Protein Family IF10011
Metagenome
Isolate
256
Members
77
Samples
238
Scaffolds
327.92
Avg Length
Representative Sequence
- ID
- 3300042652|Ga0466708_410713|Ga0466708_410713_2760_3857
- Length
- 365 aa
- Sequence
- VEIKSHLQAFNSLPLMRPKESVRPITIKHKPFSGEGMEKNWKDLKKPQKVEIEEINHSKNFGKFVCEPLERGFGLTLGNALRRVMLSSLQGASIVSVKIDDVLHELSAINDINEDVSDIILNLKEVRLKLHGPGPRTIRVEAVGPKIVTAADIITDHMVEVLNKDCYLAHLSEKGRLNMTMEVALGKGYVPAEKPMEEQVIGSIPVDALFSPIRKVNFVVTNARVGQKTDYDKLTLDVWTDGSITPQDAVASAAAILQDQLTIFTDFDESNADSSSLDDLRANGNNENFNRSVDELELSVRSANCLKNADIYYIGELVQKTENEMLKTKNFGRKSLNEIKEVLTGFGLSLGMKVDGFVRPELRKD
Sample Types
Isolate
5.9%
Metagenome
94.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.2%
Unclassified
18.9%
Kalotermitidae
18.9%
Tenebrionidae
5.4%
Termopsidae
4.1%
Rhinotermitidae
2.7%
Passalidae
2.7%
Elmidae
1.4%
Apidae
1.4%
Hodotermitidae
1.4%
Taxonomy
Archaea
0
Bacteria
234
Eukaryota
0
Viruses
0
Unclassified
22
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 2 | 2864985977 | Staphylococcus hominis S00278 | Isolate | Elmidae |
| 3 | 2851410423 | Lactobacillus helsingborgensis ESL0183 | Isolate | Apidae |
| 4 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 5 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 6 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 7 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 8 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 9 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 10 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 13 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 14 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 15 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 16 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 17 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 18 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 19 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 20 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 21 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 22 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 23 | 2820106212 | Unclassified Proteobacteria Emb289P4bin44 | Isolate | Unclassified |
| 24 | 2645727721 | Lactobacillus helsingborgensis Bma5 | Isolate | Unclassified |
| 25 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 26 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 27 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 28 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 29 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 30 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 31 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 32 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 33 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 34 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 35 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 36 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 37 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 38 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 39 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 40 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 41 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 42 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 43 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 44 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 45 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 46 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 47 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 48 | 8012942269 | Mammaliicoccus lentus UD i2 | Isolate | Tenebrionidae |
