Protein Family IF10006

Metagenome Isolate
158 Members
55 Samples
143 Scaffolds
535.41 Avg Length

🧬 Representative Sequence

ID
3300042652|Ga0466708_394234|Ga0466708_394234_1363_3066
Length
567 aa
Sequence
MEFVRKPGFPDRSNKEPNMRLNDRELENRAQWEKAGIELPKFDRGAMIRATRAAPEWVHFGAGNIFRIFPAGLQQNLIEAGIEKTGIVMVAGRDGGILDQVFKPCDNLTLGVTLRANGEIRKRIIASIADSYWMGAAGDYGALKNIFRAPSLKMASFTITEKGYNIKDGGGEYLADAAADFAAGPGGATGPGNYMGKIAALAWERYLAGRAAGKTLPLAFVSMDNCSHNGDRLFSSVEAFALAWAERGLVEKGFVDYLRDRNAVSFPWSMIDKITPGPDRGVREMLEKDGFTDTEFYAKTTPTAPFVNAEEPQYLVVEDAFPAGRPALDRAGALFTRREIVDKVEKMKVCTCLNPLHTALAIFGCLLGYTRISDEMKNPGLVKLVEGIGYDEGLPVVVDPGIISPKKFIDEVIGVRFPNPFMPDTPQRIATDSSQKIPVRFGETIKAYLAGKARDGSGKKLSAGDLRLIPLVLAAWVRYLLGVDDRGQPFTVSPDPLYESLSSGLAGIRLGDAGPFHAALEPILSNSRIFAVNLYEAGLGEKVEALFAELAAGPGAVAAALAKYANR

📊 Sample Types

Isolate 9.5%
Metagenome 90.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 31.5%
Unclassified 27.8%
Kalotermitidae 25.9%
Termopsidae 5.6%
Rhinotermitidae 3.7%
Passalidae 3.7%
Hodotermitidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 153
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
4 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
5 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
6 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
7 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
8 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
9 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
10 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
11 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
12 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
13 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
14 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
15 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
16 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
17 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
18 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
19 2820321184 Unclassified Firmicutes Nt197P3bin86 Isolate Unclassified
20 2820590132 Unclassified Firmicutes Emb289P1bin84 Isolate Unclassified
21 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
22 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
23 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
24 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
25 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
26 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
27 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
28 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
29 2781125686 Treponema sp. Lab288P4bin22 Isolate Unclassified
30 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
31 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
32 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
33 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
34 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
35 2590828841 Oscillospiraceae bacterium Ne3 Isolate Termitidae
36 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
37 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
38 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
39 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
40 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
41 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
42 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
43 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
