Protein Family IF10016

Metagenome Isolate
589 Members
429 Samples
269 Scaffolds
204.81 Avg Length

🧬 Representative Sequence

ID
3300042652|Ga0466708_422908|Ga0466708_422908_26931_27617
Length
228 aa
Sequence
MELKVINQEGQETAKLQVSDVLFARDYNEALIHQVVVAYQANARALKRAWKLDAVGEVVVYRADAHGNRKQKNRSEVAHTTHKPWKQKGTGRARAGMSSSPIWRGGGRAFPNTPDENFSQKVNRKMFRAGVASILSELVRQERLVVVDALSVEAPKTKLFVQKLKGMGLEERLLVITDHLDANLCLSSNNLPNVLVLEAHETDPVSLIRFPRVLVTKNAVAKFEEMWA

📊 Sample Types

Isolate 54.3%
Metagenome 45.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Apidae 41.3%
Coreidae 19.4%
Unclassified 9.0%
Termitidae 6.6%
Aphididae 5.3%
Formicidae 3.9%
Kalotermitidae 3.4%
Elmidae 2.4%
Armadillidiidae 1.5%
Culicidae 1.2%
Termopsidae 1.0%
Rhinotermitidae 1.0%
Hydrophilidae 0.7%
Curculionidae 0.7%
Berytidae 0.5%
Largidae 0.5%
Passalidae 0.5%
Alydidae 0.5%
Hormaphididae 0.2%
Hodotermitidae 0.2%
Crambidae 0.2%

🌳 Taxonomy

Archaea 0
Bacteria 543
Eukaryota 0
Viruses 0
Unclassified 46

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2518285616 Brachymonas chironomi DSM 19884 Isolate Unclassified
2 2558860196 Buchnera aphidicola W106 Isolate Aphididae
3 2603880165 Burkholderiales A1 Isolate Unclassified
4 2684622922 Gilliamella apicola Ga_169 Isolate Unclassified
5 2785510746 Gilliamella sp. ESL0441 Isolate Apidae
6 2785510747 Gilliamella sp. ESL0443 Isolate Apidae
7 2820089333 Unclassified Proteobacteria Lab288P3bin88 Isolate Unclassified
8 2837615801 Gilliamella apicola ESL0177 Isolate Apidae
9 2840748007 Snodgrassella alvi A-1-12 Isolate Apidae
10 2843301220 Snodgrassella alvi Nev4-2 Isolate Apidae
11 2846363972 Snodgrassella alvi N-W7 Isolate Apidae
12 2846485327 Gilliamella apicola AM4 Isolate Apidae
13 2849406737 Snodgrassella alvi PEB0178 Isolate Apidae
14 2849415715 Snodgrassella alvi A2 Isolate Apidae
15 2849471304 Gilliamella apicola NO5 Isolate Apidae
16 2857822956 Snodgrassella alvi N-W4 Isolate Apidae
17 2864968865 Paucibacter oligotrophus S00239 Isolate Elmidae
18 2873565274 Diaphorobacter sp. HDW4A Isolate Hydrophilidae
19 2873643457 Gilliamella apis A-4-12 Isolate Apidae
20 2876011797 Gilliamella apis NO16 Isolate Apidae
21 2876022486 Gilliamella apicola A8 Isolate Apidae
22 2876027665 Gilliamella apicola P54G Isolate Apidae
23 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
24 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
25 3300009457 Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov Metagenome
26 3300009493 Microbial communities of aphids from witch-hazel in New Haven, CT, USA - Hormaphis hamamelidis NM061510_01 seqcov Metagenome Hormaphididae
27 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
28 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
29 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
30 637000043 Buchnera aphidicola APS Isolate Aphididae
31 650377918 Buchnera aphidicola TLW03 Isolate Aphididae
32 8025658853 Caballeronia temeraria LZ065 Isolate Coreidae
33 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
34 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
35 8088491222 Gilliamella apicola ESL0178 Isolate Apidae
36 8101263066 Snodgrassella sp. M0351 Isolate Apidae
37 8101994502 Caballeronia sp. ATUFL_F2_KS42 Isolate Coreidae
38 8102124461 Caballeronia sp. INML3B Isolate Coreidae
39 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
40 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae
41 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
42 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
43 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
44 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
45 2189573031 Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. Metagenome Apidae
46 2820121232 Unclassified Proteobacteria Emb289P4bin32 Isolate Unclassified
47 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
48 2820164216 Unclassified Proteobacteria Cu122P1bin22 Isolate Unclassified
49 2834412944 Snodgrassella alvi A-5-24 Isolate Apidae
50 2834415282 Snodgrassella alvi Occ4-2 Isolate Apidae
51 2840797934 Gilliamella apicola Choc5-1 Isolate Apidae
52 2846359427 Snodgrassella alvi wkB273 Isolate Apidae
53 2846472545 Gilliamella sp. N-W3 Isolate Apidae
54 2846475167 Gilliamella apicola N-G5 Isolate Apidae
55 2846493360 Gilliamella apis N-G1 Isolate Apidae
56 2848339753 Ephemeroptericola cinctiostellae F02 Isolate Unclassified
57 2854132136 Gilliamella apicola wkB292 Isolate Apidae
58 2857825141 Snodgrassella alvi wkB332 Isolate Apidae
59 2857830159 Snodgrassella alvi A-9-24 Isolate Apidae
60 2857888719 Gilliamella apicola N-15-12 Isolate Apidae
61 2864914039 Chromobacterium alkanivorans S00172 Isolate Elmidae
62 2864988360 Chromobacterium alkanivorans S00296 Isolate Elmidae
63 2868464004 Snodgrassella alvi Pens2-2-5 Isolate Apidae
64 2870908367 Gilliamella apis NO13 Isolate Apidae
65 2870910722 Gilliamella apicola wkB112 Isolate Apidae
66 2873648542 Gilliamella apicola NO10 Isolate Apidae
67 2873653628 Gilliamella apicola App6-5 Isolate Apidae
68 2876014139 Gilliamella apicola wkB18 Isolate Apidae
69 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
70 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
71 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
72 3300009531 Microbial communities of aphids from cabbage in Tucson, AZ, USA - Lipaphis pseudobrassicae NM032704 seqcov Metagenome Aphididae
73 3300010217 Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Henan Dengzhou, China - Region2 Metagenome Aphididae
74 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
75 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
76 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
77 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
78 637000045 Buchnera aphidicola Sg Isolate Aphididae
79 643348522 Buchnera aphidicola Tuc7 Isolate Aphididae
80 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
81 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
82 8025666332 Caballeronia grimmiae LZ050 Isolate Coreidae
83 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
84 8025701579 Caballeronia telluris LZ031 Isolate Coreidae
85 8101258116 Snodgrassella sp. M0112 Isolate Apidae
86 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
87 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
88 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
89 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
90 8102201977 Caballeronia sp. LZ031 Isolate Coreidae
91 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
92 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
93 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
94 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
95 2585427850 Snodgrassella alvi wkB12 Isolate Apidae
96 2811994808 Snodgrassella alvi Sa_196 v2 Isolate Unclassified
97 2820042117 Unclassified Proteobacteria Th196P4bin58 Isolate Unclassified
98 2820050117 Unclassified Proteobacteria Th196P3bin129 Isolate Unclassified
99 2820086750 Unclassified Proteobacteria Lab288P3bin98 Isolate Unclassified
100 2820157249 Unclassified Proteobacteria Cu122P4bin11 Isolate Unclassified
101 2820161938 Unclassified Proteobacteria Cu122P3bin14 Isolate Unclassified
102 2837618715 Gilliamella apicola Aw-17 Isolate Apidae
103 2841195917 Gilliamella apicola wkB7 Isolate Apidae
104 2841821538 Psychrobacter sp. YP14 Isolate Unclassified
105 2846361553 Snodgrassella alvi PEB0171 Isolate Apidae
106 2846495668 Gilliamella apicola ESL0178 Isolate Apidae
107 2849417936 Snodgrassella alvi N9 Isolate Apidae
108 2849452216 Gilliamella apicola AW11 Isolate Apidae
109 2849455045 Gilliamella apicola NO8 Isolate Apidae
110 2852205774 Snodgrassella alvi ESL0196 Isolate Apidae
111 2854086477 Snodgrassella alvi N-S3 Isolate Apidae
112 2854097802 Snodgrassella alvi Aw-18 Isolate Apidae
113 2864937364 Acidovorax soli S00198 Isolate Elmidae
114 2868504459 Gilliamella apis NO4 Isolate Apidae
115 2870917785 Gilliamella apis NO15 Isolate Apidae
116 2873636219 Gilliamella apicola App2-1 Isolate Apidae
117 2876033458 Gilliamella apicola AM6 Isolate Apidae
118 2876036378 Gilliamella apicola Choc3-5 Isolate Apidae
119 2878462549 Gilliamella apicola Occ3-1 Isolate Apidae
120 2878464769 Gilliamella apis ESL0169 Isolate Apidae
121 2891720358 Azoarcus nasutitermitis CC-YHH838 Isolate Unclassified
122 2963630348 Burkholderiales bacterium 3487_49 Isolate Formicidae
123 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
124 3300009477 Microbial communities of aphids from Cirsium sp. in Ottawa, Ontario, CA - Brachycaudus cardui CNC#HEM061370 seqcov Metagenome
125 3300009478 Microbial communities of aphids from honeysuckle in Ottawa, Ontario, CA - Hyadaphis tataricae CNC#HEM071793 seqcov Metagenome
126 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
127 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
128 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
