Protein Family IF10014

Metagenome Isolate
251 Members
64 Samples
233 Scaffolds
239.18 Avg Length

🧬 Representative Sequence

ID
3300042652|Ga0466708_419296|Ga0466708_419296_204_1085
Length
293 aa
Sequence
MPLGEPLHHAGLKKEGTAARAMRHIDNPGKVAHFSRTFFTGGSVWNISVPCLKEPVMSTPHNSAEKGQIAETVLMPGDPLRAKFVAETYLENPVEFNRIRGMLGYTGAYRGKPVSVMGSGMGMPSIGIYSYELFKFFDVENIIRIGSAGGYAKTLNVYDVLLVSESYSESSYALYQNGFEGHVIKASETLNSRLRDSARKLNFPLIEGRVHSSDIFYRENSGPIPYWQKVRDEQNCLAVEMESFALFHNARIAGKKAACLLTISDGMAIAQATTAEEREKRFTAMMEIALGIL

📊 Sample Types

Isolate 7.2%
Metagenome 92.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 41.0%
Unclassified 31.1%
Kalotermitidae 18.0%
Termopsidae 3.3%
Passalidae 3.3%
Rhinotermitidae 3.3%

🌳 Taxonomy

Archaea 0
Bacteria 237
Eukaryota 0
Viruses 0
Unclassified 14

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
2 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
3 2820306284 Unclassified Firmicutes Th196P1bin11 Isolate Unclassified
4 2820602899 Unclassified Firmicutes Emb289P1bin51 Isolate Unclassified
5 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
6 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
7 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
8 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
9 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
10 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
11 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
12 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
13 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
14 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
15 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
16 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
17 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
18 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
19 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
20 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
21 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
22 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
23 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
24 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
25 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
26 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
27 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
28 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
29 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
30 2820639607 Unclassified Firmicutes Cu122P5bin9 Isolate Unclassified
31 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
32 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
33 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
34 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
35 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
36 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
37 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
38 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
39 2718218155 Flavobacteriaceae bacterium UJ101 Isolate
40 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
41 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
42 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
43 2820298281 Unclassified Firmicutes Th196P1bin9 Isolate Unclassified
44 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
45 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
46 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
47 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
48 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
49 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
50 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
51 2820590132 Unclassified Firmicutes Emb289P1bin84 Isolate Unclassified
52 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
53 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
