1000028226 | 148 |
| 148 | 3300009784 | Ga0123357_10004711 | Ga0123357_100047112 | 148 |
| 149 | 3300009784 | Ga0123357_10149572 | Ga0123357_101495723 | 148 |
| 150 | 3300010049 | Ga0123356_10032921 | Ga0123356_100329214 | 148 |
| 151 | 3300010049 | Ga0123356_10122646 | Ga0123356_101226462 | 148 |
| 152 | 3300010167 | Ga0123353_10057005 | Ga0123353_100570055 | 148 |
| 153 | 3300010882 | Ga0123354_10000023 | Ga0123354_1000002393 | 148 |
| 154 | 3300010882 | Ga0123354_10034239 | Ga0123354_100342394 | 148 |
| 155 | 3300010882 | Ga0123354_10609592 | Ga0123354_106095922 | 148 |
| 156 | 3300042592 | Ga0466693_309468 | Ga0466693_309468_356_802 | 148 |
| 157 | 3300042596 | Ga0466696_039257 | Ga0466696_039257_12145_12591 | 148 |
| 158 | 3300042596 | Ga0466696_134020 | Ga0466696_134020_7433_7879 | 148 |
| 159 | 3300042602 | Ga0466713_002210 | Ga0466713_002210_1127_1573 | 148 |
| 160 | 3300042602 | Ga0466713_009611 | Ga0466713_009611_14289_14735 | 148 |
| 161 | 3300042602 | Ga0466713_132663 | Ga0466713_132663_1145_1591 | 148 |
| 162 | 3300042610 | Ga0466698_104843 | Ga0466698_104843_197_643 | 148 |
| 163 | 3300042616 | Ga0466715_234090 | Ga0466715_234090_3383_3829 | 148 |
| 164 | 3300042616 | Ga0466715_614816 | Ga0466715_614816_2213_2659 | 148 |
| 165 | 3300042618 | Ga0466723_092685 | Ga0466723_092685_4113_4559 | 148 |
| 166 | 3300042619 | Ga0466726_126164 | Ga0466726_126164_725_1171 | 148 |
| 167 | 3300042643 | Ga0466704_122768 | Ga0466704_122768_709_1155 | 148 |
| 168 | 3300042655 | Ga0466727_285819 | Ga0466727_285819_4402_4848 | 148 |
| 169 | 3300002462 | JGI24702J35022_10009104 | JGI24702J35022_100091047 | 149 |
| 170 | 3300002462 | JGI24702J35022_10087608 | JGI24702J35022_100876082 | 149 |
| 171 | 3300005071 | Ga0068302_10045437 | Ga0068302_100454377 | 149 |
| 172 | 3300005083 | Ga0068305_10002943 | Ga0068305_100029435 | 149 |
| 173 | 3300010049 | Ga0123356_12920692 | Ga0123356_129206921 | 149 |
| 174 | 3300042596 | Ga0466696_020689 | Ga0466696_020689_2884_3333 | 149 |
| 175 | 3300042599 | Ga0466706_037708 | Ga0466706_037708_5205_5654 | 149 |
| 176 | 3300042599 | Ga0466706_160328 | Ga0466706_160328_675_1124 | 149 |
| 177 | 3300042600 | Ga0466700_294438 | Ga0466700_294438_747_1196 | 149 |
| 178 | 3300042654 | Ga0466725_245510 | Ga0466725_245510_6743_7192 | 149 |
| 179 | 3300042655 | Ga0466727_094394 | Ga0466727_094394_20083_20532 | 149 |
| 180 | 3300042659 | Ga0466733_017489 | Ga0466733_017489_122620_123069 | 149 |
| 181 | 3300005083 | Ga0068305_10002946 | Ga0068305_1000294652 | 150 |
| 182 | 3300005201 | Ga0072941_1250699 | Ga0072941_12506992 | 150 |
| 183 | 3300042654 | Ga0466725_116915 | Ga0466725_116915_5272_5727 | 151 |
| 184 | 3300042615 | Ga0466711_238013 | Ga0466711_238013_154_810 | 162 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.71 | 0.71 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.