129 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
130 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
131 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
132 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
133 8025671076 Caballeronia cordobensis LZ034LL Isolate Coreidae
134 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
135 8101265296 Snodgrassella sp. W8158 Isolate Apidae
136 8102047609 Caballeronia sp. GACF5 Isolate Coreidae
137 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
138 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
139 8102117041 Caballeronia sp. INML3 Isolate Coreidae
140 8102131453 Caballeronia sp. INML5 Isolate Coreidae
141 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
142 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
143 8102230706 Caballeronia sp. LZ035 Isolate Coreidae
144 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
145 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
146 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
147 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
148 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
149 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
150 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
151 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
152 2558860197 Buchnera aphidicola F009 Isolate Aphididae
153 2756170265 Gilliamella apicola DSM 104097 Isolate Unclassified
154 2820065746 Unclassified Proteobacteria Nt197P3bin56 Isolate Unclassified
155 2820084079 Unclassified Proteobacteria Lab288P4bin103 Isolate Unclassified
156 2834098943 Gilliamella apis NO3 Isolate Apidae
157 2834887098 Buchnera aphidicola LNK Isolate Aphididae
158 2837560943 Snodgrassella alvi HK3 Isolate Apidae
159 2840743474 Snodgrassella alvi N-23 Isolate Apidae
160 2843337836 Gilliamella apicola N-12-12 Isolate Apidae
161 2846366200 Snodgrassella alvi Gris3-4 Isolate Apidae
162 2846370940 Snodgrassella alvi Nev3CBA3 Isolate Apidae
163 2846480698 Gilliamella apis N-G4 Isolate Apidae
164 2846488152 Gilliamella apicola Bim3-2 Isolate Apidae
165 2849449383 Gilliamella apicola WF3-4 Isolate Apidae
166 2849458003 Gilliamella apicola HK7 Isolate Apidae
167 2849463436 Gilliamella apicola A-8-12 Isolate Apidae
168 2857842411 Snodgrassella alvi Ruf1-X Isolate Apidae
169 2857876020 Gilliamella apicola Nev6-6 Isolate Apidae
170 2857881114 Gilliamella apis N-G3 Isolate Apidae
171 2864755708 Massilia timonae S00006 Isolate Elmidae
172 2868494745 Gilliamella apis NO1 Isolate Apidae
173 2870902796 Gilliamella apicola GillExp13 Isolate Apidae
174 2870915472 Gilliamella apis A-TSA3 Isolate Apidae
175 2873656248 Gilliamella apicola A-1-24 Isolate Apidae
176 2876016455 Gilliamella apicola N6 Isolate Apidae
177 3003178663 Psychrobacter fulvigenes KC-40 Isolate Unclassified
178 3003869270 Paraburkholderia sp. PGU16 Isolate Largidae
179 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
180 3300000460 Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O02 Metagenome Apidae
181 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
182 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
183 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
184 3300009468 Microbial communities of aphids from Rosa in Tucson, AZ, USA - Wahlgreniella nervata seqcov Metagenome Aphididae
185 3300009534 Microbial communities of aphids from Triticum aestivum in Marana, AZ, USA - Rhopalopisum padi seqcov Metagenome
186 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
187 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
188 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
189 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
190 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
191 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
192 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
193 643348520 Buchnera aphidicola 5A Isolate Aphididae
194 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
195 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
196 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
197 8025685901 Caballeronia fortuita LZ035 Isolate Coreidae
198 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
199 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
200 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
201 8088486376 Gilliamella apis ESL0172 Isolate Apidae
202 8100455565 Delftia sp. S67 Isolate Curculionidae
203 8101255641 Snodgrassella sp. M0110 Isolate Apidae
204 8101260589 Snodgrassella sp. M0118 Isolate Apidae
205 8101267702 Snodgrassella sp. W6238H14 Isolate Apidae
206 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
207 8102102351 Caballeronia sp. INML1 Isolate Coreidae
208 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
209 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
210 8102246966 Caballeronia sp. LZ050 Isolate Coreidae
211 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
212 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
213 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
214 8119099601 Snodgrassella alvi wkB2 Isolate Apidae
215 2511231158 Buchnera aphidicola Ua Isolate Aphididae
216 2515154047 Candidatus Gilliamella apicola wkB1 Isolate Apidae
217 2558860195 Buchnera aphidicola G002 Isolate Aphididae
218 2585428136 Snodgrassella alvi wkB2 Isolate Apidae
219 2654587723 Buchnera aphidicola (Aphis glycines) BAg Isolate Aphididae
220 2684622923 Gilliamella apicola Ga_172 Isolate Unclassified
221 2684622925 Gilliamella apicola Ga_178 Isolate Unclassified
222 2684622926 Gilliamella apicola Ga_182 Isolate Unclassified
223 2820047982 Unclassified Proteobacteria Th196P3bin67 Isolate Unclassified
224 2820059968 Unclassified Proteobacteria Nt197P4bin23 Isolate Unclassified
225 2820131053 Unclassified Proteobacteria Emb289P3bin8 Isolate Unclassified
226 2840795165 Gilliamella apicola N-22 Isolate Apidae
227 2846483029 Gilliamella apis AM1 Isolate Apidae
228 2849466174 Gilliamella apis P83G Isolate Apidae
229 2854100132 Snodgrassella alvi A-2-12 Isolate Apidae
230 2854134697 Gilliamella apicola Fer4-1 Isolate Apidae
231 2854144746 Gilliamella apicola NO6 Isolate Apidae
232 2854149989 Gilliamella apis A-TSA1 Isolate Apidae
233 2857827427 Snodgrassella alvi App6-4 Isolate Apidae
234 2857832487 Snodgrassella alvi HK9x Isolate Apidae
235 2857870431 Gilliamella apicola A-7-24 Isolate Apidae
236 2857873190 Gilliamella apicola Nev5-1 Isolate Apidae
237 2857886120 Gilliamella apicola Bim1-2 Isolate Apidae
238 2864826666 Acidovorax konjaci S00067 Isolate Elmidae
239 2868492035 Gilliamella apicola Occ4-3 Isolate Apidae
240 2873562573 Thermomonas sp. HDW16 Isolate Hydrophilidae
241 2873571580 Diaphorobacter sp. HDW4B Isolate Hydrophilidae
242 2876019154 Gilliamella apicola ESL0182 Isolate Apidae
243 2876030618 Gilliamella apicola HK2 Isolate Apidae
244 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
245 3300000472 Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-B02 Metagenome Apidae
246 3300000475 Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-J21 Metagenome Apidae
247 3300000490 Honey bee gut microbial communities from West Haven, Conneticut, USA - Gilliamella SCG AB-598-L16 Metagenome Apidae
248 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
249 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
250 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
251 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
252 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
253 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
254 3300009456 Microbial communities of aphids from Ribes sp. in Pocatello, ID, USA - Hyperomyzus lactucae CVD94-86 seqcov Metagenome
255 3300009458 Microbial communities of aphids from Asclepias tuberosa in Tucson, AZ, USA - Aphis nerii NM100509 seqcov Metagenome
256 3300009533 Microbial communities of aphids from Crataegus sp. in NC, USA - Muscaphis stroyani CVD02-21 seqcov Metagenome
257 3300009535 Microbial communities of aphids from Calyophus hartwegii in Tucson, AZ, USA - Macrosiphum gaurae seqcov Metagenome Aphididae
258 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
259 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
260 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
261 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
262 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
263 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
264 650377915 Buchnera aphidicola JF98 Isolate Aphididae
265 650377916 Buchnera aphidicola JF99 Isolate Aphididae
266 8025716094 Caballeronia zhejiangensis LZ028 Isolate Coreidae
267 8101270055 Snodgrassella sp. W8124 Isolate Apidae
268 8101278866 Snodgrassella sp. W6238H11 Isolate Apidae
269 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
270 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
