Protein Family IF10030

Metagenome Isolate
131 Members
67 Samples
105 Scaffolds
179.5 Avg Length

🧬 Representative Sequence

ID
3300042654|Ga0466725_016638|Ga0466725_016638_4771_5430
Length
219 aa
Sequence
LHEKSVIFAQNYGFGTAINNVQNGRNNRIYTTLPIPFKVFMRKLKVTELNRLTAEEYKTSEKIPLVVVLDQVRSLNNVGSVFRTADAFRLESVCLCGITATPPNAEIHKTALGAEETVEWRYYKNTPDCVKELKKNGFYVCAIEQTENSIPLETMELSPDQKYAIILGHEVKGVQQEVINECHCCIEIPQFGTKHSLNVSVAAGIVIWEFFKVLQIKRI

📊 Sample Types

Isolate 19.9%
Metagenome 80.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 25.4%
Kalotermitidae 19.4%
Termitidae 17.9%
Culicidae 7.5%
Elmidae 6.0%
Formicidae 6.0%
Termopsidae 6.0%
Unclassified 4.5%
Passalidae 3.0%
Hodotermitidae 1.5%
Apidae 1.5%
Rhinotermitidae 1.5%

🌳 Taxonomy

Archaea 1
Bacteria 126
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 8114076984 Elizabethkingia anophelis R26 Isolate Culicidae
2 2864788197 Elizabethkingia anophelis S00027 Isolate Elmidae
3 2923982719 Parabacteroides sp. 52 Isolate Blattidae
4 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
5 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
6 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
7 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
8 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
9 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
10 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
11 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
12 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
13 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
14 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
15 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
16 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
17 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
18 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
19 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
20 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
21 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
22 8020009074 Elizabethkingia anophelis MSU001 Isolate Culicidae
23 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
24 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
25 2864948220 Elizabethkingia anophelis S00205 Isolate Elmidae
26 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
27 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
28 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
29 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
30 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
31 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
32 2847090942 Elizabethkingia anophelis Ag1 Isolate Culicidae
33 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
34 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
35 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
36 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
37 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
38 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
39 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
40 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
41 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
42 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
43 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
44 2864836148 Arcicella rosea S00070 Isolate Elmidae
45 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
46 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
47 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
48 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
49 2529292732 Elizabethkingia anophelis R26 Isolate Culicidae
50 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
51 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
52 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
53 3004667792 Bacteroides sp. 519 Isolate Blattidae
54 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
55 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
56 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
57 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
58 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
59 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
60 2864923010 Elizabethkingia anophelis S00177 Isolate Elmidae
61 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
62 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
63 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
64 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
65 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
66 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
67 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_233397 3300042612 Bacteria 5819
2 Ga0466703_206962 3300042636 Bacteria 15694