54 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
55 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
56 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
57 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
58 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
59 2820504582 Unclassified Firmicutes Lab288P1bin5 Isolate Unclassified
60 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
61 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
62 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
63 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
64 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466720_035542 3300042607 Bacteria 4167
2 Ga0466657_133792 3300042582 Bacteria 1081
3 Ga0466690_355143 3300042590 Bacteria 4044
4 Ga0466694_131718 3300042594 Bacteria 2463
5 Ga0466694_389579 3300042594 Bacteria 1915
6 Ga0466699_003739 3300042597 Bacteria 2378
7 Ga0466699_037483 3300042597 Bacteria 31779
8 Ga0466735_106023 3300042624 Bacteria 11746
9 Ga0466703_325210 3300042636 Bacteria 2419
10 Ga0466708_459066 3300042652 Bacteria 2927
11 Ga0123357_10157688 3300009784 Bacteria 2732
12 Ga0123355_10000543 3300009826 Bacteria 50713
13 Ga0123355_10183701 3300009826 Bacteria 3098
14 Ga0123356_10001967 3300010049 Bacteria 22245
15 Ga0123356_10444364 3300010049 Bacteria 1444
16 Ga0123356_10698691 3300010049 Bacteria 1183
17 Ga0123353_10009450 3300010167 Bacteria 13468
18 Ga0123353_10067749 3300010167 Bacteria 5732
19 Ga0123353_10196853 3300010167 Bacteria 3176
20 Ga0123353_10249500 3300010167 Bacteria 2750
21 Ga0123353_10363952 3300010167 Bacteria 2172
22 Ga0123353_10370149 3300010167 Bacteria 2149
23 Ga0123353_10539599 3300010167 Bacteria 1686
24 Ga0123353_10550859 3300010167 Bacteria 1664
25 Ga0466712_030959 3300042614 Bacteria 1577
26 Ga0466712_048722 3300042614 Bacteria 18693
27 JGI24698J34947_10006109 3300002449 Bacteria 6610
28 JGI24698J34947_10037664 3300002449 Unclassified 2511
29 JGI24695J34938_10005305 3300002450 Bacteria 8086
30 JGI24695J34938_10012698 3300002450 Bacteria 4455
31 Ga0466707_041634 3300042601 Bacteria 70206
32 Ga0466714_102514 3300042603 Bacteria 3014
33 Ga0466714_128021 3300042603 Bacteria 3626
34 Ga0466714_145661 3300042603 Bacteria 1947
35 Ga0466722_089858 3300042609 Bacteria 8225
36 Ga0466722_260601 3300042609 Bacteria 2128
37 Ga0466698_206545 3300042610 Bacteria 2142
38 Ga0466698_410347 3300042610 Bacteria 1675
39 Ga0466693_155889 3300042592 Bacteria 2800
40 Ga0466693_252011 3300042592 Bacteria 1123
41 Ga0466694_115287 3300042594 Bacteria 6353
42 Ga0466694_164187 3300042594 Bacteria 1083
43 Ga0466694_227775 3300042594 Bacteria 1630
44 Ga0466695_217119 3300042595 Bacteria 1070
45 Ga0466699_140511 3300042597 Bacteria 1613
46 Ga0466699_199572 3300042597 Bacteria 34648
47 Ga0466703_203359 3300042636 Bacteria 1058
48 Ga0123355_10001433 3300009826 Bacteria 33186
49 Ga0123355_10030578 3300009826 Bacteria 8727
50 Ga0123355_10443458 3300009826 Bacteria 1642
51 Ga0123356_10357950 3300010049 Bacteria 1585
52 Ga0123356_10359709 3300010049 Bacteria 1582
53 Ga0123356_10673770 3300010049 Bacteria 1202
54 Ga0123353_10132041 3300010167 Bacteria 4006
55 Ga0123353_10873890 3300010167 Bacteria 1228
56 Ga0123353_10945807 3300010167 Bacteria 1166
57 Ga0466712_066012 3300042614 Bacteria 2315
58 Ga0466712_155540 3300042614 Bacteria 10157
59 Ga0466711_248526 3300042615 Bacteria 21611
60 Ga0466723_194192 3300042618 Bacteria 9536
61 Ga0466726_298820 3300042619 Bacteria 1301
62 IMNBL1DRAFT_c0006579 3300000062 Bacteria 6318
63 JGI24698J34947_10036624 3300002449 Bacteria 2553
64 JGI24695J34938_10008686 3300002450 Bacteria 5770
65 JGI24695J34938_10041403 3300002450 Bacteria 2068
66 JGI24699J35502_11122113 3300002509 Bacteria 3402
67 Ga0068305_10023684 3300005083 Bacteria 7826
68 Ga0466705_247045 3300042612 Bacteria 1806
69 Ga0466732_125209 3300042656 Bacteria 22857