271 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
272 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
273 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
274 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
275 8102251710 Caballeronia sp. LZ065 Isolate Coreidae
276 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
277 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
278 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
279 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
280 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
281 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
282 2687453742 Burkholderiales bacterium B_Cag20 Isolate Unclassified
283 2785510744 Gilliamella sp. ESL0405 Isolate Apidae
284 2785510745 Gilliamella sp. ESL0407 Isolate Apidae
285 2843334863 Gilliamella apicola A-2-24 Isolate Apidae
286 2846376288 Snodgrassella alvi Fer4-2 Isolate Apidae
287 2846379220 Snodgrassella alvi wkB237 Isolate Apidae
288 2846490831 Gilliamella apis ESL0172 Isolate Apidae
289 2849399727 Snodgrassella alvi Fer1-2 Isolate Apidae
290 2849402121 Snodgrassella alvi A-10-12 Isolate Apidae
291 2849409164 Snodgrassella alvi wkB298 Isolate Apidae
292 2849413536 Snodgrassella alvi N-S4 Isolate Apidae
293 2849446820 Gilliamella apicola Bif1-4 Isolate Apidae
294 2849468476 Gilliamella apicola N-28 Isolate Apidae
295 2854091108 Snodgrassella alvi wkB339 Isolate Apidae
296 2854095577 Snodgrassella alvi A12 Isolate Apidae
297 2854129949 Gilliamella apis M1-2G Isolate Apidae
298 2854139540 Gilliamella apicola Imp1-1 Isolate Apidae
299 2857837414 Snodgrassella alvi App4-8 Isolate Apidae
300 2857883421 Gilliamella apicola N2 Isolate Apidae
301 2857891623 Gilliamella apicola wkB171 Isolate Apidae
302 2864812326 Chitinimonas taiwanensis S00057 Isolate Elmidae
303 2864859030 Chromobacterium alkanivorans S00115 Isolate Elmidae
304 2868169047 Comamonas aquatica S00077 Isolate Elmidae
305 2868486652 Gilliamella sp. N-G2 Isolate Apidae
306 2868506828 Gilliamella apicola App4-10 Isolate Apidae
307 2870897478 Gilliamella apicola A-7-12 Isolate Apidae
308 2870900452 Gilliamella apis NO14 Isolate Apidae
309 2873640908 Gilliamella apicola wkB308 Isolate Apidae
310 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
311 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
312 3300009461 Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov Metagenome
313 3300009463 Microbial communities of aphids from fava bean in Tucson, AZ, USA - Aphis craccivora NM101509 seqcov Metagenome
314 3300009539 Microbial communities of aphids from Brassica oleracea in Tucson, AZ, USA - Brevicoryne brassicae seqcov Metagenome Aphididae
315 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
316 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
317 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
318 8023757577 Caballeronia peredens LP006 Isolate Coreidae
319 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
320 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
321 8025728939 Caballeronia telluris LZ024 Isolate Coreidae
322 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
323 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
324 8069775773 Caballeronia sp. LZ062 Isolate Coreidae
325 8100461708 Delftia sp. S65 Isolate Curculionidae
326 8101272231 Snodgrassella sp. W8132 Isolate Apidae
327 8101951471 Caballeronia sp. AAUFL_F1_KS45 Isolate Coreidae
328 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
329 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
330 8102020860 Caballeronia sp. AZ10_KS36 Isolate Coreidae
331 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
332 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae
333 2511231206 Buchnera aphidicola Ak Isolate Aphididae
334 2515154048 Candidatus Gilliamella apicola wkB11 Isolate Apidae
335 2684622924 Gilliamella apicola Ga_177 Isolate Unclassified
336 2684622927 Snodgrassella alvi Sa_196 Isolate Unclassified
337 2687453753 Burkholderiales bacterium B_Cag25 Isolate Unclassified
338 2837563510 Snodgrassella alvi N-S1 Isolate Apidae
339 2838840603 Gilliamella apicola A-9-12 Isolate Apidae
340 2843299038 Snodgrassella alvi N-S2 Isolate Apidae
341 2846368606 Snodgrassella alvi A-11-12 Isolate Apidae
342 2846477985 Gilliamella apicola Fer1-1 Isolate Apidae
343 2849404451 Snodgrassella alvi E1 Isolate Apidae
344 2849460838 Gilliamella apicola Gris3-2 Isolate Apidae
345 2854088767 Snodgrassella alvi MS1-3 Isolate Apidae
346 2854104879 Snodgrassella alvi Fer2-2 Isolate Apidae
347 2854127928 Gilliamella apicola Choc6-1 Isolate Apidae
348 2857840086 Snodgrassella alvi Aw-20 Isolate Apidae
349 2857868033 Gilliamella apis P62G Isolate Apidae
350 2868461634 Snodgrassella alvi Gris2-3-4 Isolate Apidae
351 2868497104 Gilliamella apis A-TSA4 Isolate Apidae
352 2870905362 Gilliamella apicola Nev3-1 Isolate Apidae
353 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
354 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
355 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
356 3300009482 Microbial communities of aphids from from Chrysanthemum sp. in New Haven, CT, USA - Macrosiphoniella sanborni NM102210_03 seqcov Metagenome
357 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
358 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
359 8024014383 Caballeronia sp. SL2Y3 Isolate Berytidae
360 8025740903 Caballeronia zhejiangensis LZ008 Isolate Coreidae
361 8069748016 Caballeronia sp. LP003 Isolate Coreidae
362 8088488961 Gilliamella apis ESL0169 Isolate Apidae
363 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
364 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
365 8102109360 Caballeronia sp. INML2 Isolate Coreidae
366 8102145433 Caballeronia sp. LP006 Isolate Coreidae
367 8102186987 Caballeronia sp. LZ028 Isolate Coreidae
368 8102223607 Caballeronia sp. LZ034LL Isolate Coreidae
369 8102286609 Caballeronia sp. NCTM5 Isolate Coreidae
370 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
371 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
372 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
373 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
374 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
375 2515154049 Candidatus Gilliamella apicola wkB30 Isolate Apidae
376 2558860194 Buchnera aphidicola USDA Isolate Aphididae
377 2571042003 Stenoxybacter acetivorans DSM 19021 Isolate Rhinotermitidae
378 2585427851 Snodgrassella alvi wkB29 Isolate Apidae
379 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
380 2820077244 Unclassified Proteobacteria Lab288P4bin72 Isolate Unclassified
381 2820152154 Unclassified Proteobacteria Cu122P5bin47 Isolate Unclassified
382 2834230000 Pandoraea novymonadis E262 Isolate Unclassified
383 2846373876 Snodgrassella alvi Gris1-3 Isolate Apidae
384 2848751009 Snodgrassella alvi App2-2 Isolate Apidae
385 2849411303 Snodgrassella alvi A3 Isolate Apidae
386 2854084220 Snodgrassella alvi Snod2-1-5 Isolate Apidae
387 2854093395 Snodgrassella alvi N-S5 Isolate Apidae
388 2854102457 Snodgrassella alvi Gris1-6 Isolate Apidae
389 2854141978 Gilliamella apicola A-12-12 Isolate Apidae
390 2854147632 Gilliamella apicola wkB195 Isolate Apidae
391 2855798354 Achromobacter insolitus AR476-2 Isolate Crambidae
392 2857835046 Snodgrassella alvi wkB9 Isolate Apidae
393 2857845033 Snodgrassella alvi WF3-3 Isolate Apidae
394 2857878760 Gilliamella apicola Gris1-4 Isolate Apidae
395 2864808494 Chitinimonas taiwanensis S00056 Isolate Elmidae
396 2868489326 Gilliamella apicola N10 Isolate Apidae
397 2868499409 Gilliamella apicola N-9-4 Isolate Apidae
398 2870913170 Gilliamella apis A-TSA2 Isolate Apidae
399 2870920129 Gilliamella apicola wkB108 Isolate Apidae
400 2872745489 Buchnera aphidicola LSR1 Isolate Aphididae
401 2873633977 Gilliamella apicola wkB178 Isolate Apidae
402 2873638493 Gilliamella apicola wkB72 Isolate Apidae
403 2873651485 Gilliamella apicola Choc4-2 Isolate Apidae
404 2876025319 Gilliamella apis NO12 Isolate Apidae
405 2889908211 Bowmanella denitrificans JL63 Isolate Unclassified
406 3003878002 Paraburkholderia sp. PGU19 Isolate Largidae
407 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
408 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
409 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
410 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
411 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
412 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
413 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
414 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
415 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
416 650377917 Buchnera aphidicola LL01 Isolate Aphididae
417 8023752828 Caballeronia grimmiae LZ062 Isolate Coreidae
418 8024019580 Caballeronia sp. Lep1P3 Isolate Coreidae
419 8024031916 Cupriavidus pauculus BHJ32i Isolate Alydidae