44 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
45 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
46 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
47 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
48 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
49 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
50 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
51 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
52 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
53 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
54 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
55 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466709_007118 3300042648 Bacteria 4461
2 Ga0466727_076650 3300042655 Bacteria 3074
3 Ga0466728_044431 3300042620 Bacteria 5463
4 Ga0466728_265382 3300042620 Bacteria 4225
5 Ga0123355_10012500 3300009826 Bacteria 13152
6 Ga0123355_10017737 3300009826 Bacteria 11257
7 Ga0123353_10046012 3300010167 Bacteria 6930
8 Ga0466692_022555 3300042591 Bacteria 7165
9 Ga0466692_177586 3300042591 Bacteria 2084
10 JGI24698J34947_10017469 3300002449 Bacteria 3887
11 JGI24698J34947_10019662 3300002449 Bacteria 3640
12 JGI24695J34938_10004453 3300002450 Bacteria 9173
13 Ga0072941_1082826 3300005201 Bacteria 3728
14 Ga0123357_10002505 3300009784 Bacteria 20550
15 Ga0466716_489728 3300042605 Bacteria 6499
16 Ga0466719_166339 3300042606 Bacteria 3261
17 Ga0466722_113985 3300042609 Bacteria 2797
18 Ga0466735_013617 3300042624 Bacteria 4842
19 Ga0466735_158088 3300042624 Bacteria 3277
20 Ga0466735_206155 3300042624 Unclassified 9266
21 Ga0466704_086877 3300042643 Bacteria 7537
22 Ga0466708_127853 3300042652 Bacteria 8794
23 Ga0466711_028178 3300042615 Bacteria 8580
24 Ga0466726_418717 3300042619 Bacteria 6675
25 Ga0466728_329053 3300042620 Bacteria 3796
26 Ga0123355_10004470 3300009826 Bacteria 20344
27 Ga0123355_10313410 3300009826 Bacteria 2123
28 Ga0123353_10136626 3300010167 Bacteria 3932
29 Ga0123353_10379229 3300010167 Bacteria 2116
30 Ga0466691_043778 3300042593 Bacteria 3022
31 Ga0466694_174349 3300042594 Bacteria 93398
32 Ga0466699_012984 3300042597 Bacteria 13934
33 Ga0466699_022579 3300042597 Bacteria 7803
34 2227619062 2225789004 Bacteria 44796
35 JGI24698J34947_10006007 3300002449 Bacteria 6663
36 JGI24698J34947_10008176 3300002449 Unclassified 5737
37 JGI24699J35502_11112013 3300002509 Bacteria 2743
38 Ga0466722_015416 3300042609 Bacteria 6021
39 Ga0466705_352828 3300042612 Unclassified 17932
40 Ga0466708_064393 3300042652 Bacteria 10010
41 Ga0466712_216357 3300042614 Bacteria 4448
42 Ga0466712_256792 3300042614 Bacteria 2681
43 Ga0466726_337141 3300042619 Bacteria 9385
44 Ga0123357_10238083 3300009784 Bacteria 1978
45 Ga0123355_10002472 3300009826 Bacteria 26156
46 Ga0466690_086567 3300042590 Bacteria 12041
47 Ga0466692_032386 3300042591 Bacteria 4232
48 Ga0466691_081186 3300042593 Bacteria 8623
49 JGI24698J34947_10019670 3300002449 Bacteria 3639
50 JGI24695J34938_10008773 3300002450 Bacteria 5725
51 JGI24702J35022_10000569 3300002462 Bacteria 22397
52 Ga0466719_023777 3300042606 Bacteria 34238
53 Ga0466722_027106 3300042609 Bacteria 24794
54 Ga0466705_105062 3300042612 Bacteria 2742
55 Ga0466703_196810 3300042636 Bacteria 23282
56 Ga0466704_316074 3300042643 Bacteria 8689
57 Ga0466708_375734 3300042652 Bacteria 1798
58 Ga0466708_394234 3300042652 Bacteria 4475
59 Ga0466712_224220 3300042614 Bacteria 2399