| 49 | 2758568796 | Unclassified Deltaproteobacteria Th196P3_bin21 | Isolate | Unclassified |
| 50 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 51 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 52 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 53 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 54 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 55 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 56 | 2820947865 | Unclassified Acidobacteria Nt197P3bin133 | Isolate | Unclassified |
| 57 | 2740892557 | Staphylococcus sp. JDR108L-110-1 | Isolate | Unclassified |
| 58 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 59 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 60 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 61 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 62 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 63 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 64 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 65 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 66 | 2684622914 | Lactobacillus helsinborgensis Lb_183 | Isolate | Unclassified |
| 67 | 2758568512 | Lactobacillus helsingborgensis ESL0262 | Isolate | Unclassified |
| 68 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 69 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 70 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 71 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 72 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 73 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 74 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 75 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 76 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 77 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_145350 | 3300042659 | Bacteria | 4766 |
| 2 | Ga0562379_0011 | 3300056790 | Bacteria | 1623141 |
| 3 | JGI24698J34947_10001360 | 3300002449 | Bacteria | 12855 |
| 4 | Ga0072941_1014078 | 3300005201 | Bacteria | 3309 |
| 5 | Ga0072941_1019328 | 3300005201 | Bacteria | 7771 |
| 6 | Ga0466705_440140 | 3300042612 | Bacteria | 2704 |
| 7 | Ga0466710_255355 | 3300042613 | Bacteria | 2408 |
| 8 | Ga0466715_443492 | 3300042616 | Bacteria | 1347 |
| 9 | Ga0466703_382073 | 3300042636 | Bacteria | 3532 |
| 10 | Ga0466704_055691 | 3300042643 | Bacteria | 39736 |
| 11 | Ga0466709_051474 | 3300042648 | Bacteria | 17283 |
| 12 | Ga0466709_080305 | 3300042648 | Bacteria | 46838 |
| 13 | Ga0466709_130369 | 3300042648 | Bacteria | 9653 |
| 14 | Ga0466708_154343 | 3300042652 | Bacteria | 2378 |
| 15 | Ga0466691_209260 | 3300042593 | Bacteria | 5285 |
| 16 | Ga0466706_015682 | 3300042599 | Unclassified | 2164 |
| 17 | Ga0466706_186042 | 3300042599 | Bacteria | 6626 |
| 18 | Ga0466714_053981 | 3300042603 | Bacteria | 7171 |
| 19 | Ga0466698_135130 | 3300042610 | Bacteria | 1667 |