420 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
421 8069763219 Caballeronia sp. LZ008 Isolate Coreidae
422 8088493931 Gilliamella apis K-MP18 Isolate Apidae
423 8100449422 Delftia sp. S66 Isolate Curculionidae
424 8101274435 Snodgrassella sp. W8134 Isolate Apidae
425 8101276651 Snodgrassella sp. W8135 Isolate Apidae
426 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
427 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
428 8102181083 Caballeronia sp. LZ025 Isolate Coreidae
429 8102271933 Caballeronia sp. NCF4 Isolate Coreidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_264547 3300042611 Bacteria 2984
2 Ga0466710_388240 3300042613 Bacteria 4441
3 Ga0466712_057974 3300042614 Bacteria 5746
4 Ga0466711_444412 3300042615 Bacteria 3726
5 Ga0466715_355522 3300042616 Bacteria 36627
6 Ga0123356_10005609 3300010049 Bacteria 12758
7 Ga0123356_10634158 3300010049 Bacteria 1235
8 Ga0123354_10357111 3300010882 Unclassified 1294
9 Ga0160433_104621 3300012846 Bacteria 2194
10 Ga0160447_106448 3300012849 Unclassified 3099
11 Ga0160430_118761 3300012852 Unclassified 983
12 Ga0466690_039408 3300042590 Bacteria 3070
13 Ga0466690_142458 3300042590 Bacteria 24638
14 Ga0466690_310963 3300042590 Bacteria 1692
15 Ga0466695_303783 3300042595 Bacteria 1637
16 Ga0466701_034034 3300042598 Bacteria 3203
17 Ga0466701_081790 3300042598 Unclassified 2537
18 Ga0466701_084882 3300042598 Bacteria 5042
19 Ga0466713_051830 3300042602 Bacteria 7850
20 Ga0466717_014539 3300042604 Bacteria 7299
21 Ga0466719_196815 3300042606 Bacteria 7189
22 Ga0466719_442292 3300042606 Bacteria 1742
23 Ga0466722_069074 3300042609 Bacteria 8279
24 Ga0466697_049973 3300042611 Unclassified 3798
25 Ga0466709_342330 3300042648 Bacteria 9914
26 Ga0466725_015277 3300042654 Bacteria 7882
27 Ga0466727_137609 3300042655 Bacteria 15927
28 SCG598B02_11303 3300000472 Unclassified 2571
29 SCG598J21_12823 3300000475 Bacteria 133353
30 SCG598L16_104919 3300000490 Bacteria 2185
31 CVPL010W_10041023 3300002931 Bacteria 1369
32 Ga0072941_1627484 3300005201 Bacteria 4046
33 Ga0102739_1031684 3300007095 Unclassified 705
34 Ga0103264_1000013 3300007188 Bacteria 122810
35 Ga0127526_1000110 3300009535 Bacteria 643549
36 Ga0123357_10000005 3300009784 Bacteria 295874
37 Ga0466697_266060 3300042611 Unclassified 1520
38 Ga0466733_032202 3300042659 Bacteria 3300
39 Ga0466710_211598 3300042613 Bacteria 14971
40 Ga0466715_639114 3300042616 Bacteria 1746
41 Ga0123357_10005768 3300009784 Bacteria 14912
42 Ga0123354_10002414 3300010882 Bacteria 24635
43 Ga0160469_108166 3300012824 Bacteria 969
44 Ga0160441_108679 3300012825 Unclassified 1302
45 Ga0466693_114159 3300042592 Bacteria 3180
46 Ga0466691_067834 3300042593 Bacteria 5319
47 Ga0466691_070961 3300042593 Bacteria 5558
48 Ga0466691_123602 3300042593 Bacteria 12992
49 Ga0466696_042576 3300042596 Bacteria 13410
50 Ga0466707_398396 3300042601 Bacteria 9298
51 Ga0466717_091910 3300042604 Bacteria 9410
52 Ga0466719_196546 3300042606 Bacteria 8334
53 Ga0466719_412608 3300042606 Bacteria 5089
54 Ga0466703_162382 3300042636 Bacteria 11491
55 Ga0466704_084352 3300042643 Bacteria 1425
56 Ga0466725_038753 3300042654 Bacteria 1783
57 JGI24702J35022_10007115 3300002462 Bacteria 6431
58 JGI24705J35276_12236155 3300002504 Bacteria 7572
59 CVPL010W_10000724 3300002931 Bacteria 36746
60 CVPL005L_10015572 3300002938 Bacteria 12401
61 Ga0068305_10277852 3300005083 Bacteria 15502
62 Ga0072941_1148988 3300005201 Bacteria 3629
63 Ga0102738_1000171 3300007141 Bacteria 15690
64 Ga0102737_1000288 3300007142 Bacteria 17121
65 Ga0103264_1001542 3300007188 Bacteria 10153
66 Ga0103264_1011568 3300007188 Unclassified 4322
67 Ga0103264_1014995 3300007188 Unclassified 4048
68 Ga0466705_353643 3300042612 Bacteria 46241
69 Ga0466710_025665 3300042613 Bacteria 1417
70 Ga0466715_193807 3300042616 Bacteria 17352
71 Ga0466723_124011 3300042618 Bacteria 17539
72 Ga0123357_10005148 3300009784 Bacteria 15597
73 Ga0123354_10033211 3300010882 Unclassified 8080
74 Ga0160459_116337 3300012831 Unclassified 830
75 Ga0466656_271070 3300042550 Bacteria 1848
76 Ga0466657_147301 3300042582 Bacteria 4802
77 Ga0466690_317622 3300042590 Unclassified 3568
78 Ga0466692_167359 3300042591 Bacteria 33417
79 Ga0466696_350914 3300042596 Unclassified 3527
80 Ga0466701_005277 3300042598 Bacteria 23408
81 Ga0466701_027410 3300042598 Bacteria 6386
82 Ga0466706_005069 3300042599 Bacteria 5850
83 Ga0466706_114011 3300042599 Bacteria 2201
84 Ga0466700_086934 3300042600 Bacteria 5684
85 Ga0466717_137923 3300042604 Bacteria 4360
86 Ga0466719_029114 3300042606 Bacteria 3596
87 Ga0466719_471696 3300042606 Bacteria 1280
88 Ga0466722_164700 3300042609 Bacteria 4354
89 Ga0466731_108024 3300042622 Unclassified 2001
90 Ga0466735_111007 3300042624 Unclassified 3795
91 Ga0466730_000281 3300042625 Bacteria 35325
92 Ga0466730_017261 3300042625 Bacteria 3475
93 Ga0466703_234993 3300042636 Unclassified 2203
94 Ga0466704_150483 3300042643 Bacteria 8168
95 Ga0466704_608928 3300042643 Bacteria 18017
96 Ga0466724_67933 3300042649 Bacteria 20884
97 Ga0466708_088956 3300042652 Bacteria 13799
98 Ga0466708_366542 3300042652 Bacteria 12576
99 Ga0466708_422908 3300042652 Bacteria 38381
100 Ga0466725_321717 3300042654 Bacteria 1460
101 CVPL010W_10032397 3300002931 Unclassified 1972
102 Ga0102735_1000316 3300007080 Bacteria 11156
103 Ga0102737_1014167 3300007142 Unclassified 1284
104 Ga0103264_1000602 3300007188 Bacteria 17678
105 Ga0127524_100015 3300009478 Bacteria 633867
106 Ga0466705_129008 3300042612 Bacteria 16819
107 Ga0466733_216390 3300042659 Bacteria 1222
108 Ga0466710_230397 3300042613 Unclassified 5472
109 Ga0466711_180869 3300042615 Bacteria 2223
110 Ga0466715_204503 3300042616 Bacteria 40116
111 Ga0466726_083783 3300042619 Bacteria 3228
112 Ga0466726_188842 3300042619 Bacteria 15083
113 Ga0123353_10036651 3300010167 Bacteria 7684
114 Ga0160453_101505 3300012814 Bacteria 7806
115 Ga0160468_103222 3300012819 Bacteria 2313
116 Ga0160444_100030 3300012841 Bacteria 245980
117 Ga0415639_009611 3300038395 Bacteria 4413
118 Ga0466656_188662 3300042550 Bacteria 3466
119 Ga0466690_001556 3300042590 Bacteria 38032
120 Ga0466701_019319 3300042598 Bacteria 2597
121 Ga0466701_049353 3300042598 Bacteria 1953
122 Ga0466701_059715 3300042598 Bacteria 3296
123 Ga0466701_063061 3300042598 Unclassified 2537
124 Ga0466707_222672 3300042601 Bacteria 7078
125 Ga0466734_030486 3300042623 Bacteria 2434
126 Ga0466734_109601 3300042623 Bacteria 3111
127 Ga0466704_380145 3300042643 Bacteria 5193
128 Ga0466724_62199 3300042649 Bacteria 9065
129 Ga0466725_017039 3300042654 Bacteria 50096
130 IMNBL1DRAFT_c0006760 3300000062 Bacteria 6196
131 HBC_ctgsDRAFT_1003725 3300000333 Bacteria 3503
132 Ga0072941_1008779 3300005201 Bacteria 10347
133 Ga0103263_101601 3300007042 Unclassified 2884
134 Ga0102734_1006226 3300007129 Unclassified 2668
135 Ga0103264_1000527 3300007188 Bacteria 24761
136 Ga0105524_101418 3300007733 Bacteria 4740
137 Ga0127644_100036 3300009463 Bacteria 636219
138 Ga0127530_100162 3300009468 Bacteria 26462
139 Ga0466711_117375 3300042615 Bacteria 8154
140 Ga0466715_639431 3300042616 Bacteria 2229
141 Ga0466726_323683 3300042619 Bacteria 1013
142 Ga0466728_065377 3300042620 Unclassified 17183
143 Ga0123357_10040381 3300009784 Unclassified 6343
144 Ga0160454_101751 3300012798 Bacteria 2919
145 Ga0160460_101558 3300012845 Bacteria 7266
146 Ga0160460_110895 3300012845 Unclassified 1104
147 Ga0466656_251915 3300042550 Bacteria 5598
148 Ga0466657_118976 3300042582 Bacteria 3235
149 Ga0466701_000530 3300042598 Bacteria 3979
150 Ga0466701_030295 3300042598 Bacteria 4071
151 Ga0466706_241347 3300042599 Bacteria 14034
152 Ga0466713_091546 3300042602 Bacteria 18477
153 Ga0466717_192548 3300042604 Unclassified 2438
154 Ga0466734_015756 3300042623 Bacteria 28187
155 Ga0466734_121583 3300042623 Bacteria 2062
156 Ga0466730_029373 3300042625 Bacteria 4669
157 Ga0466703_232591 3300042636 Bacteria 10669
158 Ga0466708_129072 3300042652 Bacteria 14349
159 SCG598O02_12456 3300000460 Bacteria 38612
160 CVPL010W_10027853 3300002931 Unclassified 2482
161 CVPL005W_1000710 3300002934 Bacteria 11719
162 Ga0068305_10587743 3300005083 Unclassified 1016
163 Ga0103261_1007108 3300007083 Unclassified 1608
164 Ga0102739_1008061 3300007095 Unclassified 1388
165 Ga0103264_1000318 3300007188 Bacteria 26213
166 Ga0103264_1033151 3300007188 Bacteria 2339
167 Ga0105524_105069 3300007733 Bacteria 1775
168 Ga0127646_100058 3300009458 Bacteria 571963
169 Ga0127522_100011 3300009477 Bacteria 644448
170 Ga0127528_1000015 3300009533 Bacteria 619772
171 Ga0466710_223111 3300042613 Unclassified 3098
172 Ga0466710_328608 3300042613 Bacteria 1242
173 Ga0466715_253033 3300042616 Bacteria 21734
174 Ga0136159_1000005 3300010217 Bacteria 637387
175 Ga0123354_10524744 3300010882 Bacteria 908
176 Ga0160452_100151 3300012834 Bacteria 81696
177 Ga0466657_021707 3300042582 Bacteria 36648