60 Ga0466715_092553 3300042616 Bacteria 8988
61 Ga0466718_098532 3300042617 Bacteria 1796
62 Ga0466723_050728 3300042618 Bacteria 15848
63 Ga0123353_10091039 3300010167 Bacteria 4913
64 Ga0466690_336516 3300042590 Bacteria 3187
65 Ga0466691_072487 3300042593 Bacteria 1765
66 Ga0466694_033022 3300042594 Bacteria 4521
67 JGI24698J34947_10002539 3300002449 Bacteria 9845
68 JGI24702J35022_10014899 3300002462 Bacteria 4283
69 Ga0466706_186490 3300042599 Bacteria 3566
70 Ga0466707_344354 3300042601 Bacteria 15444
71 Ga0466722_027767 3300042609 Bacteria 12522
72 Ga0466705_303983 3300042612 Bacteria 4781
73 Ga0466731_178797 3300042622 Bacteria 9919
74 Ga0466703_153313 3300042636 Bacteria 3006
75 Ga0466704_046904 3300042643 Bacteria 74594
76 Ga0466727_232510 3300042655 Bacteria 3814
77 Ga0466712_270711 3300042614 Unclassified 2173
78 Ga0466715_000572 3300042616 Bacteria 21083
79 Ga0466715_085883 3300042616 Bacteria 11517
80 Ga0466715_214768 3300042616 Bacteria 3836
81 Ga0466723_026492 3300042618 Bacteria 13737
82 Ga0466723_271554 3300042618 Bacteria 2132
83 Ga0466726_322425 3300042619 Bacteria 4017
84 Ga0123353_10299352 3300010167 Bacteria 2456
85 Ga0466692_012723 3300042591 Bacteria 2647
86 Ga0466694_182073 3300042594 Bacteria 7292
87 Ga0466696_031779 3300042596 Bacteria 2318
88 Ga0466696_328442 3300042596 Bacteria 4025
89 Ga0466699_267011 3300042597 Bacteria 5079
90 Ga0466706_249494 3300042599 Bacteria 5757
91 Ga0466700_090760 3300042600 Bacteria 2025
92 Ga0466714_116386 3300042603 Bacteria 12704
93 Ga0466719_099995 3300042606 Bacteria 30212
94 Ga0466705_358816 3300042612 Bacteria 10532
95 Ga0466708_151170 3300042652 Bacteria 4559
96 Ga0466727_286858 3300042655 Bacteria 10127
97 Ga0466712_161558 3300042614 Bacteria 10810
98 Ga0466712_221722 3300042614 Bacteria 3116
99 Ga0466712_268672 3300042614 Bacteria 7565
100 Ga0466715_293742 3300042616 Bacteria 13394
101 Ga0466723_035304 3300042618 Bacteria 10567
102 Ga0466723_203772 3300042618 Bacteria 19194
103 Ga0466723_266186 3300042618 Bacteria 9062
104 Ga0123354_10086389 3300010882 Bacteria 4384
105 Ga0466696_037623 3300042596 Bacteria 3504
106 2227535733 2225789004 Bacteria 56982
107 IMNBL1DRAFT_c0003760 3300000062 Bacteria 9494
108 Ga0072941_1029365 3300005201 Bacteria 4323
109 Ga0466700_034560 3300042600 Bacteria 2402
110 Ga0466716_272535 3300042605 Bacteria 7095
111 Ga0466719_291614 3300042606 Bacteria 4138
112 Ga0466719_495967 3300042606 Bacteria 34420
113 Ga0466719_566229 3300042606 Bacteria 7273
114 Ga0466722_013101 3300042609 Bacteria 4093
115 Ga0466705_167880 3300042612 Bacteria 18008
116 Ga0466735_225701 3300042624 Bacteria 1866
117 Ga0466703_150800 3300042636 Bacteria 19852
118 Ga0466703_239782 3300042636 Bacteria 17931
119 Ga0466705_499599 3300042612 Bacteria 15319
120 Ga0466715_032785 3300042616 Unclassified 16745
121 Ga0123355_10147990 3300009826 Bacteria 3575
122 Ga0123356_10004081 3300010049 Bacteria 15173
123 Ga0123353_10352112 3300010167 Bacteria 2218
124 Ga0466690_189235 3300042590 Bacteria 3883
125 Ga0072941_1031725 3300005201 Bacteria 5073
126 Ga0466707_229553 3300042601 Bacteria 3936
127 Ga0466716_236050 3300042605 Bacteria 14149
128 Ga0466722_041597 3300042609 Bacteria 7976
129 Ga0466722_046095 3300042609 Bacteria 6932
130 Ga0466722_214743 3300042609 Bacteria 5486
131 Ga0466722_230071 3300042609 Bacteria 9442
132 Ga0466703_073385 3300042636 Bacteria 13449
133 Ga0466708_222737 3300042652 Bacteria 3661