3 Ga0466704_078240 3300042643 Bacteria 7319
4 Ga0466711_036318 3300042615 Bacteria 24493
5 Ga0466713_124834 3300042602 Bacteria 50546
6 JGI24696J40584_12859472 3300002834 Bacteria 1007
7 Ga0102734_1000004 3300007129 Bacteria 74698
8 Ga0466732_375818 3300042656 Bacteria 2984
9 Ga0466735_151567 3300042624 Bacteria 2419
10 Ga0466703_155813 3300042636 Bacteria 4839
11 Ga0466704_036087 3300042643 Bacteria 26125
12 Ga0466704_239838 3300042643 Bacteria 4562
13 Ga0466704_270385 3300042643 Bacteria 7326
14 Ga0466709_365596 3300042648 Bacteria 29138
15 Ga0123356_11540493 3300010049 Bacteria 821
16 Ga0466707_021500 3300042601 Bacteria 2724
17 Ga0466707_325272 3300042601 Bacteria 1494
18 2227383574 2225789004 Bacteria 5916
19 2227559618 2225789004 Bacteria 2743
20 IMNBL1DRAFT_c0002364 3300000062 Bacteria 13195
21 Meta3P_1002250 3300002464 Unclassified 32052
22 Ga0068305_10011322 3300005083 Bacteria 1578
23 Ga0068305_10087386 3300005083 Bacteria 20604
24 Ga0103264_1001119 3300007188 Bacteria 11949
25 Ga0466733_169327 3300042659 Bacteria 15695
26 Ga0466704_131004 3300042643 Bacteria 10484
27 Ga0466704_170837 3300042643 Unclassified 10668
28 Ga0466708_429470 3300042652 Bacteria 14783
29 Ga0466727_074084 3300042655 Bacteria 1756
30 Ga0466727_275080 3300042655 Bacteria 3491
31 Ga0466723_006936 3300042618 Bacteria 22789
32 Ga0466726_164456 3300042619 Bacteria 4863
33 Ga0466691_024094 3300042593 Bacteria 43041
34 Ga0466696_193592 3300042596 Bacteria 5289
35 Ga0123353_11211581 3300010167 Bacteria 989
36 Ga0466713_051170 3300042602 Bacteria 19777
37 Ga0466713_116734 3300042602 Bacteria 36028
38 Ga0466719_324700 3300042606 Bacteria 1714
39 Ga0466722_040494 3300042609 Bacteria 3486
40 Ga0466722_179154 3300042609 Bacteria 5732
41 Ga0068302_10033376 3300005071 Bacteria 689
42 Ga0072940_1233525 3300005200 Bacteria 1335
43 Ga0466730_019380 3300042625 Bacteria 1363
44 Ga0466704_046750 3300042643 Bacteria 1083
45 Ga0466704_085663 3300042643 Bacteria 15952
46 Ga0466704_245126 3300042643 Bacteria 8675
47 Ga0466725_016638 3300042654 Bacteria 13290
48 Ga0466727_016365 3300042655 Bacteria 14084
49 Ga0466727_090895 3300042655 Bacteria 19830
50 Ga0466727_129257 3300042655 Bacteria 8456
51 Ga0466715_071082 3300042616 Bacteria 3038
52 Ga0466723_176850 3300042618 Bacteria 11607
53 Ga0466723_206130 3300042618 Bacteria 34794
54 Ga0123354_10632028 3300010882 Bacteria 772
55 Ga0466719_134282 3300042606 Bacteria 8026
56 Ga0466719_162727 3300042606 Bacteria 34676
57 IMNBL1DRAFT_c0002127 3300000062 Bacteria 14081
58 JGI24702J35022_10000230 3300002462 Bacteria 31710
59 Ga0466705_004955 3300042612 Bacteria 3004
60 Ga0466735_091953 3300042624 Bacteria 1289
61 Ga0466703_081080 3300042636 Bacteria 17567
62 Ga0466704_196052 3300042643 Bacteria 5284
63 Ga0466709_240386 3300042648 Bacteria 67601
64 Ga0466724_07109 3300042649 Bacteria 285871
65 Ga0466715_184396 3300042616 Bacteria 9508
66 Ga0466690_001090 3300042590 Bacteria 2098
67 Ga0466690_230710 3300042590 Bacteria 19563
68 Ga0466690_361501 3300042590 Bacteria 19149
69 Ga0466691_098534 3300042593 Bacteria 1981
70 Ga0466707_143524 3300042601 Bacteria 2458
71 Ga0466713_082837 3300042602 Bacteria 4177
72 Ga0466713_150871 3300042602 Bacteria 11473
73 Ga0466719_314667 3300042606 Bacteria 4888
74 Ga0466722_266173 3300042609 Bacteria 16387
75 JGI24702J35022_10136477 3300002462 Archaea 1365
76 Ga0068305_10009904 3300005083 Bacteria 41398
77 Ga0466705_021602 3300042612 Bacteria 2872
78 Ga0466705_196563 3300042612 Bacteria 14261
79 Ga0466732_152370 3300042656 Bacteria 4733
80 Ga0466733_139976 3300042659 Bacteria 3944
81 Ga0466735_061198 3300042624 Bacteria 8328
82 Ga0466704_159211 3300042643 Bacteria 13501
83 Ga0466728_220036 3300042620 Bacteria 16122
84 Ga0466691_036644 3300042593 Bacteria 14810
85 Ga0466722_153451 3300042609 Bacteria 2323
86 IMNBL1DRAFT_c0102562 3300000062 Bacteria 768
87 JGI24702J35022_10044076 3300002462 Bacteria 2377
88 Ga0466732_398841 3300042656 Bacteria 1248
89 Ga0466733_120112 3300042659 Bacteria 197910
90 Ga0466735_232952 3300042624 Unclassified 4043
91 Ga0466704_056416 3300042643 Bacteria 6267
92 Ga0466715_394135 3300042616 Bacteria 7136
93 Ga0466728_171509 3300042620 Bacteria 10752
94 Ga0123353_10319554 3300010167 Bacteria 2357
95 Ga0466713_002422 3300042602 Bacteria 5053
96 Ga0102735_1001216 3300007080 Bacteria 4514
97 Ga0466733_091806 3300042659 Bacteria 1352
98 Ga0466709_404844 3300042648 Bacteria 22037
99 Ga0466710_387076 3300042613 Bacteria 7778
100 Ga0466728_221816 3300042620 Bacteria 12247
101 Ga0466706_144698 3300042599 Bacteria 1518
102 Ga0466707_134928 3300042601 Bacteria 5424
103 Ga0466713_002928 3300042602 Unclassified 1549
104 Ga0466719_348784 3300042606 Bacteria 3517
105 Ga0103265_1000002 3300007068 Bacteria 139087