178 Ga0466657_064910 3300042582 Unclassified 3043
179 Ga0466657_145587 3300042582 Bacteria 3065
180 Ga0466657_194100 3300042582 Bacteria 1754
181 Ga0466706_042415 3300042599 Bacteria 6380
182 Ga0466719_006996 3300042606 Bacteria 2031
183 Ga0466719_486174 3300042606 Bacteria 4623
184 Ga0466721_187322 3300042608 Bacteria 4578
185 Ga0466729_260780 3300042621 Unclassified 4754
186 Ga0466734_013590 3300042623 Bacteria 11762
187 Ga0466703_196402 3300042636 Bacteria 10145
188 Ga0466704_503680 3300042643 Bacteria 1735
189 Ga0466709_103920 3300042648 Bacteria 2863
190 Ga0466709_271167 3300042648 Unclassified 2601
191 Ga0466724_23524 3300042649 Bacteria 1147
192 Ga0466724_54183 3300042649 Bacteria 59651
193 Ga0466725_092290 3300042654 Bacteria 16768
194 Ga0466725_319345 3300042654 Unclassified 7153
195 Ga0102736_1002369 3300007052 Unclassified 3366
196 Ga0103266_1000132 3300007067 Bacteria 24007
197 Ga0103261_1002402 3300007083 Bacteria 2934
198 Ga0103264_1001327 3300007188 Bacteria 14916
199 Ga0103268_1003185 3300007192 Bacteria 3471
200 Ga0127657_121819 3300009457 Bacteria 2994
201 Ga0127654_100011 3300009493 Bacteria 643543
202 Ga0466705_238427 3300042612 Unclassified 6350
203 Ga0466732_457005 3300042656 Unclassified 2826
204 Ga0466733_080847 3300042659 Bacteria 30122
205 Ga0466710_115345 3300042613 Bacteria 8153
206 Ga0466710_229469 3300042613 Unclassified 2451
207 Ga0466710_362701 3300042613 Bacteria 1987
208 Ga0466723_023127 3300042618 Bacteria 13191
209 Ga0466726_396445 3300042619 Bacteria 7446
210 Ga0466729_109686 3300042621 Bacteria 28411
211 Ga0123356_10094274 3300010049 Bacteria 2858
212 Ga0123354_10010479 3300010882 Bacteria 14280
213 Ga0160434_101262 3300012850 Bacteria 4920
214 Ga0160435_1003342 3300012857 Bacteria 3807
215 Ga0466657_096754 3300042582 Bacteria 7478
216 Ga0466692_017555 3300042591 Bacteria 19818
217 Ga0466701_001027 3300042598 Bacteria 90142
218 Ga0466707_258979 3300042601 Bacteria 7487
219 Ga0466719_199877 3300042606 Bacteria 4803
220 Ga0466719_486350 3300042606 Bacteria 13185
221 Ga0466734_173971 3300042623 Bacteria 5929
222 Ga0466704_405583 3300042643 Bacteria 15459
223 Ga0466704_551631 3300042643 Bacteria 4726
224 Ga0466708_131644 3300042652 Bacteria 25858
225 Ga0466725_051815 3300042654 Bacteria 1592
226 Ga0466725_185939 3300042654 Bacteria 36509
227 Ga0466725_203690 3300042654 Bacteria 1301
228 Ga0466727_312739 3300042655 Bacteria 55771
229 gam1t_NODE_270540_length=48566_GC=35_7_Contigs=1 2189573031 Bacteria 48566
230 IMNBGM34_c001305 3300000036 Bacteria 4470
231 JGI24702J35022_10049565 3300002462 Unclassified 2237
232 CVPL010W_10027869 3300002931 Unclassified 2481
233 CVPL005L_10004946 3300002938 Bacteria 14009
234 Ga0102734_1021422 3300007129 Bacteria 1614
235 Ga0103264_1001938 3300007188 Bacteria 9207
236 Ga0127523_100016 3300009456 Bacteria 642955
237 Ga0127648_100010 3300009534 Bacteria 473475
238 Ga0127521_100003 3300009539 Bacteria 647534
239 Ga0466710_245229 3300042613 Unclassified 16763
240 Ga0466711_109307 3300042615 Bacteria 29995
241 Ga0123355_10322209 3300009826 Bacteria 2081
242 Ga0123353_10480011 3300010167 Bacteria 1819
243 Ga0123354_10002575 3300010882 Bacteria 24153
244 Ga0123354_10022551 3300010882 Bacteria 9926
245 Ga0160443_115335 3300012848 Bacteria 832
246 Ga0160430_100531 3300012852 Bacteria 20613
247 Ga0160457_1000003 3300012858 Bacteria 1020748
248 Ga0466657_157400 3300042582 Unclassified 3595
249 Ga0466692_081226 3300042591 Bacteria 19781
250 Ga0466692_162230 3300042591 Bacteria 3554
251 Ga0466701_069022 3300042598 Bacteria 2532
252 Ga0466716_100747 3300042605 Bacteria 3548
253 Ga0466716_288795 3300042605 Bacteria 12220
254 Ga0466719_064168 3300042606 Bacteria 2287
255 Ga0466697_000265 3300042611 Bacteria 1131
256 Ga0466735_049949 3300042624 Bacteria 3266
257 Ga0466702_243468 3300042635 Bacteria 3972
258 Ga0466703_022903 3300042636 Bacteria 5415
259 Ga0466708_032942 3300042652 Bacteria 36683
260 Ga0466725_091734 3300042654 Unclassified 1544
261 Ga0466725_272788 3300042654 Bacteria 15338
262 CVPL010W_10001231 3300002931 Bacteria 29573
263 Ga0068302_10044078 3300005071 Bacteria 10404
264 Ga0074278_105790 3300005721 Bacteria 48566
265 Ga0102736_1001882 3300007052 Bacteria 3485
266 Ga0102740_1003189 3300007140 Bacteria 3583
267 Ga0127645_100025 3300009461 Bacteria 631301
268 Ga0127527_100008 3300009482 Bacteria 420258
269 Ga0127525_100070 3300009531 Bacteria 646221

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042654 Ga0466725_091734 Ga0466725_091734_13_570 185
2 3300012857 Ga0160435_1003342 Ga0160435_10033424 189
3 3300012846 Ga0160433_104621 Ga0160433_1046214 191
4 3300012845 Ga0160460_101558 Ga0160460_10155813 193
5 3300012858 Ga0160457_1000003 Ga0160457_10000034 193
6 3300012852 Ga0160430_100531 Ga0160430_1005314 194
7 3300042582 Ga0466657_194100 Ga0466657_194100_1086_1697 194
8 3300005083 Ga0068305_10587743 Ga0068305_105877432 197
9 2189573031 gam1t_NODE_270540_length=48566_GC=35_7_Contigs=1 gam1t_00069790 200
10 iso_pr_bacteria 2515154047 2515331026 200
11 iso_pr_bacteria 2515154048 2515334812 200
12 iso_pr_bacteria 2515154049 2515336691 200
13 iso_pr_bacteria 2684622922 2686092621 200
14 iso_pr_bacteria 2684622923 2686094849 200
15 iso_pr_bacteria 2684622924 2686097335 200
16 iso_pr_bacteria 2684622925 2686100175 200
17 iso_pr_bacteria 2684622926 2686102875 200
18 iso_pr_bacteria 2756170265 2756751536 200
19 iso_pr_bacteria 2785510744 2785736768 200
20 iso_pr_bacteria 2785510745 2785739240 200
21 iso_pr_bacteria 2785510746 2785741700 200
22 iso_pr_bacteria 2785510747 2785744166 200
23 iso_pr_bacteria 2834098943 2834099073 200
24 iso_pr_bacteria 2837615801 2837615963 200
25 iso_pr_bacteria 2837618715 2837620139 200
26 iso_pr_bacteria 2838840603 2838840896 200
27 iso_pr_bacteria 2840795165 2840796208 200
28 iso_pr_bacteria 2840797934 2840798209 200
29 iso_pr_bacteria 2841195917 2841197557 200
30 iso_pr_bacteria 2841821538 2841821975 200
31 iso_pr_bacteria 2843334863 2843335629 200
32 iso_pr_bacteria 2843337836 2843337956 200
33 iso_pr_bacteria 2846472545 2846474336 200
34 iso_pr_bacteria 2846475167 2846475605 200
35 iso_pr_bacteria 2846477985 2846478276 200
36 iso_pr_bacteria 2846480698 2846480727 200
37 iso_pr_bacteria 2846483029 2846483385 200
38 iso_pr_bacteria 2846485327 2846485447 200
39 iso_pr_bacteria 2846488152 2846489141 200
40 iso_pr_bacteria 2846488152 2846489553 200
41 iso_pr_bacteria 2846490831 2846490978 200
42 iso_pr_bacteria 2846493360 2846494576 200
43 iso_pr_bacteria 2846495668 2846495803 200
44 iso_pr_bacteria 2849446820 2849448284 200
45 iso_pr_bacteria 2849449383 2849451217 200
46 iso_pr_bacteria 2849452216 2849452232 200
47 iso_pr_bacteria 2849455045 2849457903 200
48 iso_pr_bacteria 2849458003 2849459302 200
49 iso_pr_bacteria 2849460838 2849462700 200
50 iso_pr_bacteria 2849463436 2849464385 200
51 iso_pr_bacteria 2849466174 2849467199 200
52 iso_pr_bacteria 2849468476 2849470160 200
53 iso_pr_bacteria 2849471304 2849471440 200
54 iso_pr_bacteria 2854127928 2854128873 200
55 iso_pr_bacteria 2854129949 2854132021 200
56 iso_pr_bacteria 2854132136 2854133914 200
57 iso_pr_bacteria 2854134697 2854134944 200
58 iso_pr_bacteria 2854139540 2854141349 200
59 iso_pr_bacteria 2854141978 2854142103 200
60 iso_pr_bacteria 2854144746 2854146498 200
61 iso_pr_bacteria 2854147632 2854149011 200
62 iso_pr_bacteria 2854149989 2854150074 200
63 iso_pr_bacteria 2857868033 2857868531 200
64 iso_pr_bacteria 2857870431 2857870534 200
65 iso_pr_bacteria 2857873190 2857874899 200
66 iso_pr_bacteria 2857876020 2857878705 200
67 iso_pr_bacteria 2857878760 2857880206 200
68 iso_pr_bacteria 2857881114 2857882137 200
69 iso_pr_bacteria 2857883421 2857883538 200
70 iso_pr_bacteria 2857886120 2857886955 200
71 iso_pr_bacteria 2857888719 2857888776 200
72 iso_pr_bacteria 2857891623 2857892167 200
73 iso_pr_bacteria 2868486652 2868487347 200
74 iso_pr_bacteria 2868489326 2868489355 200
75 iso_pr_bacteria 2868492035 2868494484 200
76 iso_pr_bacteria 2868494745 2868494843 200
77 iso_pr_bacteria 2868497104 2868497225 200
78 iso_pr_bacteria 2868499409 2868499545 200
79 iso_pr_bacteria 2868504459 2868505325 200
80 iso_pr_bacteria 2868506828 2868508023 200
81 iso_pr_bacteria 2870897478 2870898056 200
82 iso_pr_bacteria 2870900452 2870901748 200
83 iso_pr_bacteria 2870902796 2870902814 200
84 iso_pr_bacteria 2870905362 2870907987 200
85 iso_pr_bacteria 2870908367 2870908497 200
86 iso_pr_bacteria 2870910722 2870913056 200
87 iso_pr_bacteria 2870913170 2870913291 200
88 iso_pr_bacteria 2870915472 2870915587 200
89 iso_pr_bacteria 2870917785 2870917915 200
90 iso_pr_bacteria 2870920129 2870922799 200
91 iso_pr_bacteria 2873562573 2873564866 200
92 iso_pr_bacteria 2873633977 2873635774 200
93 iso_pr_bacteria 2873636219 2873637449 200
94 iso_pr_bacteria 2873638493 2873640477 200
95 iso_pr_bacteria 2873640908 2873642007 200
96 iso_pr_bacteria 2873643457 2873643580 200