134 Ga0466711_207356 3300042615 Bacteria 11789
135 Ga0466715_279182 3300042616 Bacteria 2450
136 Ga0466690_268690 3300042590 Bacteria 2484
137 Ga0466692_014609 3300042591 Bacteria 5698
138 Ga0466692_116451 3300042591 Bacteria 68874
139 Ga0466699_377194 3300042597 Bacteria 8094
140 JGI24698J34947_10012550 3300002449 Bacteria 4643
141 Ga0466719_141686 3300042606 Bacteria 2060
142 Ga0466719_374227 3300042606 Bacteria 9159
143 Ga0466722_076528 3300042609 Bacteria 6857

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300009826 Ga0123355_10012500 Ga0123355_100125009 475
2 iso_pr_bacteria 2781125681 2781408232 485
3 3300042655 Ga0466727_076650 Ga0466727_076650_56_1516 486
4 3300042603 Ga0466714_116386 Ga0466714_116386_4562_6028 488
5 3300009826 Ga0123355_10017737 Ga0123355_1001773711 492
6 3300042652 Ga0466708_375734 Ga0466708_375734_281_1777 498
7 3300009826 Ga0123355_10147990 Ga0123355_101479902 504
8 3300042606 Ga0466719_141686 Ga0466719_141686_22_1542 506
9 3300042614 Ga0466712_270711 Ga0466712_270711_34_1557 507
10 3300042600 Ga0466700_090760 Ga0466700_090760_22_1548 508
11 3300042652 Ga0466708_222737 Ga0466708_222737_179_1708 509
12 3300042618 Ga0466723_271554 Ga0466723_271554_409_1947 512
13 3300009826 Ga0123355_10002472 Ga0123355_1000247217 513
14 iso_pr_bacteria 2820590132 2820590668 513
15 3300042599 Ga0466706_186490 Ga0466706_186490_1737_3284 515
16 3300042609 Ga0466722_041597 Ga0466722_041597_5610_7160 516
17 iso_pr_bacteria 2781125694 2781435256 518
18 3300042624 Ga0466735_158088 Ga0466735_158088_910_2469 519
19 3300042616 Ga0466715_000572 Ga0466715_000572_15585_17147 520
20 3300042636 Ga0466703_196810 Ga0466703_196810_12692_14293 522
21 iso_pr_bacteria 2781125648 2781305844 522
22 3300002450 JGI24695J34938_10004453 JGI24695J34938_100044533 523
23 3300002462 JGI24702J35022_10014899 JGI24702J35022_100148993 523
24 3300042612 Ga0466705_499599 Ga0466705_499599_1787_3358 523
25 3300042606 Ga0466719_566229 Ga0466719_566229_5268_6890 527
26 3300042594 Ga0466694_174349 Ga0466694_174349_30899_32485 528
27 3300042609 Ga0466722_076528 Ga0466722_076528_232_1839 528
28 2225789004 2227619062 2228196456 531
29 3300000062 IMNBL1DRAFT_c0003760 IMNBL1DRAFT_00037606 532
30 iso_pr_bacteria 650716099 650879315 532
31 3300042593 Ga0466691_072487 Ga0466691_072487_92_1693 533
32 3300042618 Ga0466723_026492 Ga0466723_026492_7801_9402 533
33 3300042652 Ga0466708_127853 Ga0466708_127853_6168_7769 533
34 3300010167 Ga0123353_10379229 Ga0123353_103792292 534
35 3300042590 Ga0466690_268690 Ga0466690_268690_13_1617 534
36 3300042606 Ga0466719_099995 Ga0466719_099995_27088_28692 534
37 3300042612 Ga0466705_167880 Ga0466705_167880_11885_13489 534
38 3300042620 Ga0466728_329053 Ga0466728_329053_1315_2919 534
39 3300042636 Ga0466703_073385 Ga0466703_073385_10275_11879 534
40 3300042636 Ga0466703_153313 Ga0466703_153313_1225_2829 534
41 3300042643 Ga0466704_316074 Ga0466704_316074_6929_8533 534
42 iso_pr_bacteria 2781125695 2781439096 534
43 iso_pr_bacteria 2820535361 2820537183 534
44 3300002449 JGI24698J34947_10008176 JGI24698J34947_100081762 535
45 3300042596 Ga0466696_328442 Ga0466696_328442_1904_3511 535
46 3300042609 Ga0466722_046095 Ga0466722_046095_3081_4688 535
47 3300042618 Ga0466723_035304 Ga0466723_035304_8588_10195 535
48 3300042620 Ga0466728_044431 Ga0466728_044431_3491_5098 535
49 3300042620 Ga0466728_265382 Ga0466728_265382_189_1796 535
50 iso_pr_bacteria 2781125633 2781273360 535