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300000062 IMNBL1DRAFT_c0002364 IMNBL1DRAFT_00023646 176
2 3300010049 Ga0123356_11540493 Ga0123356_115404932 176
3 3300010167 Ga0123353_10319554 Ga0123353_103195542 176
4 3300010167 Ga0123353_11211581 Ga0123353_112115812 176
5 3300010882 Ga0123354_10632028 Ga0123354_106320281 176
6 3300042590 Ga0466690_230710 Ga0466690_230710_18154_18684 176
7 3300042593 Ga0466691_098534 Ga0466691_098534_1304_1834 176
8 3300042596 Ga0466696_193592 Ga0466696_193592_74_604 176
9 3300042602 Ga0466713_002928 Ga0466713_002928_175_705 176
10 3300042602 Ga0466713_082837 Ga0466713_082837_656_1186 176
11 3300042602 Ga0466713_150871 Ga0466713_150871_1965_2495 176
12 3300042609 Ga0466722_040494 Ga0466722_040494_1495_2025 176
13 3300042609 Ga0466722_179154 Ga0466722_179154_5006_5536 176
14 3300042612 Ga0466705_021602 Ga0466705_021602_674_1204 176
15 3300042612 Ga0466705_196563 Ga0466705_196563_13614_14144 176
16 3300042616 Ga0466715_071082 Ga0466715_071082_2018_2548 176
17 3300042619 Ga0466726_164456 Ga0466726_164456_3922_4452 176
18 3300042620 Ga0466728_220036 Ga0466728_220036_7557_8087 176
19 3300042624 Ga0466735_151567 Ga0466735_151567_755_1285 176
20 3300042625 Ga0466730_019380 Ga0466730_019380_431_961 176
21 3300042643 Ga0466704_046750 Ga0466704_046750_19_549 176
22 3300042643 Ga0466704_056416 Ga0466704_056416_3512_4042 176
23 3300042643 Ga0466704_085663 Ga0466704_085663_5276_5806 176
24 3300042643 Ga0466704_159211 Ga0466704_159211_10582_11112 176
25 3300042643 Ga0466704_170837 Ga0466704_170837_9727_10257 176
26 3300042643 Ga0466704_245126 Ga0466704_245126_2356_2886 176
27 3300042648 Ga0466709_240386 Ga0466709_240386_4497_5027 176
28 3300042649 Ga0466724_07109 Ga0466724_07109_220865_221395 176
29 3300042655 Ga0466727_090895 Ga0466727_090895_1924_2454 176
30 3300042655 Ga0466727_129257 Ga0466727_129257_3638_4168 176
31 3300042656 Ga0466732_152370 Ga0466732_152370_776_1306 176
32 iso_pr_bacteria 2529292732 2529758874 176
33 iso_pr_bacteria 2847090942 2847093510 176
34 iso_pr_bacteria 2864788197 2864791903 176
35 iso_pr_bacteria 2864923010 2864926696 176
36 iso_pr_bacteria 2864948220 2864951905 176
37 iso_pr_bacteria 2910930387 2910931333 176
38 iso_pr_bacteria 2923982719 2923982959 176
39 iso_pr_bacteria 2940205530 2940208521 176
40 iso_pr_bacteria 2940209341 2940212272 176
41 iso_pr_bacteria 2940212447 2940215435 176
42 iso_pr_bacteria 2940298504 2940301489 176
43 iso_pr_bacteria 2940302308 2940305291 176
44 iso_pr_bacteria 2940306115 2940308809 176
45 iso_pr_bacteria 2940309933 2940312647 176
46 iso_pr_bacteria 2940313741 2940316460 176