70 Ga0466732_146338 3300042656 Bacteria 27148
71 Ga0466714_030263 3300042603 Bacteria 1665
72 Ga0466716_280333 3300042605 Unclassified 1443
73 Ga0466720_060904 3300042607 Bacteria 13154
74 Ga0466720_066447 3300042607 Bacteria 12747
75 Ga0466720_109732 3300042607 Bacteria 9099
76 Ga0466720_165845 3300042607 Bacteria 11928
77 Ga0466699_425873 3300042597 Bacteria 2711
78 Ga0466708_160705 3300042652 Bacteria 3673
79 Ga0466708_371410 3300042652 Bacteria 4295
80 Ga0466708_419296 3300042652 Bacteria 1449
81 Ga0123355_10324168 3300009826 Bacteria 2071
82 Ga0123356_10008916 3300010049 Bacteria 9928
83 Ga0123353_10013868 3300010167 Bacteria 11576
84 Ga0123353_10309998 3300010167 Unclassified 2403
85 Ga0123353_11102385 3300010167 Bacteria 1054
86 Ga0123354_10126136 3300010882 Bacteria 3268
87 Ga0123354_10294570 3300010882 Bacteria 1548
88 Ga0466712_186952 3300042614 Bacteria 20411
89 Ga0466712_191768 3300042614 Bacteria 3088
90 Ga0466726_270667 3300042619 Bacteria 9247
91 Ga0466728_144424 3300042620 Bacteria 2449
92 IMNBL1DRAFT_c0007368 3300000062 Bacteria 5807
93 JGI24698J34947_10042953 3300002449 Bacteria 2319
94 JGI24695J34938_10000068 3300002450 Bacteria 86379
95 JGI24695J34938_10011650 3300002450 Bacteria 4724
96 JGI24695J34938_10016936 3300002450 Bacteria 3690
97 Ga0072941_1005900 3300005201 Bacteria 1795
98 Ga0072941_1032367 3300005201 Bacteria 11566
99 Ga0466705_235709 3300042612 Bacteria 10181
100 Ga0466716_300475 3300042605 Bacteria 4651
101 Ga0466720_103332 3300042607 Bacteria 19536
102 Ga0466720_162399 3300042607 Bacteria 19296
103 Ga0415639_103312 3300038395 Bacteria 1497
104 Ga0466694_344317 3300042594 Bacteria 2663
105 Ga0466731_049404 3300042622 Bacteria 1073
106 Ga0466709_043613 3300042648 Bacteria 36261
107 Ga0123355_10035852 3300009826 Bacteria 8064
108 Ga0123356_10060415 3300010049 Bacteria 3537
109 Ga0123356_10982168 3300010049 Bacteria 1015
110 Ga0123356_11065012 3300010049 Bacteria 978
111 Ga0123353_10028986 3300010167 Bacteria 8521
112 Ga0123353_10108017 3300010167 Bacteria 4484
113 Ga0123353_10175231 3300010167 Bacteria 3401
114 Ga0123353_10186217 3300010167 Bacteria 3282
115 Ga0123353_10350002 3300010167 Bacteria 2227
116 Ga0123353_10391258 3300010167 Unclassified 2074
117 Ga0123353_10556789 3300010167 Bacteria 1652
118 Ga0123353_11030453 3300010167 Bacteria 1102
119 Ga0123354_10390866 3300010882 Bacteria 1189
120 Ga0466712_089760 3300042614 Bacteria 1520
121 Ga0466712_093947 3300042614 Bacteria 3120
122 Ga0466711_439302 3300042615 Bacteria 3161
123 2227470354 2225789004 Unclassified 930
124 IMNBL1DRAFT_c0000574 3300000062 Unclassified 29635
125 JGI24698J34947_10028638 3300002449 Bacteria 2949
126 JGI24698J34947_10035208 3300002449 Bacteria 2616
127 JGI24698J34947_10052401 3300002449 Bacteria 2047
128 JGI24698J34947_10056737 3300002449 Bacteria 1946
129 JGI24700J35501_10930568 3300002508 Bacteria 15843
130 Ga0072941_1027745 3300005201 Bacteria 14028
131 Ga0072941_1055231 3300005201 Bacteria 6030
132 Ga0072941_1056014 3300005201 Unclassified 3078
133 Ga0466705_277753 3300042612 Bacteria 5449
134 Ga0466720_075845 3300042607 Unclassified 11150
135 Ga0466720_214336 3300042607 Bacteria 1982
136 Ga0466698_233900 3300042610 Bacteria 1368
137 Ga0466698_312478 3300042610 Unclassified 2333
138 Ga0466699_171355 3300042597 Bacteria 6109
139 Ga0466699_290660 3300042597 Bacteria 1294
140 Ga0466699_318857 3300042597 Bacteria 1554
141 Ga0466699_418297 3300042597 Bacteria 1065
142 Ga0123355_10026346 3300009826 Bacteria 9378
143 Ga0123355_10070045 3300009826 Bacteria 5635
144 Ga0123355_10320892 3300009826 Bacteria 2087
145 Ga0123356_10000842 3300010049 Bacteria 34101
146 Ga0123356_10327903 3300010049 Bacteria 1646
147 Ga0123356_10793103 3300010049 Bacteria 1118
148 Ga0123353_10005001 3300010167 Bacteria 17266
149 Ga0123353_10552517 3300010167 Bacteria 1660