97 iso_pr_bacteria 2873648542 2873649505 200
98 iso_pr_bacteria 2873651485 2873652732 200
99 iso_pr_bacteria 2873653628 2873654999 200
100 iso_pr_bacteria 2873656248 2873656355 200
101 iso_pr_bacteria 2876011797 2876012798 200
102 iso_pr_bacteria 2876014139 2876015919 200
103 iso_pr_bacteria 2876016455 2876016600 200
104 iso_pr_bacteria 2876019154 2876019396 200
105 iso_pr_bacteria 2876022486 2876024475 200
106 iso_pr_bacteria 2876025319 2876025448 200
107 iso_pr_bacteria 2876027665 2876029858 200
108 iso_pr_bacteria 2876030618 2876032399 200
109 iso_pr_bacteria 2876033458 2876035302 200
110 iso_pr_bacteria 2876036378 2876037430 200
111 iso_pr_bacteria 2878462549 2878462781 200
112 iso_pr_bacteria 2878464769 2878464913 200
113 iso_pr_bacteria 3003178663 3003181046 200
114 iso_pr_bacteria 8088486376 8088486476 200
115 iso_pr_bacteria 8088488961 8088489046 200
116 iso_pr_bacteria 8088491222 8088491316 200
117 iso_pr_bacteria 8088493931 8088494030 200
118 3300000333 HBC_ctgsDRAFT_1003725 HBC_ctgsDRAFT_10037255 201
119 3300000472 SCG598B02_11303 SCG598B02_113033 201
120 3300000490 SCG598L16_104919 SCG598L16_1049192 201
121 3300005721 Ga0074278_105790 Ga0074278_10579052 201
122 3300007733 Ga0105524_101418 Ga0105524_1014184 201
123 3300007733 Ga0105524_105069 Ga0105524_1050692 201
124 3300009457 Ga0127657_121819 Ga0127657_1218194 201
125 iso_pr_bacteria 2511231158 2511830581 201
126 iso_pr_bacteria 2511231206 2511995418 201
127 iso_pr_bacteria 2558860194 2559122206 201
128 iso_pr_bacteria 2558860195 2559122813 201
129 iso_pr_bacteria 2558860196 2559123428 201
130 iso_pr_bacteria 2558860197 2559124036 201
131 iso_pr_bacteria 2654587723 2655552704 201
132 iso_pr_bacteria 2834887098 2834887158 201
133 iso_pr_bacteria 2872745489 2872746023 201
134 iso_pr_bacteria 2889908211 2889908261 201
135 iso_pr_bacteria 637000043 637056535 201
136 iso_pr_bacteria 637000045 637306391 201
137 iso_pr_bacteria 643348520 643571889 201
138 iso_pr_bacteria 643348522 643572477 201
139 iso_pr_bacteria 650377915 650450061 201
140 iso_pr_bacteria 650377916 650449532 201
141 iso_pr_bacteria 650377917 650448300 201
142 iso_pr_bacteria 650377918 650448911 201
143 3300007188 Ga0103264_1000318 Ga0103264_10003182 202
144 3300009456 Ga0127523_100016 Ga0127523_100016540 202
145 3300009458 Ga0127646_100058 Ga0127646_100058289 202
146 3300009461 Ga0127645_100025 Ga0127645_100025277 202
147 3300009463 Ga0127644_100036 Ga0127644_10003669 202
148 3300009468 Ga0127530_100162 Ga0127530_1001623 202
149 3300009477 Ga0127522_100011 Ga0127522_100011549 202
150 3300009478 Ga0127524_100015 Ga0127524_100015406 202
151 3300009482 Ga0127527_100008 Ga0127527_10000875 202
152 3300009493 Ga0127654_100011 Ga0127654_100011319 202
153 3300009531 Ga0127525_100070 Ga0127525_100070396 202
154 3300009533 Ga0127528_1000015 Ga0127528_1000015565 202
155 3300009534 Ga0127648_100010 Ga0127648_100010406 202
156 3300009535 Ga0127526_1000110 Ga0127526_1000110541 202
157 3300009539 Ga0127521_100003 Ga0127521_100003464 202
158 3300010217 Ga0136159_1000005 Ga0136159_1000005334 202
159 3300012798 Ga0160454_101751 Ga0160454_1017515 204
160 3300042593 Ga0466691_067834 Ga0466691_067834_744_1361 205
161 3300042598 Ga0466701_027410 Ga0466701_027410_4105_4722 205
162 3300042601 Ga0466707_398396 Ga0466707_398396_6058_6675 205
163 3300042615 Ga0466711_180869 Ga0466711_180869_228_845 205
164 3300042654 Ga0466725_321717 Ga0466725_321717_72_689 205
165 3300042655 Ga0466727_312739 Ga0466727_312739_53758_54375 205
166 iso_pr_bacteria 2603880165 2606014211 205
167 iso_pr_bacteria 2848339753 2848340030 205
168 3300002931 CVPL010W_10027853 CVPL010W_100278532 206
169 3300002931 CVPL010W_10027869 CVPL010W_100278692 206
170 3300007095 Ga0102739_1008061 Ga0102739_10080613 206
171 3300007095 Ga0102739_1031684 Ga0102739_10316841 206
172 3300007188 Ga0103264_1000527 Ga0103264_10005273 206
173 3300007188 Ga0103264_1001327 Ga0103264_10013273 206
174 3300042550 Ga0466656_188662 Ga0466656_188662_1095_1715 206
175 3300042550 Ga0466656_251915 Ga0466656_251915_1998_2618 206
176 3300042550 Ga0466656_271070 Ga0466656_271070_93_713 206
177 3300042582 Ga0466657_064910 Ga0466657_064910_628_1248 206
178 3300042582 Ga0466657_145587 Ga0466657_145587_1818_2438 206
179 3300042582 Ga0466657_147301 Ga0466657_147301_2775_3395 206
180 3300042590 Ga0466690_001556 Ga0466690_001556_35988_36608 206
181 3300042590 Ga0466690_039408 Ga0466690_039408_1426_2046 206
182 3300042591 Ga0466692_081226 Ga0466692_081226_17188_17808 206
183 3300042591 Ga0466692_167359 Ga0466692_167359_16655_17275 206
184 3300042592 Ga0466693_114159 Ga0466693_114159_2479_3099 206
185 3300042593 Ga0466691_123602 Ga0466691_123602_11337_11957 206
186 3300042596 Ga0466696_042576 Ga0466696_042576_12097_12717 206
187 3300042596 Ga0466696_350914 Ga0466696_350914_441_1061 206
188 3300042598 Ga0466701_001027 Ga0466701_001027_1546_2166 206
189 3300042598 Ga0466701_005277 Ga0466701_005277_21468_22088 206
190 3300042598 Ga0466701_030295 Ga0466701_030295_2822_3442 206
191 3300042598 Ga0466701_034034 Ga0466701_034034_1314_1934 206
192 3300042598 Ga0466701_059715 Ga0466701_059715_1084_1704 206
193 3300042598 Ga0466701_069022 Ga0466701_069022_654_1274 206
194 3300042598 Ga0466701_084882 Ga0466701_084882_2602_3222 206
195 3300042599 Ga0466706_241347 Ga0466706_241347_367_987 206
196 3300042600 Ga0466700_086934 Ga0466700_086934_3412_4032 206
197 3300042601 Ga0466707_258979 Ga0466707_258979_785_1405 206
198 3300042602 Ga0466713_091546 Ga0466713_091546_2529_3149 206
199 3300042604 Ga0466717_014539 Ga0466717_014539_3303_3923 206
200 3300042604 Ga0466717_137923 Ga0466717_137923_2066_2686 206
201 3300042604 Ga0466717_192548 Ga0466717_192548_519_1139 206
202 3300042605 Ga0466716_288795 Ga0466716_288795_1271_1891 206
203 3300042606 Ga0466719_442292 Ga0466719_442292_760_1380 206
204 3300042606 Ga0466719_486350 Ga0466719_486350_1270_1890 206
205 3300042609 Ga0466722_069074 Ga0466722_069074_2012_2632 206
206 3300042609 Ga0466722_164700 Ga0466722_164700_2313_2933 206
207 3300042611 Ga0466697_000265 Ga0466697_000265_428_1048 206
208 3300042611 Ga0466697_049973 Ga0466697_049973_2287_2907 206
209 3300042611 Ga0466697_266060 Ga0466697_266060_430_1050 206
210 3300042612 Ga0466705_353643 Ga0466705_353643_34839_35459 206
211 3300042613 Ga0466710_025665 Ga0466710_025665_671_1291 206
212 3300042613 Ga0466710_245229 Ga0466710_245229_3143_3763 206
213 3300042613 Ga0466710_328608 Ga0466710_328608_23_643 206
214 3300042613 Ga0466710_362701 Ga0466710_362701_1316_1936 206
215 3300042616 Ga0466715_204503 Ga0466715_204503_25199_25819 206
216 3300042616 Ga0466715_253033 Ga0466715_253033_8064_8684 206
217 3300042616 Ga0466715_639114 Ga0466715_639114_141_761 206
218 3300042618 Ga0466723_023127 Ga0466723_023127_8851_9471 206
219 3300042619 Ga0466726_083783 Ga0466726_083783_1185_1805 206
220 3300042619 Ga0466726_188842 Ga0466726_188842_13217_13837 206
221 3300042619 Ga0466726_323683 Ga0466726_323683_70_690 206
222 3300042621 Ga0466729_260780 Ga0466729_260780_1242_1862 206
223 3300042623 Ga0466734_013590 Ga0466734_013590_2163_2783 206
224 3300042623 Ga0466734_030486 Ga0466734_030486_148_768 206
225 3300042623 Ga0466734_109601 Ga0466734_109601_1003_1623 206
226 3300042623 Ga0466734_173971 Ga0466734_173971_1299_1919 206
227 3300042624 Ga0466735_049949 Ga0466735_049949_945_1565 206
228 3300042625 Ga0466730_000281 Ga0466730_000281_1357_1977 206
229 3300042625 Ga0466730_017261 Ga0466730_017261_1036_1656 206
230 3300042636 Ga0466703_022903 Ga0466703_022903_1735_2355 206
231 3300042636 Ga0466703_162382 Ga0466703_162382_6359_6979 206
232 3300042636 Ga0466703_196402 Ga0466703_196402_6318_6938 206
233 3300042636 Ga0466703_234993 Ga0466703_234993_133_753 206
234 3300042643 Ga0466704_150483 Ga0466704_150483_2355_2975 206
235 3300042643 Ga0466704_503680 Ga0466704_503680_426_1046 206
236 3300042643 Ga0466704_551631 Ga0466704_551631_1124_1744 206
237 3300042643 Ga0466704_608928 Ga0466704_608928_10714_11334 206
238 3300042648 Ga0466709_271167 Ga0466709_271167_1482_2102 206
239 3300042648 Ga0466709_342330 Ga0466709_342330_5305_5925 206
240 3300042649 Ga0466724_23524 Ga0466724_23524_414_1034 206
241 3300042649 Ga0466724_67933 Ga0466724_67933_1422_2042 206
242 3300042652 Ga0466708_366542 Ga0466708_366542_10528_11148 206
243 3300042654 Ga0466725_015277 Ga0466725_015277_5272_5892 206
244 3300042654 Ga0466725_017039 Ga0466725_017039_2308_2928 206
245 3300042654 Ga0466725_038753 Ga0466725_038753_686_1306 206
246 3300042654 Ga0466725_092290 Ga0466725_092290_6994_7614 206
247 3300042654 Ga0466725_203690 Ga0466725_203690_362_982 206
248 3300042654 Ga0466725_319345 Ga0466725_319345_3572_4192 206
249 3300042655 Ga0466727_137609 Ga0466727_137609_2309_2929 206
250 3300042656 Ga0466732_457005 Ga0466732_457005_304_924 206
251 3300042659 Ga0466733_080847 Ga0466733_080847_13993_14613 206
252 3300042659 Ga0466733_216390 Ga0466733_216390_152_772 206