47 iso_pr_bacteria 2940317558 2940320275 176
48 iso_pr_bacteria 2940321370 2940324031 176
49 iso_pr_bacteria 2940325180 2940328161 176
50 iso_pr_bacteria 2940328985 2940331968 176
51 iso_pr_bacteria 2940332795 2940335509 176
52 iso_pr_bacteria 2940371297 2940372729 176
53 iso_pr_bacteria 8020009074 8020009156 176
54 iso_pr_bacteria 8114076984 8114079734 176
55 2225789004 2227383574 2227828587 177
56 3300000062 IMNBL1DRAFT_c0002127 IMNBL1DRAFT_00021276 177
57 3300000062 IMNBL1DRAFT_c0102562 IMNBL1DRAFT_01025622 177
58 3300002464 Meta3P_1002250 Meta3P_100225028 177
59 3300005200 Ga0072940_1233525 Ga0072940_12335251 177
60 3300042601 Ga0466707_021500 Ga0466707_021500_807_1340 177
61 3300042602 Ga0466713_002422 Ga0466713_002422_2038_2571 177
62 3300042606 Ga0466719_324700 Ga0466719_324700_918_1451 177
63 3300042606 Ga0466719_348784 Ga0466719_348784_1261_1794 177
64 3300042616 Ga0466715_394135 Ga0466715_394135_3232_3765 177
65 3300042624 Ga0466735_232952 Ga0466735_232952_571_1104 177
66 3300042606 Ga0466719_162727 Ga0466719_162727_18324_18860 178
67 3300042613 Ga0466710_387076 Ga0466710_387076_45_581 178
68 3300042620 Ga0466728_221816 Ga0466728_221816_4406_4942 178
69 3300042624 Ga0466735_091953 Ga0466735_091953_338_874 178
70 3300042655 Ga0466727_016365 Ga0466727_016365_9659_10195 178
71 3300042655 Ga0466727_074084 Ga0466727_074084_235_771 178
72 3300042655 Ga0466727_275080 Ga0466727_275080_1369_1905 178
73 3300002834 JGI24696J40584_12859472 JGI24696J40584_128594721 179
74 3300005071 Ga0068302_10033376 Ga0068302_100333761 179
75 3300042609 Ga0466722_266173 Ga0466722_266173_10993_11532 179
76 3300042636 Ga0466703_081080 Ga0466703_081080_971_1510 179
77 3300042643 Ga0466704_078240 Ga0466704_078240_1822_2361 179
78 3300042656 Ga0466732_375818 Ga0466732_375818_2368_2907 179
79 3300042659 Ga0466733_139976 Ga0466733_139976_1602_2141 179
80 3300007068 Ga0103265_1000002 Ga0103265_100000276 180
81 3300007188 Ga0103264_1001119 Ga0103264_10011199 180
82 3300042590 Ga0466690_361501 Ga0466690_361501_14885_15427 180
83 3300042593 Ga0466691_024094 Ga0466691_024094_23088_23630 180
84 3300042593 Ga0466691_036644 Ga0466691_036644_11659_12201 180
85 3300042602 Ga0466713_051170 Ga0466713_051170_13942_14484 180
86 3300042602 Ga0466713_124834 Ga0466713_124834_12835_13377 180
87 3300042612 Ga0466705_233397 Ga0466705_233397_1321_1863 180
88 3300042616 Ga0466715_184396 Ga0466715_184396_8563_9105 180
89 3300042618 Ga0466723_176850 Ga0466723_176850_5418_5960 180
90 3300042620 Ga0466728_171509 Ga0466728_171509_8534_9076 180
91 3300042636 Ga0466703_155813 Ga0466703_155813_4013_4555 180