| 20 | Ga0123353_10043087 | 3300010167 | Bacteria | 7147 |
| 21 | Ga0123354_10008853 | 3300010882 | Bacteria | 15351 |
| 22 | Ga0466705_317371 | 3300042612 | Bacteria | 146251 |
| 23 | Ga0466727_349039 | 3300042655 | Bacteria | 1561 |
| 24 | Ga0466733_090216 | 3300042659 | Bacteria | 6126 |
| 25 | Ga0466733_155816 | 3300042659 | Bacteria | 13838 |
| 26 | Ga0466733_185620 | 3300042659 | Bacteria | 2897 |
| 27 | Ga0562377_2566 | 3300056842 | Unclassified | 13073 |
| 28 | 2227496302 | 2225789004 | Bacteria | 3925 |
| 29 | IMNBL1DRAFT_c0003713 | 3300000062 | Bacteria | 9584 |
| 30 | JGI24698J34947_10087281 | 3300002449 | Unclassified | 1443 |
| 31 | JGI24695J34938_10009272 | 3300002450 | Bacteria | 5486 |
| 32 | Ga0466723_003057 | 3300042618 | Bacteria | 15038 |
| 33 | Ga0466723_038419 | 3300042618 | Bacteria | 31685 |
| 34 | Ga0466723_094930 | 3300042618 | Bacteria | 2380 |
| 35 | Ga0466728_155386 | 3300042620 | Bacteria | 2423 |
| 36 | Ga0466728_240671 | 3300042620 | Bacteria | 17710 |
| 37 | Ga0466657_286672 | 3300042582 | Bacteria | 5985 |
| 38 | Ga0466693_210573 | 3300042592 | Bacteria | 3118 |
| 39 | Ga0466694_352081 | 3300042594 | Unclassified | 3342 |
| 40 | Ga0466694_399463 | 3300042594 | Bacteria | 4021 |
| 41 | Ga0466706_107295 | 3300042599 | Bacteria | 2227 |
| 42 | Ga0466714_026670 | 3300042603 | Unclassified | 15441 |
| 43 | Ga0466714_063295 | 3300042603 | Bacteria | 11290 |
| 44 | Ga0466717_230080 | 3300042604 | Bacteria | 1157 |
| 45 | Ga0466716_075598 | 3300042605 | Bacteria | 6015 |
| 46 | Ga0466720_020310 | 3300042607 | Bacteria | 2437 |
| 47 | Ga0123357_10181051 | 3300009784 | Bacteria | 2461 |
| 48 | Ga0123356_10265568 | 3300010049 | Bacteria | 1803 |
| 49 | Ga0123353_10444851 | 3300010167 | Bacteria | 1910 |
| 50 | Ga0466732_131782 | 3300042656 | Bacteria | 3203 |
| 51 | Ga0466733_064239 | 3300042659 | Unclassified | 16085 |
| 52 | Ga0466733_090854 | 3300042659 | Bacteria | 14327 |
| 53 | Ga0466733_158679 | 3300042659 | Bacteria | 2988 |
| 54 | Ga0466733_164022 | 3300042659 | Bacteria | 12429 |
| 55 | Ga0466733_170000 | 3300042659 | Bacteria | 1771 |
| 56 | Ga0562379_1470 | 3300056790 | Bacteria | 26720 |
| 57 | Ga0562374_0010 | 3300057007 | Bacteria | 1930599 |
| 58 | JGI24695J34938_10037129 | 3300002450 | Bacteria | 2216 |
| 59 | Ga0072940_1007047 | 3300005200 | Unclassified | 8578 |
| 60 | Ga0466715_069772 | 3300042616 | Bacteria | 32177 |
| 61 | Ga0466715_257161 | 3300042616 | Bacteria | 85931 |
| 62 | Ga0466718_030844 | 3300042617 | Bacteria | 2871 |
| 63 | Ga0466718_042697 | 3300042617 | Bacteria | 2009 |
| 64 | Ga0466723_192342 | 3300042618 | Bacteria | 20312 |
| 65 | Ga0466731_013508 | 3300042622 | Bacteria | 24867 |
| 66 | Ga0466734_041833 | 3300042623 | Unclassified | 6872 |
| 67 | Ga0466735_015321 | 3300042624 | Bacteria | 42913 |
| 68 | Ga0466730_032775 | 3300042625 | Bacteria | 2311 |
| 69 | Ga0466703_311388 | 3300042636 | Bacteria | 3401 |
| 70 | Ga0466708_422180 | 3300042652 | Bacteria | 2003 |
| 71 | Ga0265387_1009583 | 3300024582 | Bacteria | 1311 |
| 72 | Ga0466694_207837 | 3300042594 | Bacteria | 4708 |
| 73 | Ga0466695_170946 | 3300042595 | Bacteria | 1445 |
| 74 | Ga0466696_352689 | 3300042596 | Bacteria | 3385 |
| 75 | Ga0466701_029719 | 3300042598 | Bacteria | 3192 |