253 iso_pr_bacteria 2518285616 2518644241 206
254 iso_pr_bacteria 2571042003 2571060892 206
255 iso_pr_bacteria 2585427850 2586973686 206
256 iso_pr_bacteria 2585427851 2586975636 206
257 iso_pr_bacteria 2585428136 2588039247 206
258 iso_pr_bacteria 2597489944 2598058629 206
259 iso_pr_bacteria 2684622927 2686107979 206
260 iso_pr_bacteria 2811994808 2812044389 206
261 iso_pr_bacteria 2820042117 2820044458 206
262 iso_pr_bacteria 2820059968 2820061108 206
263 iso_pr_bacteria 2820065746 2820067895 206
264 iso_pr_bacteria 2820089333 2820091303 206
265 iso_pr_bacteria 2820121232 2820123098 206
266 iso_pr_bacteria 2820123897 2820124526 206
267 iso_pr_bacteria 2820131053 2820132534 206
268 iso_pr_bacteria 2834230000 2834230940 206
269 iso_pr_bacteria 2834412944 2834413834 206
270 iso_pr_bacteria 2834415282 2834416882 206
271 iso_pr_bacteria 2837560943 2837562725 206
272 iso_pr_bacteria 2837563510 2837563977 206
273 iso_pr_bacteria 2840743474 2840744086 206
274 iso_pr_bacteria 2840748007 2840749672 206
275 iso_pr_bacteria 2843299038 2843299356 206
276 iso_pr_bacteria 2843301220 2843301619 206
277 iso_pr_bacteria 2846359427 2846359756 206
278 iso_pr_bacteria 2846361553 2846362631 206
279 iso_pr_bacteria 2846363972 2846364605 206
280 iso_pr_bacteria 2846366200 2846366820 206
281 iso_pr_bacteria 2846368606 2846369840 206
282 iso_pr_bacteria 2846370940 2846373212 206
283 iso_pr_bacteria 2846373876 2846374569 206
284 iso_pr_bacteria 2846376288 2846378005 206
285 iso_pr_bacteria 2846379220 2846380854 206
286 iso_pr_bacteria 2848751009 2848751161 206
287 iso_pr_bacteria 2849399727 2849400702 206
288 iso_pr_bacteria 2849402121 2849402234 206
289 iso_pr_bacteria 2849404451 2849404925 206
290 iso_pr_bacteria 2849406737 2849408661 206
291 iso_pr_bacteria 2849409164 2849410122 206
292 iso_pr_bacteria 2849411303 2849411845 206
293 iso_pr_bacteria 2849413536 2849413661 206
294 iso_pr_bacteria 2849415715 2849415886 206
295 iso_pr_bacteria 2849417936 2849418456 206
296 iso_pr_bacteria 2852205774 2852207883 206
297 iso_pr_bacteria 2854084220 2854085422 206
298 iso_pr_bacteria 2854086477 2854087121 206
299 iso_pr_bacteria 2854088767 2854090613 206
300 iso_pr_bacteria 2854091108 2854093259 206
301 iso_pr_bacteria 2854093395 2854095364 206
302 iso_pr_bacteria 2854095577 2854097085 206
303 iso_pr_bacteria 2854097802 2854098884 206
304 iso_pr_bacteria 2854100132 2854102352 206
305 iso_pr_bacteria 2854102457 2854103147 206
306 iso_pr_bacteria 2854104879 2854104971 206
307 iso_pr_bacteria 2855798354 2855802072 206
308 iso_pr_bacteria 2857822956 2857823126 206
309 iso_pr_bacteria 2857825141 2857827187 206
310 iso_pr_bacteria 2857827427 2857828395 206
311 iso_pr_bacteria 2857830159 2857831461 206
312 iso_pr_bacteria 2857832487 2857833862 206
313 iso_pr_bacteria 2857835046 2857836638 206
314 iso_pr_bacteria 2857837414 2857839655 206
315 iso_pr_bacteria 2857840086 2857841406 206
316 iso_pr_bacteria 2857842411 2857842449 206
317 iso_pr_bacteria 2857845033 2857847251 206
318 iso_pr_bacteria 2864755708 2864757996 206
319 iso_pr_bacteria 2864859030 2864862102 206
320 iso_pr_bacteria 2864914039 2864917098 206
321 iso_pr_bacteria 2864937364 2864943689 206
322 iso_pr_bacteria 2864968865 2864971841 206
323 iso_pr_bacteria 2864988360 2864991039 206
324 iso_pr_bacteria 2868461634 2868463194 206
325 iso_pr_bacteria 2868464004 2868466150 206
326 iso_pr_bacteria 2873565274 2873569638 206
327 iso_pr_bacteria 2873571580 2873573552 206
328 iso_pr_bacteria 2891720358 2891723391 206
329 iso_pr_bacteria 2963630348 2963631423 206
330 iso_pr_bacteria 3003869270 3003872377 206
331 iso_pr_bacteria 3003878002 3003881412 206
332 iso_pr_bacteria 8023724303 8023727812 206
333 iso_pr_bacteria 8023747282 8023750923 206
334 iso_pr_bacteria 8023752828 8023756831 206
335 iso_pr_bacteria 8023757577 8023761086 206
336 iso_pr_bacteria 8023764196 8023769991 206
337 iso_pr_bacteria 8024001094 8024003633 206
338 iso_pr_bacteria 8024014383 8024016809 206
339 iso_pr_bacteria 8024019580 8024019894 206
340 iso_pr_bacteria 8024025509 8024025787 206
341 iso_pr_bacteria 8024031916 8024034866 206
342 iso_pr_bacteria 8024037630 8024040248 206
343 iso_pr_bacteria 8024044713 8024047250 206
344 iso_pr_bacteria 8025650824 8025653599 206
345 iso_pr_bacteria 8025658853 8025661707 206
346 iso_pr_bacteria 8025666332 8025668824 206
347 iso_pr_bacteria 8025671076 8025673634 206
348 iso_pr_bacteria 8025678175 8025680572 206
349 iso_pr_bacteria 8025685901 8025689049 206
350 iso_pr_bacteria 8025694439 8025697279 206
351 iso_pr_bacteria 8025701579 8025706264 206
352 iso_pr_bacteria 8025708040 8025710761 206
353 iso_pr_bacteria 8025716094 8025719055 206
354 iso_pr_bacteria 8025723035 8025725419 206
355 iso_pr_bacteria 8025728939 8025731751 206
356 iso_pr_bacteria 8025735396 8025736453 206
357 iso_pr_bacteria 8025740903 8025743357 206
358 iso_pr_bacteria 8025747911 8025750595 206
359 iso_pr_bacteria 8025756023 8025758707 206
360 iso_pr_bacteria 8069748016 8069749383 206
361 iso_pr_bacteria 8069755105 8069757789 206
362 iso_pr_bacteria 8069763219 8069765673 206
363 iso_pr_bacteria 8069770227 8069773868 206
364 iso_pr_bacteria 8069775773 8069779776 206
365 iso_pr_bacteria 8078130113 8078132671 206
366 iso_pr_bacteria 8100449422 8100451578 206
367 iso_pr_bacteria 8100455565 8100458008 206
368 iso_pr_bacteria 8100461708 8100463963 206
369 iso_pr_bacteria 8101255641 8101257567 206
370 iso_pr_bacteria 8101258116 8101259968 206
371 iso_pr_bacteria 8101260589 8101262335 206
372 iso_pr_bacteria 8101263066 8101264775 206
373 iso_pr_bacteria 8101265296 8101266226 206
374 iso_pr_bacteria 8101267702 8101269314 206
375 iso_pr_bacteria 8101270055 8101271794 206
376 iso_pr_bacteria 8101272231 8101273907 206
377 iso_pr_bacteria 8101274435 8101275814 206
378 iso_pr_bacteria 8101276651 8101278030 206
379 iso_pr_bacteria 8101278866 8101280467 206
380 iso_pr_bacteria 8101951471 8101954061 206
381 iso_pr_bacteria 8101960468 8101963059 206
382 iso_pr_bacteria 8101967387 8101969973 206
383 iso_pr_bacteria 8101974301 8101976894 206
384 iso_pr_bacteria 8101981714 8101984282 206
385 iso_pr_bacteria 8101988189 8101990800 206
386 iso_pr_bacteria 8101994502 8101997347 206
387 iso_pr_bacteria 8102001125 8102003541 206
388 iso_pr_bacteria 8102007614 8102010138 206
389 iso_pr_bacteria 8102014801 8102017335 206
390 iso_pr_bacteria 8102020860 8102023760 206
391 iso_pr_bacteria 8102026984 8102029652 206
392 iso_pr_bacteria 8102033761 8102036927 206
393 iso_pr_bacteria 8102041249 8102043765 206
394 iso_pr_bacteria 8102047609 8102050392 206
395 iso_pr_bacteria 8102054868 8102057384 206
396 iso_pr_bacteria 8102060671 8102063406 206
397 iso_pr_bacteria 8102067727 8102070312 206
398 iso_pr_bacteria 8102074813 8102077442 206
399 iso_pr_bacteria 8102081745 8102084363 206
400 iso_pr_bacteria 8102087471 8102090006 206
401 iso_pr_bacteria 8102094248 8102097167 206
402 iso_pr_bacteria 8102102351 8102104904 206
403 iso_pr_bacteria 8102109360 8102111976 206
404 iso_pr_bacteria 8102117041 8102119588 206
405 iso_pr_bacteria 8102124461 8102127207 206
406 iso_pr_bacteria 8102131453 8102136623 206
407 iso_pr_bacteria 8102138357 8102140943 206
408 iso_pr_bacteria 8102145433 8102148942 206
409 iso_pr_bacteria 8102152052 8102157847 206
410 iso_pr_bacteria 8102161003 8102167497 206
411 iso_pr_bacteria 8102169119 8102170176 206
412 iso_pr_bacteria 8102174626 8102177438 206
413 iso_pr_bacteria 8102181083 8102183467 206
414 iso_pr_bacteria 8102186987 8102189946 206
415 iso_pr_bacteria 8102193924 8102196644 206
416 iso_pr_bacteria 8102201977 8102206662 206
417 iso_pr_bacteria 8102208438 8102211213 206
418 iso_pr_bacteria 8102216467 8102219307 206
419 iso_pr_bacteria 8102223607 8102226165 206
420 iso_pr_bacteria 8102230706 8102233854 206
421 iso_pr_bacteria 8102239244 8102241640 206
422 iso_pr_bacteria 8102246966 8102249458 206
423 iso_pr_bacteria 8102251710 8102254564 206
424 iso_pr_bacteria 8102264549 8102267199 206
425 iso_pr_bacteria 8102271933 8102274684 206
426 iso_pr_bacteria 8102279326 8102281978 206
427 iso_pr_bacteria 8102286609 8102289344 206
428 iso_pr_bacteria 8102312426 8102314821 206
429 iso_pr_bacteria 8119099601 8119100594 206
430 3300000036 IMNBGM34_c001305 IMNBGM34_0013056 207
431 3300000062 IMNBL1DRAFT_c0006760 IMNBL1DRAFT_00067605 207
432 3300000460 SCG598O02_12456 SCG598O02_1245625 207
433 3300000475 SCG598J21_12823 SCG598J21_128237 207
434 3300002462 JGI24702J35022_10007115 JGI24702J35022_1000711510 207
435 3300002504 JGI24705J35276_12236155 JGI24705J35276_122361556 207
436 3300002931 CVPL010W_10032397 CVPL010W_100323973 207
437 3300002934 CVPL005W_1000710 CVPL005W_10007105 207
438 3300002938 CVPL005L_10004946 CVPL005L_100049463 207
439 3300002938 CVPL005L_10015572 CVPL005L_100155725 207
440 3300005071 Ga0068302_10044078 Ga0068302_100440783 207
441 3300005083 Ga0068305_10277852 Ga0068305_1027785227 207
442 3300005201 Ga0072941_1148988 Ga0072941_11489882 207