92 3300042643 Ga0466704_196052 Ga0466704_196052_1095_1637 180
93 3300042643 Ga0466704_239838 Ga0466704_239838_2776_3318 180
94 3300042648 Ga0466709_365596 Ga0466709_365596_24665_25207 180
95 3300042648 Ga0466709_404844 Ga0466709_404844_4250_4792 180
96 3300042659 Ga0466733_169327 Ga0466733_169327_9875_10417 180
97 iso_pr_bacteria 2864836148 2864837782 180
98 2225789004 2227559618 2228095345 181
99 3300002462 JGI24702J35022_10000230 JGI24702J35022_1000023015 181
100 3300002462 JGI24702J35022_10044076 JGI24702J35022_100440762 181
101 3300002462 JGI24702J35022_10136477 JGI24702J35022_101364772 181
102 3300005083 Ga0068305_10009904 Ga0068305_1000990412 181
103 3300042601 Ga0466707_134928 Ga0466707_134928_4487_5032 181
104 3300042606 Ga0466719_134282 Ga0466719_134282_3919_4464 181
105 3300042618 Ga0466723_006936 Ga0466723_006936_1579_2124 181
106 3300042618 Ga0466723_206130 Ga0466723_206130_15762_16307 181
107 3300042643 Ga0466704_131004 Ga0466704_131004_7884_8429 181
108 3300007080 Ga0102735_1001216 Ga0102735_10012161 182
109 3300042590 Ga0466690_001090 Ga0466690_001090_1068_1616 182
110 3300042624 Ga0466735_061198 Ga0466735_061198_5598_6146 182
111 3300042656 Ga0466732_398841 Ga0466732_398841_279_827 182
112 3300042659 Ga0466733_120112 Ga0466733_120112_137018_137566 182
113 3300042599 Ga0466706_144698 Ga0466706_144698_454_1005 183
114 3300042601 Ga0466707_325272 Ga0466707_325272_744_1328 183
115 3300042636 Ga0466703_206962 Ga0466703_206962_11832_12383 183
116 3300042659 Ga0466733_091806 Ga0466733_091806_237_788 183
117 iso_pr_bacteria 8065497608 8065497876 183
118 3300042601 Ga0466707_143524 Ga0466707_143524_39_593 184
119 3300007129 Ga0102734_1000004 Ga0102734_100000475 185
120 iso_pr_bacteria 3004667792 3004671454 185
121 3300005083 Ga0068305_10011322 Ga0068305_100113222 186
122 3300042602 Ga0466713_116734 Ga0466713_116734_12624_13184 186
123 3300005083 Ga0068305_10087386 Ga0068305_100873862 187
124 3300042652 Ga0466708_429470 Ga0466708_429470_3912_4475 187
125 3300042643 Ga0466704_036087 Ga0466704_036087_18812_19378 188
126 3300042643 Ga0466704_270385 Ga0466704_270385_4959_5525 188
127 3300042606 Ga0466719_314667 Ga0466719_314667_599_1177 192
128 3300042615 Ga0466711_036318 Ga0466711_036318_3100_3678 192
129 3300042609 Ga0466722_153451 Ga0466722_153451_1627_2226 199
130 3300042612 Ga0466705_004955 Ga0466705_004955_1141_1779 212
131 3300042654 Ga0466725_016638 Ga0466725_016638_4771_5430 219

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00588 SpoU_methylase SpoU rRNA Methylase family 65 207 0.93

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.