150 Ga0466712_266055 3300042614 Bacteria 3535
151 Ga0466712_315350 3300042614 Bacteria 11372
152 JGI24698J34947_10019101 3300002449 Bacteria 3701
153 JGI24698J34947_10019362 3300002449 Bacteria 3671
154 JGI24698J34947_10020567 3300002449 Bacteria 3553
155 JGI24698J34947_10027216 3300002449 Bacteria 3035
156 JGI24695J34938_10001788 3300002450 Bacteria 17683
157 Ga0466732_191985 3300042656 Bacteria 1649
158 Ga0466700_474991 3300042600 Bacteria 2063
159 Ga0466719_445652 3300042606 Bacteria 1150
160 Ga0466720_060762 3300042607 Bacteria 1715
161 Ga0466720_067705 3300042607 Bacteria 18756
162 Ga0466720_130937 3300042607 Bacteria 3328
163 Ga0415639_024068 3300038395 Bacteria 1799
164 Ga0466694_133468 3300042594 Bacteria 3366
165 Ga0466699_020170 3300042597 Bacteria 1418
166 Ga0466699_048407 3300042597 Bacteria 2034
167 Ga0466699_240665 3300042597 Bacteria 2421
168 Ga0466729_240186 3300042621 Bacteria 1371
169 Ga0466702_270820 3300042635 Bacteria 1092
170 Ga0466708_037590 3300042652 Bacteria 4885
171 Ga0466708_224922 3300042652 Bacteria 7595
172 Ga0123355_10007516 3300009826 Bacteria 16347
173 Ga0123355_10253071 3300009826 Bacteria 2476
174 Ga0123356_10075617 3300010049 Bacteria 3173
175 Ga0123356_10287333 3300010049 Bacteria 1743
176 Ga0123353_10411191 3300010167 Bacteria 2009
177 Ga0123353_10662140 3300010167 Unclassified 1475
178 Ga0466712_122508 3300042614 Unclassified 1809
179 Ga0466712_302711 3300042614 Bacteria 3556
180 Ga0466711_327348 3300042615 Bacteria 8940
181 Ga0466718_031449 3300042617 Bacteria 1282
182 2227485201 2225789004 Bacteria 4275
183 IMNBL1DRAFT_c0000638 3300000062 Bacteria 28044
184 JGI24698J34947_10009343 3300002449 Unclassified 5382
185 Ga0072941_1015770 3300005201 Bacteria 12849
186 Ga0466732_076133 3300042656 Bacteria 15677
187 Ga0466722_052832 3300042609 Bacteria 18992
188 Ga0264413_121524 3300024493 Bacteria 2531
189 Ga0415639_000642 3300038395 Bacteria 11125
190 Ga0466696_381362 3300042596 Bacteria 1437
191 Ga0466699_001104 3300042597 Bacteria 7447
192 Ga0466709_201939 3300042648 Bacteria 14293
193 Ga0123355_10216895 3300009826 Bacteria 2760
194 Ga0123355_10629181 3300009826 Bacteria 1261
195 Ga0123353_10023258 3300010167 Bacteria 9377
196 Ga0123353_10231051 3300010167 Bacteria 2884
197 Ga0123353_10508771 3300010167 Bacteria 1752
198 Ga0123353_10642367 3300010167 Bacteria 1504
199 Ga0123353_10714012 3300010167 Bacteria 1404
200 Ga0123354_10078711 3300010882 Bacteria 4684
201 Ga0123354_10325518 3300010882 Bacteria 1410
202 Ga0466712_284061 3300042614 Bacteria 2719
203 IMNBL1DRAFT_c0098983 3300000062 Bacteria 787
204 JGI24698J34947_10010967 3300002449 Bacteria 4973
205 JGI24695J34938_10005105 3300002450 Bacteria 8328
206 JGI24695J34938_10086060 3300002450 Bacteria 1294
207 Ga0072941_1048470 3300005201 Bacteria 5384
208 Ga0466700_127223 3300042600 Bacteria 1160
209 Ga0466714_097568 3300042603 Bacteria 1783
210 Ga0466722_193454 3300042609 Bacteria 6359
211 Ga0466698_380499 3300042610 Bacteria 1244
212 Ga0264413_103647 3300024493 Bacteria 10362
213 Ga0466699_069291 3300042597 Bacteria 2826
214 Ga0466699_376808 3300042597 Bacteria 2075
215 Ga0466699_397321 3300042597 Bacteria 2351
216 Ga0123355_10082383 3300009826 Bacteria 5132
217 Ga0123355_10251478 3300009826 Bacteria 2487
218 Ga0123356_10088249 3300010049 Bacteria 2948
219 Ga0123353_10003140 3300010167 Bacteria 20742
220 Ga0123353_10085927 3300010167 Bacteria 5066
221 Ga0123353_10186441 3300010167 Bacteria 3280
222 Ga0123353_10346013 3300010167 Bacteria 2243
223 Ga0123353_10549204 3300010167 Unclassified 1667
224 Ga0466712_152922 3300042614 Bacteria 2146
225 Ga0466728_186851 3300042620 Bacteria 5172
226 AustNasuHG_c1003589 3300000089 Bacteria 5603
227 AustNasuHG_c1004919 3300000089 Bacteria 4783
228 JGI24698J34947_10019975 3300002449 Unclassified 3610
229 JGI24698J34947_10064587 3300002449 Bacteria 1788