| 76 | Ga0466706_014133 | 3300042599 | Bacteria | 19194 |
| 77 | Ga0466707_211091 | 3300042601 | Bacteria | 1912 |
| 78 | Ga0466714_028278 | 3300042603 | Bacteria | 3118 |
| 79 | Ga0466722_088834 | 3300042609 | Bacteria | 20099 |
| 80 | Ga0123357_10378749 | 3300009784 | Bacteria | 1316 |
| 81 | Ga0123353_10000836 | 3300010167 | Bacteria | 37407 |
| 82 | Ga0123353_10199944 | 3300010167 | Unclassified | 3145 |
| 83 | Ga0123353_10881822 | 3300010167 | Bacteria | 1221 |
| 84 | Ga0123354_10414063 | 3300010882 | Unclassified | 1127 |
| 85 | Ga0466705_142505 | 3300042612 | Bacteria | 15973 |
| 86 | Ga0466733_031543 | 3300042659 | Bacteria | 31583 |
| 87 | Ga0562379_0003 | 3300056790 | Bacteria | 3011780 |
| 88 | Ga0562379_2278 | 3300056790 | Bacteria | 16502 |
| 89 | JGI24698J34947_10007438 | 3300002449 | Bacteria | 6020 |
| 90 | JGI24698J34947_10099374 | 3300002449 | Unclassified | 1312 |
| 91 | JGI24702J35022_10030507 | 3300002462 | Bacteria | 2893 |
| 92 | JGI24705J35276_12235012 | 3300002504 | Bacteria | 6076 |
| 93 | Ga0072941_1250355 | 3300005201 | Unclassified | 2719 |
| 94 | Ga0466705_392104 | 3300042612 | Bacteria | 17200 |
| 95 | Ga0466705_440682 | 3300042612 | Bacteria | 34147 |
| 96 | Ga0466712_137270 | 3300042614 | Bacteria | 3665 |
| 97 | Ga0466711_464018 | 3300042615 | Bacteria | 4172 |
| 98 | Ga0466715_303400 | 3300042616 | Bacteria | 7260 |
| 99 | Ga0466715_517808 | 3300042616 | Bacteria | 2514 |
| 100 | Ga0466718_003809 | 3300042617 | Bacteria | 2506 |
| 101 | Ga0466734_052812 | 3300042623 | Bacteria | 3338 |
| 102 | Ga0466704_078415 | 3300042643 | Bacteria | 3183 |
| 103 | Ga0415639_169526 | 3300038395 | Bacteria | 2351 |
| 104 | Ga0466690_418235 | 3300042590 | Bacteria | 2641 |
| 105 | Ga0466691_191273 | 3300042593 | Bacteria | 20272 |
| 106 | Ga0466694_001419 | 3300042594 | Bacteria | 1499 |
| 107 | Ga0466694_088671 | 3300042594 | Bacteria | 1525 |
| 108 | Ga0466694_397131 | 3300042594 | Unclassified | 1856 |
| 109 | Ga0466695_228876 | 3300042595 | Bacteria | 8580 |
| 110 | Ga0466699_064292 | 3300042597 | Bacteria | 4860 |
| 111 | Ga0466699_403731 | 3300042597 | Bacteria | 1813 |
| 112 | Ga0466716_241304 | 3300042605 | Bacteria | 3076 |
| 113 | Ga0466719_447640 | 3300042606 | Bacteria | 1440 |
| 114 | Ga0466719_571988 | 3300042606 | Bacteria | 28243 |
| 115 | Ga0466722_189048 | 3300042609 | Bacteria | 149153 |
| 116 | Ga0466698_098263 | 3300042610 | Bacteria | 2603 |
| 117 | Ga0123354_10112526 | 3300010882 | Bacteria | 3583 |
| 118 | Ga0466705_245982 | 3300042612 | Bacteria | 20685 |
| 119 | Ga0466733_048297 | 3300042659 | Bacteria | 2034 |
| 120 | Ga0466733_162467 | 3300042659 | Bacteria | 9311 |
| 121 | Ga0562379_0489 | 3300056790 | Bacteria | 79810 |
| 122 | JGI24705J35276_12210406 | 3300002504 | Bacteria | 1825 |
| 123 | Ga0068305_10077824 | 3300005083 | Bacteria | 15891 |
| 124 | Ga0072941_1250356 | 3300005201 | Unclassified | 2633 |
| 125 | Ga0466711_202977 | 3300042615 | Bacteria | 8125 |
| 126 | Ga0466711_328250 | 3300042615 | Bacteria | 50562 |
| 127 | Ga0466711_360808 | 3300042615 | Bacteria | 5257 |
| 128 | Ga0466715_154133 | 3300042616 | Bacteria | 37484 |
| 129 | Ga0466723_108203 | 3300042618 | Bacteria | 2195 |
| 130 | Ga0466726_444057 | 3300042619 | Bacteria | 23518 |