443 3300005201 Ga0072941_1627484 Ga0072941_16274846 207
444 3300007052 Ga0102736_1001882 Ga0102736_10018826 207
445 3300007083 Ga0103261_1007108 Ga0103261_10071082 207
446 3300007129 Ga0102734_1006226 Ga0102734_10062263 207
447 3300007129 Ga0102734_1021422 Ga0102734_10214223 207
448 3300007140 Ga0102740_1003189 Ga0102740_10031893 207
449 3300007141 Ga0102738_1000171 Ga0102738_10001713 207
450 3300007142 Ga0102737_1000288 Ga0102737_100028812 207
451 3300007188 Ga0103264_1000013 Ga0103264_100001350 207
452 3300007188 Ga0103264_1000602 Ga0103264_100060216 207
453 3300007188 Ga0103264_1001542 Ga0103264_10015424 207
454 3300007188 Ga0103264_1001938 Ga0103264_10019384 207
455 3300007188 Ga0103264_1033151 Ga0103264_10331514 207
456 3300007192 Ga0103268_1003185 Ga0103268_10031856 207
457 3300009784 Ga0123357_10000005 Ga0123357_10000005306 207
458 3300009784 Ga0123357_10005148 Ga0123357_1000514814 207
459 3300009784 Ga0123357_10040381 Ga0123357_100403813 207
460 3300009826 Ga0123355_10322209 Ga0123355_103222092 207
461 3300010049 Ga0123356_10094274 Ga0123356_100942742 207
462 3300010049 Ga0123356_10634158 Ga0123356_106341582 207
463 3300010167 Ga0123353_10036651 Ga0123353_100366515 207
464 3300010167 Ga0123353_10480011 Ga0123353_104800112 207
465 3300010882 Ga0123354_10010479 Ga0123354_1001047914 207
466 3300010882 Ga0123354_10022551 Ga0123354_1002255114 207
467 3300010882 Ga0123354_10033211 Ga0123354_100332115 207
468 3300010882 Ga0123354_10357111 Ga0123354_103571112 207
469 3300010882 Ga0123354_10524744 Ga0123354_105247442 207
470 3300012814 Ga0160453_101505 Ga0160453_1015056 207
471 3300012819 Ga0160468_103222 Ga0160468_1032222 207
472 3300012824 Ga0160469_108166 Ga0160469_1081661 207
473 3300012825 Ga0160441_108679 Ga0160441_1086792 207
474 3300012831 Ga0160459_116337 Ga0160459_1163372 207
475 3300012834 Ga0160452_100151 Ga0160452_1001514 207
476 3300012841 Ga0160444_100030 Ga0160444_10003018 207
477 3300012845 Ga0160460_110895 Ga0160460_1108952 207
478 3300012848 Ga0160443_115335 Ga0160443_1153352 207
479 3300012849 Ga0160447_106448 Ga0160447_1064484 207
480 3300012850 Ga0160434_101262 Ga0160434_1012625 207
481 3300012852 Ga0160430_118761 Ga0160430_1187612 207
482 3300042582 Ga0466657_021707 Ga0466657_021707_1295_1918 207
483 3300042582 Ga0466657_096754 Ga0466657_096754_5541_6164 207
484 3300042582 Ga0466657_118976 Ga0466657_118976_1285_1908 207
485 3300042582 Ga0466657_157400 Ga0466657_157400_2174_2797 207
486 3300042590 Ga0466690_310963 Ga0466690_310963_521_1144 207
487 3300042590 Ga0466690_317622 Ga0466690_317622_2618_3241 207
488 3300042591 Ga0466692_162230 Ga0466692_162230_1281_1904 207
489 3300042595 Ga0466695_303783 Ga0466695_303783_685_1308 207
490 3300042598 Ga0466701_000530 Ga0466701_000530_696_1319 207
491 3300042598 Ga0466701_019319 Ga0466701_019319_1347_1970 207
492 3300042598 Ga0466701_049353 Ga0466701_049353_1269_1892 207
493 3300042598 Ga0466701_063061 Ga0466701_063061_1189_1812 207
494 3300042598 Ga0466701_081790 Ga0466701_081790_1189_1812 207
495 3300042599 Ga0466706_042415 Ga0466706_042415_2640_3263 207
496 3300042599 Ga0466706_114011 Ga0466706_114011_1321_1944 207
497 3300042601 Ga0466707_222672 Ga0466707_222672_5251_5874 207
498 3300042602 Ga0466713_051830 Ga0466713_051830_2321_2944 207
499 3300042604 Ga0466717_091910 Ga0466717_091910_1306_1929 207
500 3300042606 Ga0466719_006996 Ga0466719_006996_270_893 207
501 3300042606 Ga0466719_029114 Ga0466719_029114_2275_2898 207
502 3300042606 Ga0466719_064168 Ga0466719_064168_320_943 207
503 3300042606 Ga0466719_199877 Ga0466719_199877_714_1337 207
504 3300042606 Ga0466719_412608 Ga0466719_412608_3552_4175 207
505 3300042606 Ga0466719_471696 Ga0466719_471696_602_1225 207
506 3300042606 Ga0466719_486174 Ga0466719_486174_146_769 207
507 3300042608 Ga0466721_187322 Ga0466721_187322_1336_1959 207
508 3300042611 Ga0466697_264547 Ga0466697_264547_1113_1736 207
509 3300042612 Ga0466705_129008 Ga0466705_129008_14954_15577 207
510 3300042612 Ga0466705_238427 Ga0466705_238427_4031_4654 207
511 3300042613 Ga0466710_115345 Ga0466710_115345_1303_1926 207
512 3300042613 Ga0466710_211598 Ga0466710_211598_1288_1911 207
513 3300042613 Ga0466710_223111 Ga0466710_223111_350_973 207
514 3300042613 Ga0466710_229469 Ga0466710_229469_734_1357 207
515 3300042613 Ga0466710_230397 Ga0466710_230397_3567_4190 207
516 3300042613 Ga0466710_388240 Ga0466710_388240_1293_1916 207
517 3300042615 Ga0466711_117375 Ga0466711_117375_942_1565 207
518 3300042615 Ga0466711_444412 Ga0466711_444412_1996_2619 207
519 3300042616 Ga0466715_193807 Ga0466715_193807_15358_15981 207
520 3300042616 Ga0466715_355522 Ga0466715_355522_1176_1799 207
521 3300042616 Ga0466715_639431 Ga0466715_639431_621_1244 207
522 3300042618 Ga0466723_124011 Ga0466723_124011_15855_16478 207
523 3300042619 Ga0466726_396445 Ga0466726_396445_3849_4472 207
524 3300042621 Ga0466729_109686 Ga0466729_109686_21703_22326 207
525 3300042622 Ga0466731_108024 Ga0466731_108024_1337_1960 207
526 3300042623 Ga0466734_121583 Ga0466734_121583_365_988 207
527 3300042624 Ga0466735_111007 Ga0466735_111007_995_1618 207
528 3300042625 Ga0466730_029373 Ga0466730_029373_1335_1958 207
529 3300042643 Ga0466704_084352 Ga0466704_084352_623_1246 207
530 3300042643 Ga0466704_380145 Ga0466704_380145_1150_1773 207
531 3300042643 Ga0466704_405583 Ga0466704_405583_13509_14132 207
532 3300042648 Ga0466709_103920 Ga0466709_103920_44_667 207
533 3300042649 Ga0466724_54183 Ga0466724_54183_57682_58305 207
534 3300042649 Ga0466724_62199 Ga0466724_62199_1775_2398 207
535 3300042652 Ga0466708_032942 Ga0466708_032942_35382_36005 207
536 3300042652 Ga0466708_088956 Ga0466708_088956_1238_1861 207
537 3300042652 Ga0466708_129072 Ga0466708_129072_5583_6206 207
538 3300042652 Ga0466708_131644 Ga0466708_131644_19149_19772 207
539 3300042654 Ga0466725_051815 Ga0466725_051815_663_1286 207
540 3300042654 Ga0466725_185939 Ga0466725_185939_34530_35153 207
541 3300042654 Ga0466725_272788 Ga0466725_272788_1465_2088 207
542 iso_pr_bacteria 2687453742 2689988114 207
543 iso_pr_bacteria 2687453753 2690037934 207
544 iso_pr_bacteria 2820084079 2820085453 207
545 iso_pr_bacteria 2820086750 2820088242 207
546 iso_pr_bacteria 2820152154 2820152963 207
547 iso_pr_bacteria 2820157249 2820158644 207
548 iso_pr_bacteria 2820161938 2820162775 207
549 iso_pr_bacteria 2820164216 2820165931 207
550 iso_pr_bacteria 2864808494 2864808993 207
551 iso_pr_bacteria 2864812326 2864812825 207
552 iso_pr_bacteria 2864826666 2864829863 207
553 iso_pr_bacteria 2868169047 2868172924 207
554 3300002931 CVPL010W_10001231 CVPL010W_100012312 208
555 3300002931 CVPL010W_10041023 CVPL010W_100410231 208
556 3300005201 Ga0072941_1008779 Ga0072941_10087797 208
557 3300007052 Ga0102736_1002369 Ga0102736_10023693 208
558 3300007083 Ga0103261_1002402 Ga0103261_10024022 208
559 3300007142 Ga0102737_1014167 Ga0102737_10141672 208
560 3300007188 Ga0103264_1011568 Ga0103264_10115683 208
561 3300007188 Ga0103264_1014995 Ga0103264_10149955 208
562 3300010049 Ga0123356_10005609 Ga0123356_100056094 208
563 3300010882 Ga0123354_10002575 Ga0123354_100025754 208
564 3300042591 Ga0466692_017555 Ga0466692_017555_1289_1915 208
565 3300042599 Ga0466706_005069 Ga0466706_005069_3482_4108 208
566 3300042606 Ga0466719_196546 Ga0466719_196546_721_1347 208
567 3300042614 Ga0466712_057974 Ga0466712_057974_4436_5062 208
568 3300042623 Ga0466734_015756 Ga0466734_015756_1637_2263 208
569 3300042635 Ga0466702_243468 Ga0466702_243468_936_1562 208
570 iso_pr_bacteria 2820047982 2820049909 208
571 iso_pr_bacteria 2820050117 2820052133 208
572 iso_pr_bacteria 2820077244 2820079098 208
573 3300002462 JGI24702J35022_10049565 JGI24702J35022_100495652 209
574 3300002931 CVPL010W_10000724 CVPL010W_1000072425 209
575 3300007042 Ga0103263_101601 Ga0103263_1016013 209
576 3300007067 Ga0103266_1000132 Ga0103266_10001322 209
577 3300007080 Ga0102735_1000316 Ga0102735_10003165 209
578 3300009784 Ga0123357_10005768 Ga0123357_100057684 209
579 3300010882 Ga0123354_10002414 Ga0123354_100024144 209
580 3300038395 Ga0415639_009611 Ga0415639_009611_3082_3714 210
581 3300042605 Ga0466716_100747 Ga0466716_100747_1234_1866 210
582 3300042590 Ga0466690_142458 Ga0466690_142458_13398_14033 211
583 3300042593 Ga0466691_070961 Ga0466691_070961_915_1550 211
584 3300042606 Ga0466719_196815 Ga0466719_196815_1865_2500 211
585 3300042620 Ga0466728_065377 Ga0466728_065377_12324_12959 211
586 3300042636 Ga0466703_232591 Ga0466703_232591_3744_4379 211
587 3300042615 Ga0466711_109307 Ga0466711_109307_1210_1857 215
588 3300042659 Ga0466733_032202 Ga0466733_032202_1379_2044 221
589 3300042652 Ga0466708_422908 Ga0466708_422908_26931_27617 228

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00573 Ribosomal_L4 Ribosomal protein L4/L1 family 58 225 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.69 0.78 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.