230 JGI24698J34947_10088349 3300002449 Bacteria 1430
231 JGI24700J35501_10929654 3300002508 Bacteria 9745
232 Ga0072941_1001886 3300005201 Bacteria 139305
233 Ga0072941_1056015 3300005201 Bacteria 3264

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042606 Ga0466719_445652 Ga0466719_445652_24_611 195
2 3300042615 Ga0466711_327348 Ga0466711_327348_4784_5425 213
3 3300010167 Ga0123353_10642367 Ga0123353_106423673 234
4 3300042614 Ga0466712_191768 Ga0466712_191768_1173_1880 235
5 iso_pr_bacteria 2781125640 2781288586 235
6 3300000062 IMNBL1DRAFT_c0007368 IMNBL1DRAFT_00073683 236
7 3300002450 JGI24695J34938_10012698 JGI24695J34938_100126984 236
8 3300005083 Ga0068305_10023684 Ga0068305_100236849 236
9 3300024493 Ga0264413_121524 Ga0264413_1215245 236
10 3300042594 Ga0466694_115287 Ga0466694_115287_378_1088 236
11 3300042594 Ga0466694_227775 Ga0466694_227775_703_1413 236
12 3300042607 Ga0466720_060762 Ga0466720_060762_115_825 236
13 3300042607 Ga0466720_060904 Ga0466720_060904_7595_8305 236
14 3300042607 Ga0466720_214336 Ga0466720_214336_770_1480 236
15 3300042610 Ga0466698_233900 Ga0466698_233900_288_998 236
16 3300042610 Ga0466698_312478 Ga0466698_312478_280_990 236
17 3300042610 Ga0466698_380499 Ga0466698_380499_339_1049 236
18 3300042610 Ga0466698_410347 Ga0466698_410347_657_1367 236
19 3300042617 Ga0466718_031449 Ga0466718_031449_517_1227 236
20 2225789004 2227470354 2227915285 237
21 3300002450 JGI24695J34938_10086060 JGI24695J34938_100860602 237
22 3300010167 Ga0123353_10196853 Ga0123353_101968532 237
23 3300038395 Ga0415639_024068 Ga0415639_024068_1062_1775 237
24 3300042590 Ga0466690_355143 Ga0466690_355143_134_847 237
25 3300042592 Ga0466693_155889 Ga0466693_155889_563_1276 237
26 3300042592 Ga0466693_252011 Ga0466693_252011_213_926 237
27 3300042594 Ga0466694_133468 Ga0466694_133468_236_949 237
28 3300042594 Ga0466694_164187 Ga0466694_164187_284_997 237
29 3300042594 Ga0466694_344317 Ga0466694_344317_771_1484 237
30 3300042594 Ga0466694_389579 Ga0466694_389579_546_1259 237
31 3300042596 Ga0466696_381362 Ga0466696_381362_328_1041 237
32 3300042597 Ga0466699_003739 Ga0466699_003739_1247_1960 237
33 3300042597 Ga0466699_020170 Ga0466699_020170_405_1118 237
34 3300042597 Ga0466699_037483 Ga0466699_037483_18157_18870 237
35 3300042597 Ga0466699_048407 Ga0466699_048407_376_1089 237
36 3300042597 Ga0466699_069291 Ga0466699_069291_16_729 237
37 3300042597 Ga0466699_140511 Ga0466699_140511_375_1088 237
38 3300042597 Ga0466699_171355 Ga0466699_171355_2117_2830 237
39 3300042597 Ga0466699_199572 Ga0466699_199572_31041_31754 237
40 3300042597 Ga0466699_240665 Ga0466699_240665_1126_1839 237
41 3300042597 Ga0466699_290660 Ga0466699_290660_317_1030 237
42 3300042597 Ga0466699_318857 Ga0466699_318857_683_1396 237
43 3300042597 Ga0466699_376808 Ga0466699_376808_348_1061 237
44 3300042597 Ga0466699_397321 Ga0466699_397321_1611_2324 237
45 3300042597 Ga0466699_418297 Ga0466699_418297_146_859 237
46 3300042600 Ga0466700_127223 Ga0466700_127223_124_837 237
47 3300042600 Ga0466700_474991 Ga0466700_474991_186_899 237
48 3300042605 Ga0466716_300475 Ga0466716_300475_3459_4172 237
49 3300042607 Ga0466720_035542 Ga0466720_035542_507_1220 237
50 3300042607 Ga0466720_066447 Ga0466720_066447_9618_10331 237
51 3300042607 Ga0466720_067705 Ga0466720_067705_235_948 237
52 3300042607 Ga0466720_075845 Ga0466720_075845_3319_4032 237
53 3300042607 Ga0466720_103332 Ga0466720_103332_15617_16330 237
54 3300042607 Ga0466720_165845 Ga0466720_165845_8475_9188 237
55 3300042609 Ga0466722_089858 Ga0466722_089858_6754_7467 237
56 3300042609 Ga0466722_193454 Ga0466722_193454_3294_4007 237
57 3300042609 Ga0466722_260601 Ga0466722_260601_270_983 237
58 3300042610 Ga0466698_206545 Ga0466698_206545_606_1319 237
59 3300042614 Ga0466712_030959 Ga0466712_030959_840_1553 237
60 3300042614 Ga0466712_048722 Ga0466712_048722_8204_8917 237