| 131 | Ga0466728_036996 | 3300042620 | Bacteria | 4052 |
| 132 | Ga0466728_153839 | 3300042620 | Unclassified | 2333 |
| 133 | Ga0466703_309378 | 3300042636 | Bacteria | 2252 |
| 134 | Ga0466704_397399 | 3300042643 | Unclassified | 2333 |
| 135 | Ga0466709_420077 | 3300042648 | Bacteria | 1525 |
| 136 | Ga0466708_410713 | 3300042652 | Bacteria | 5655 |
| 137 | Ga0264413_117903 | 3300024493 | Bacteria | 2639 |
| 138 | Ga0466656_151030 | 3300042550 | Bacteria | 3708 |
| 139 | Ga0466657_056447 | 3300042582 | Bacteria | 5880 |
| 140 | Ga0466692_120097 | 3300042591 | Bacteria | 76506 |
| 141 | Ga0466696_265464 | 3300042596 | Bacteria | 21014 |
| 142 | Ga0466699_202468 | 3300042597 | Bacteria | 7425 |
| 143 | Ga0466699_367241 | 3300042597 | Bacteria | 2060 |
| 144 | Ga0466700_033144 | 3300042600 | Unclassified | 3402 |
| 145 | Ga0466700_156273 | 3300042600 | Bacteria | 5877 |
| 146 | Ga0466716_004923 | 3300042605 | Bacteria | 1299 |
| 147 | Ga0466716_160908 | 3300042605 | Bacteria | 35345 |
| 148 | Ga0123357_10271347 | 3300009784 | Bacteria | 1772 |
| 149 | Ga0123356_10034926 | 3300010049 | Bacteria | 4699 |
| 150 | Ga0123353_10096273 | 3300010167 | Bacteria | 4770 |
| 151 | Ga0123353_10115938 | 3300010167 | Bacteria | 4311 |
| 152 | Ga0123353_10152904 | 3300010167 | Unclassified | 3682 |
| 153 | Ga0466705_285307 | 3300042612 | Bacteria | 25130 |
| 154 | Ga0466705_325997 | 3300042612 | Bacteria | 31796 |
| 155 | Ga0466733_109474 | 3300042659 | Bacteria | 12479 |
| 156 | JGI24698J34947_10046661 | 3300002449 | Bacteria | 2203 |
| 157 | JGI24702J35022_10007524 | 3300002462 | Bacteria | 6237 |
| 158 | Ga0068305_10005402 | 3300005083 | Bacteria | 29409 |
| 159 | Ga0466715_128043 | 3300042616 | Bacteria | 6375 |
| 160 | Ga0466718_092624 | 3300042617 | Bacteria | 1743 |
| 161 | Ga0466723_019869 | 3300042618 | Bacteria | 35706 |
| 162 | Ga0466723_078064 | 3300042618 | Bacteria | 3015 |
| 163 | Ga0466723_223639 | 3300042618 | Bacteria | 19566 |
| 164 | Ga0466726_406694 | 3300042619 | Bacteria | 19448 |
| 165 | Ga0466728_251755 | 3300042620 | Bacteria | 48527 |
| 166 | Ga0466704_072513 | 3300042643 | Bacteria | 30873 |
| 167 | Ga0466704_075131 | 3300042643 | Bacteria | 12617 |
| 168 | Ga0466704_116481 | 3300042643 | Bacteria | 45712 |
| 169 | Ga0466708_138739 | 3300042652 | Bacteria | 32324 |
| 170 | Ga0466708_201489 | 3300042652 | Bacteria | 43335 |
| 171 | Ga0264413_125592 | 3300024493 | Bacteria | 15616 |
| 172 | Ga0466691_180951 | 3300042593 | Bacteria | 1892 |
| 173 | Ga0466695_222321 | 3300042595 | Bacteria | 9388 |
| 174 | Ga0466699_090916 | 3300042597 | Bacteria | 4829 |
| 175 | Ga0466706_010117 | 3300042599 | Bacteria | 3696 |
| 176 | Ga0466707_091590 | 3300042601 | Bacteria | 17398 |
| 177 | Ga0466714_161126 | 3300042603 | Bacteria | 3430 |
| 178 | Ga0466716_475582 | 3300042605 | Bacteria | 3106 |
| 179 | Ga0466716_547446 | 3300042605 | Bacteria | 1563 |
| 180 | Ga0123356_10147706 | 3300010049 | Bacteria | 2329 |
| 181 | Ga0123356_10257884 | 3300010049 | Bacteria | 1825 |
| 182 | Ga0123353_10003138 | 3300010167 | Bacteria | 20743 |
| 183 | Ga0123353_10229405 | 3300010167 | Bacteria | 2897 |
| 184 | Ga0466705_184966 | 3300042612 | Bacteria | 36484 |