61 3300042614 Ga0466712_066012 Ga0466712_066012_400_1113 237
62 3300042614 Ga0466712_089760 Ga0466712_089760_769_1482 237
63 3300042614 Ga0466712_152922 Ga0466712_152922_1167_1880 237
64 3300042614 Ga0466712_155540 Ga0466712_155540_2168_2881 237
65 3300042614 Ga0466712_266055 Ga0466712_266055_1014_1727 237
66 3300042614 Ga0466712_284061 Ga0466712_284061_1032_1745 237
67 3300042614 Ga0466712_302711 Ga0466712_302711_1777_2490 237
68 3300042614 Ga0466712_315350 Ga0466712_315350_9586_10299 237
69 3300042615 Ga0466711_248526 Ga0466711_248526_4783_5496 237
70 3300042615 Ga0466711_439302 Ga0466711_439302_2372_3085 237
71 3300042618 Ga0466723_194192 Ga0466723_194192_1344_2057 237
72 3300042620 Ga0466728_186851 Ga0466728_186851_2464_3177 237
73 3300042621 Ga0466729_240186 Ga0466729_240186_334_1047 237
74 3300042622 Ga0466731_049404 Ga0466731_049404_62_775 237
75 3300042624 Ga0466735_106023 Ga0466735_106023_7921_8634 237
76 3300042636 Ga0466703_203359 Ga0466703_203359_122_835 237
77 3300042636 Ga0466703_325210 Ga0466703_325210_740_1453 237
78 3300042648 Ga0466709_043613 Ga0466709_043613_13472_14185 237
79 3300042648 Ga0466709_201939 Ga0466709_201939_13074_13787 237
80 3300042652 Ga0466708_037590 Ga0466708_037590_4155_4868 237
81 3300042652 Ga0466708_371410 Ga0466708_371410_966_1679 237
82 3300042652 Ga0466708_459066 Ga0466708_459066_1213_1926 237
83 3300042656 Ga0466732_125209 Ga0466732_125209_687_1400 237
84 3300042656 Ga0466732_191985 Ga0466732_191985_451_1164 237
85 iso_pr_bacteria 2718218155 2720329133 237
86 iso_pr_bacteria 2781125631 2781268427 237
87 iso_pr_bacteria 2781125658 2781326298 237
88 iso_pr_bacteria 2781125689 2781425185 237
89 iso_pr_bacteria 2820306284 2820308171 237
90 iso_pr_bacteria 2820590132 2820591759 237
91 iso_pr_bacteria 2820639607 2820641422 237
92 3300000062 IMNBL1DRAFT_c0000638 IMNBL1DRAFT_000063817 238
93 3300000062 IMNBL1DRAFT_c0006579 IMNBL1DRAFT_00065792 238
94 3300000089 AustNasuHG_c1003589 AustNasuHG_10035893 238
95 3300000089 AustNasuHG_c1004919 AustNasuHG_10049194 238
96 3300002449 JGI24698J34947_10006109 JGI24698J34947_100061093 238
97 3300002449 JGI24698J34947_10009343 JGI24698J34947_100093431 238
98 3300002449 JGI24698J34947_10010967 JGI24698J34947_100109671 238
99 3300002449 JGI24698J34947_10019101 JGI24698J34947_100191012 238
100 3300002449 JGI24698J34947_10019362 JGI24698J34947_100193622 238
101 3300002449 JGI24698J34947_10019975 JGI24698J34947_100199753 238
102 3300002449 JGI24698J34947_10020567 JGI24698J34947_100205673 238
103 3300002449 JGI24698J34947_10027216 JGI24698J34947_100272164 238
104 3300002449 JGI24698J34947_10028638 JGI24698J34947_100286382 238
105 3300002449 JGI24698J34947_10035208 JGI24698J34947_100352081 238
106 3300002449 JGI24698J34947_10036624 JGI24698J34947_100366244 238
107 3300002449 JGI24698J34947_10037664 JGI24698J34947_100376642 238
108 3300002449 JGI24698J34947_10052401 JGI24698J34947_100524012 238
109 3300002449 JGI24698J34947_10056737 JGI24698J34947_100567372 238
110 3300002449 JGI24698J34947_10064587 JGI24698J34947_100645872 238
111 3300002449 JGI24698J34947_10088349 JGI24698J34947_100883493 238
112 3300002450 JGI24695J34938_10016936 JGI24695J34938_100169361 238
113 3300002450 JGI24695J34938_10041403 JGI24695J34938_100414032 238
114 3300002508 JGI24700J35501_10930568 JGI24700J35501_109305687 238
115 3300002509 JGI24699J35502_11122113 JGI24699J35502_111221133 238
116 3300005201 Ga0072941_1001886 Ga0072941_100188692 238
117 3300005201 Ga0072941_1015770 Ga0072941_10157706 238
118 3300005201 Ga0072941_1027745 Ga0072941_10277457 238
119 3300005201 Ga0072941_1032367 Ga0072941_10323673 238
120 3300005201 Ga0072941_1055231 Ga0072941_10552317 238
121 3300005201 Ga0072941_1056014 Ga0072941_10560142 238
122 3300009784 Ga0123357_10157688 Ga0123357_101576882 238
123 3300009826 Ga0123355_10007516 Ga0123355_1000751614 238
124 3300009826 Ga0123355_10026346 Ga0123355_100263464 238
125 3300009826 Ga0123355_10035852 Ga0123355_100358527 238
126 3300009826 Ga0123355_10070045 Ga0123355_100700454 238
127 3300009826 Ga0123355_10253071 Ga0123355_102530713 238
128 3300010049 Ga0123356_10008916 Ga0123356_100089164 238
129 3300010049 Ga0123356_10088249 Ga0123356_100882492 238
130 3300010049 Ga0123356_11065012 Ga0123356_110650121 238
131 3300010167 Ga0123353_10003140 Ga0123353_100031408 238
132 3300010167 Ga0123353_10009450 Ga0123353_100094503 238
133 3300010167 Ga0123353_10023258 Ga0123353_100232583 238
134 3300010167 Ga0123353_10067749 Ga0123353_100677493 238
135 3300010167 Ga0123353_10085927 Ga0123353_100859272 238
136 3300010167 Ga0123353_10186217 Ga0123353_101862173 238
137 3300010167 Ga0123353_10186441 Ga0123353_101864412 238
138 3300010167 Ga0123353_10350002 Ga0123353_103500022 238
139 3300010167 Ga0123353_10370149 Ga0123353_103701492 238
140 3300010167 Ga0123353_10391258 Ga0123353_103912581 238
141 3300010167 Ga0123353_10411191 Ga0123353_104111912 238
142 3300010167 Ga0123353_10550859 Ga0123353_105508592 238
143 3300010167 Ga0123353_10556789 Ga0123353_105567892 238
144 3300010167 Ga0123353_10945807 Ga0123353_109458072 238
145 3300010167 Ga0123353_11030453 Ga0123353_110304532 238
146 3300010167 Ga0123353_11102385 Ga0123353_111023852 238
147 3300010882 Ga0123354_10078711 Ga0123354_100787113 238
148 3300010882 Ga0123354_10126136 Ga0123354_101261362 238
149 3300010882 Ga0123354_10294570 Ga0123354_102945702 238
150 3300010882 Ga0123354_10325518 Ga0123354_103255181 238
151 3300010882 Ga0123354_10390866 Ga0123354_103908661 238
152 3300038395 Ga0415639_000642 Ga0415639_000642_1624_2340 238
153 3300038395 Ga0415639_103312 Ga0415639_103312_458_1174 238
154 3300042597 Ga0466699_001104 Ga0466699_001104_2533_3249 238
155 3300042597 Ga0466699_425873 Ga0466699_425873_1060_1776 238
156 3300042609 Ga0466722_052832 Ga0466722_052832_12867_13583 238
157 3300042614 Ga0466712_186952 Ga0466712_186952_3521_4237 238
158 3300042635 Ga0466702_270820 Ga0466702_270820_305_1021 238
159 3300042652 Ga0466708_224922 Ga0466708_224922_4672_5388 238
160 iso_pr_bacteria 2781125633 2781273122 238
161 iso_pr_bacteria 2820602899 2820605431 238
162 iso_pr_bacteria 2820661146 2820663546 238
163 iso_pr_bacteria 2820666966 2820667599 238
164 iso_pr_bacteria 2820690275 2820692689 238
165 3300000062 IMNBL1DRAFT_c0098983 IMNBL1DRAFT_00989831 239
166 3300002450 JGI24695J34938_10000068 JGI24695J34938_100000682 239
167 3300002450 JGI24695J34938_10001788 JGI24695J34938_100017884 239
168 3300002450 JGI24695J34938_10005105 JGI24695J34938_100051055 239
169 3300002450 JGI24695J34938_10005305 JGI24695J34938_100053059 239
170 3300002450 JGI24695J34938_10008686 JGI24695J34938_100086862 239
171 3300002450 JGI24695J34938_10011650 JGI24695J34938_100116503 239
172 3300009826 Ga0123355_10000543 Ga0123355_1000054320 239
173 3300009826 Ga0123355_10030578 Ga0123355_100305784 239
174 3300010049 Ga0123356_10000842 Ga0123356_1000084221 239
175 3300010049 Ga0123356_10001967 Ga0123356_1000196717 239
176 3300010049 Ga0123356_10060415 Ga0123356_100604153 239
177 3300010049 Ga0123356_10075617 Ga0123356_100756172 239
178 3300010049 Ga0123356_10287333 Ga0123356_102873333 239
179 3300010049 Ga0123356_10673770 Ga0123356_106737702 239
180 3300010167 Ga0123353_10231051 Ga0123353_102310512 239
181 3300010167 Ga0123353_10249500 Ga0123353_102495002 239
182 3300010167 Ga0123353_10346013 Ga0123353_103460132 239
183 3300010167 Ga0123353_10508771 Ga0123353_105087712 239
184 3300010167 Ga0123353_10549204 Ga0123353_105492042 239
185 3300010167 Ga0123353_10552517 Ga0123353_105525172 239
186 3300010167 Ga0123353_10662140 Ga0123353_106621402 239
187 3300010167 Ga0123353_10873890 Ga0123353_108738902 239
188 3300042607 Ga0466720_162399 Ga0466720_162399_7153_7872 239