| 185 | Ga0072940_1244982 | 3300005200 | Bacteria | 1124 |
| 186 | Ga0072941_1330392 | 3300005201 | Bacteria | 2555 |
| 187 | Ga0123357_10000013 | 3300009784 | Bacteria | 161473 |
| 188 | Ga0466715_038082 | 3300042616 | Bacteria | 19718 |
| 189 | Ga0466715_040556 | 3300042616 | Bacteria | 48791 |
| 190 | Ga0466723_015433 | 3300042618 | Bacteria | 8886 |
| 191 | Ga0466723_342981 | 3300042618 | Bacteria | 8699 |
| 192 | Ga0466735_017858 | 3300042624 | Bacteria | 100811 |
| 193 | Ga0466703_233385 | 3300042636 | Bacteria | 1589 |
| 194 | Ga0466704_474633 | 3300042643 | Unclassified | 2349 |
| 195 | Ga0466709_345400 | 3300042648 | Bacteria | 6688 |
| 196 | Ga0466709_407816 | 3300042648 | Bacteria | 4660 |
| 197 | Ga0466693_014707 | 3300042592 | Bacteria | 2313 |
| 198 | Ga0466693_428269 | 3300042592 | Bacteria | 3155 |
| 199 | Ga0466691_081749 | 3300042593 | Bacteria | 15757 |
| 200 | Ga0466694_359643 | 3300042594 | Bacteria | 15714 |
| 201 | Ga0466696_137941 | 3300042596 | Bacteria | 25447 |
| 202 | Ga0466706_021848 | 3300042599 | Unclassified | 16324 |
| 203 | Ga0466707_110333 | 3300042601 | Bacteria | 1545 |
| 204 | Ga0466714_132072 | 3300042603 | Bacteria | 14433 |
| 205 | Ga0123355_10002018 | 3300009826 | Bacteria | 28705 |
| 206 | Ga0123353_10083170 | 3300010167 | Bacteria | 5150 |
| 207 | Ga0123353_10489182 | 3300010167 | Bacteria | 1797 |
| 208 | Ga0466705_354103 | 3300042612 | Bacteria | 9789 |
| 209 | Ga0466733_003819 | 3300042659 | Bacteria | 23682 |
| 210 | Ga0466733_031510 | 3300042659 | Bacteria | 9464 |
| 211 | IMNBL1DRAFT_c0032690 | 3300000062 | Bacteria | 1872 |
| 212 | JGI24695J34938_10021250 | 3300002450 | Bacteria | 3178 |
| 213 | JGI24702J35022_10015320 | 3300002462 | Bacteria | 4223 |
| 214 | JGI24702J35022_10049749 | 3300002462 | Bacteria | 2233 |
| 215 | JGI24705J35276_12118405 | 3300002504 | Unclassified | 1065 |
| 216 | JGI24705J35276_12238337 | 3300002504 | Bacteria | 19543 |
| 217 | Ga0466711_465742 | 3300042615 | Unclassified | 7580 |
| 218 | Ga0466715_041878 | 3300042616 | Bacteria | 3669 |
| 219 | Ga0466718_085948 | 3300042617 | Bacteria | 9068 |
| 220 | Ga0466723_173631 | 3300042618 | Bacteria | 36631 |
| 221 | Ga0466726_137556 | 3300042619 | Bacteria | 24871 |
| 222 | Ga0466734_158812 | 3300042623 | Bacteria | 13514 |
| 223 | Ga0466702_157150 | 3300042635 | Bacteria | 1813 |
| 224 | Ga0466704_445574 | 3300042643 | Bacteria | 1421 |
| 225 | Ga0466704_578011 | 3300042643 | Bacteria | 2362 |
| 226 | Ga0466708_014710 | 3300042652 | Bacteria | 68951 |
| 227 | Ga0466708_041708 | 3300042652 | Bacteria | 26213 |
| 228 | Ga0466708_082549 | 3300042652 | Bacteria | 53797 |
| 229 | Ga0466693_416368 | 3300042592 | Bacteria | 2217 |
| 230 | Ga0466700_187918 | 3300042600 | Bacteria | 1986 |
| 231 | Ga0466700_228296 | 3300042600 | Bacteria | 1476 |
| 232 | Ga0466707_152407 | 3300042601 | Bacteria | 36983 |
| 233 | Ga0466714_087117 | 3300042603 | Bacteria | 2241 |
| 234 | Ga0466716_451977 | 3300042605 | Bacteria | 1855 |
| 235 | Ga0466719_181946 | 3300042606 | Bacteria | 1564 |
| 236 | Ga0123356_10225758 | 3300010049 | Bacteria | 1933 |
| 237 | Ga0123353_10000175 | 3300010167 | Bacteria | 81609 |
| 238 | Ga0123353_10004661 | 3300010167 | Bacteria | 17715 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.