189 3300042612 Ga0466705_277753 Ga0466705_277753_2584_3303 239
190 3300042620 Ga0466728_144424 Ga0466728_144424_727_1446 239
191 3300042656 Ga0466732_076133 Ga0466732_076133_1708_2427 239
192 iso_pr_bacteria 2781125683 2781410435 239
193 iso_pr_bacteria 2781125696 2781441372 239
194 iso_pr_bacteria 2820298281 2820300008 239
195 iso_pr_bacteria 2820483401 2820485809 239
196 iso_pr_bacteria 2820504582 2820506211 239
197 3300002508 JGI24700J35501_10929654 JGI24700J35501_109296545 240
198 3300005201 Ga0072941_1056015 Ga0072941_10560153 240
199 3300009826 Ga0123355_10001433 Ga0123355_1000143324 240
200 3300009826 Ga0123355_10082383 Ga0123355_100823836 240
201 3300009826 Ga0123355_10183701 Ga0123355_101837013 240
202 3300009826 Ga0123355_10216895 Ga0123355_102168952 240
203 3300009826 Ga0123355_10251478 Ga0123355_102514783 240
204 3300010167 Ga0123353_10005001 Ga0123353_1000500112 240
205 3300042612 Ga0466705_235709 Ga0466705_235709_8618_9340 240
206 3300042619 Ga0466726_270667 Ga0466726_270667_8410_9132 240
207 2225789004 2227485201 2227950346 241
208 3300005201 Ga0072941_1048470 Ga0072941_10484703 241
209 3300010049 Ga0123356_10793103 Ga0123356_107931032 241
210 3300010167 Ga0123353_10028986 Ga0123353_100289866 241
211 3300010167 Ga0123353_10175231 Ga0123353_101752315 241
212 3300010167 Ga0123353_10363952 Ga0123353_103639522 241
213 3300042594 Ga0466694_131718 Ga0466694_131718_603_1328 241
214 3300000062 IMNBL1DRAFT_c0000574 IMNBL1DRAFT_000057411 242
215 3300010049 Ga0123356_10982168 Ga0123356_109821681 242
216 3300010167 Ga0123353_10013868 Ga0123353_100138687 242
217 3300010167 Ga0123353_10132041 Ga0123353_101320414 242
218 3300010167 Ga0123353_10309998 Ga0123353_103099983 242
219 3300042603 Ga0466714_030263 Ga0466714_030263_146_874 242
220 3300042603 Ga0466714_097568 Ga0466714_097568_784_1512 242
221 3300042603 Ga0466714_102514 Ga0466714_102514_137_865 242
222 3300042603 Ga0466714_128021 Ga0466714_128021_837_1565 242
223 3300042603 Ga0466714_145661 Ga0466714_145661_610_1338 242
224 3300042614 Ga0466712_122508 Ga0466712_122508_119_847 242
225 3300002449 JGI24698J34947_10042953 JGI24698J34947_100429532 243
226 3300005201 Ga0072941_1005900 Ga0072941_10059002 243
227 3300009826 Ga0123355_10324168 Ga0123355_103241681 243
228 3300009826 Ga0123355_10629181 Ga0123355_106291811 243
229 3300010167 Ga0123353_10108017 Ga0123353_101080172 243
230 3300042607 Ga0466720_109732 Ga0466720_109732_7425_8156 243
231 3300009826 Ga0123355_10443458 Ga0123355_104434582 244
232 3300010049 Ga0123356_10357950 Ga0123356_103579502 244
233 3300010049 Ga0123356_10359709 Ga0123356_103597091 247
234 3300042605 Ga0466716_280333 Ga0466716_280333_225_968 247
235 3300042652 Ga0466708_160705 Ga0466708_160705_323_1066 247
236 3300009826 Ga0123355_10320892 Ga0123355_103208921 248
237 3300042582 Ga0466657_133792 Ga0466657_133792_290_1036 248
238 3300042595 Ga0466695_217119 Ga0466695_217119_276_1022 248
239 3300010167 Ga0123353_10714012 Ga0123353_107140122 249
240 3300010167 Ga0123353_10539599 Ga0123353_105395992 250
241 3300042607 Ga0466720_130937 Ga0466720_130937_991_1746 251
242 3300010049 Ga0123356_10327903 Ga0123356_103279032 252
243 3300010049 Ga0123356_10698691 Ga0123356_106986912 252
244 3300042656 Ga0466732_146338 Ga0466732_146338_12977_13738 253
245 3300024493 Ga0264413_103647 Ga0264413_1036477 255
246 3300010049 Ga0123356_10444364 Ga0123356_104443642 257
247 3300042601 Ga0466707_041634 Ga0466707_041634_63242_64018 258
248 3300042614 Ga0466712_093947 Ga0466712_093947_380_1156 258
249 3300042619 Ga0466726_298820 Ga0466726_298820_240_1025 261
250 3300042612 Ga0466705_247045 Ga0466705_247045_895_1683 262
251 3300042652 Ga0466708_419296 Ga0466708_419296_204_1085 293

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01048 PNP_UDP_1 Phosphorylase superfamily 73 283 0.84

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.