51 3300002449 JGI24698J34947_10012550 JGI24698J34947_100125503 536
52 3300002449 JGI24698J34947_10017469 JGI24698J34947_100174694 536
53 3300002450 JGI24695J34938_10008773 JGI24695J34938_100087731 536
54 3300042594 Ga0466694_033022 Ga0466694_033022_1943_3553 536
55 3300042597 Ga0466699_377194 Ga0466699_377194_2591_4201 536
56 3300042606 Ga0466719_374227 Ga0466719_374227_6463_8073 536
57 3300042612 Ga0466705_352828 Ga0466705_352828_3755_5398 536
58 3300042615 Ga0466711_207356 Ga0466711_207356_5697_7307 536
59 3300042616 Ga0466715_085883 Ga0466715_085883_5497_7107 536
60 3300042617 Ga0466718_098532 Ga0466718_098532_46_1656 536
61 3300042619 Ga0466726_322425 Ga0466726_322425_2102_3712 536
62 3300042636 Ga0466703_150800 Ga0466703_150800_17646_19256 536
63 3300042648 Ga0466709_007118 Ga0466709_007118_1006_2616 536
64 3300042652 Ga0466708_064393 Ga0466708_064393_6659_8269 536
65 iso_pr_bacteria 2781125632 2781270696 536
66 3300010049 Ga0123356_10004081 Ga0123356_100040817 537
67 3300042590 Ga0466690_189235 Ga0466690_189235_1393_3006 537
68 3300042591 Ga0466692_032386 Ga0466692_032386_645_2258 537
69 3300042593 Ga0466691_081186 Ga0466691_081186_6122_7735 537
70 3300042606 Ga0466719_291614 Ga0466719_291614_1627_3240 537
71 3300042612 Ga0466705_358816 Ga0466705_358816_1176_2789 537
72 3300042616 Ga0466715_032785 Ga0466715_032785_9210_10823 537
73 3300042616 Ga0466715_279182 Ga0466715_279182_658_2271 537
74 3300042643 Ga0466704_086877 Ga0466704_086877_702_2315 537
75 3300042655 Ga0466727_232510 Ga0466727_232510_998_2611 537
76 3300005201 Ga0072941_1031725 Ga0072941_10317255 538
77 3300009826 Ga0123355_10313410 Ga0123355_103134102 538
78 3300042590 Ga0466690_086567 Ga0466690_086567_3953_5569 538
79 3300042591 Ga0466692_177586 Ga0466692_177586_75_1691 538
80 3300042593 Ga0466691_043778 Ga0466691_043778_846_2462 538
81 3300042594 Ga0466694_182073 Ga0466694_182073_1187_2803 538
82 3300042605 Ga0466716_489728 Ga0466716_489728_3390_5006 538
83 3300042612 Ga0466705_105062 Ga0466705_105062_666_2282 538
84 3300042614 Ga0466712_268672 Ga0466712_268672_4925_6541 538
85 3300042616 Ga0466715_293742 Ga0466715_293742_9550_11166 538
86 3300042618 Ga0466723_050728 Ga0466723_050728_5237_6853 538
87 3300042636 Ga0466703_239782 Ga0466703_239782_14930_16546 538
88 3300042652 Ga0466708_151170 Ga0466708_151170_596_2212 538
89 3300010167 Ga0123353_10046012 Ga0123353_100460122 539
90 3300042597 Ga0466699_012984 Ga0466699_012984_8555_10174 539
91 3300042597 Ga0466699_022579 Ga0466699_022579_3959_5578 539
92 3300042597 Ga0466699_267011 Ga0466699_267011_3123_4742 539
93 3300042605 Ga0466716_272535 Ga0466716_272535_2072_3691 539
94 3300042609 Ga0466722_113985 Ga0466722_113985_987_2606 539
95 3300042614 Ga0466712_161558 Ga0466712_161558_7457_9076 539
96 3300042614 Ga0466712_216357 Ga0466712_216357_2266_3885 539
97 3300042614 Ga0466712_221722 Ga0466712_221722_617_2236 539
98 3300042624 Ga0466735_225701 Ga0466735_225701_216_1835 539
99 3300042655 Ga0466727_286858 Ga0466727_286858_991_2610 539
100 iso_pr_bacteria 2590828841 2593261602 539
101 iso_pr_bacteria 2781125689 2781424936 539
102 3300002449 JGI24698J34947_10019670 JGI24698J34947_100196703 540
103 3300002509 JGI24699J35502_11112013 JGI24699J35502_111120132 540
104 3300042609 Ga0466722_013101 Ga0466722_013101_1886_3532 540
105 3300042616 Ga0466715_092553 Ga0466715_092553_728_2350 540
106 3300042619 Ga0466726_337141 Ga0466726_337141_3084_4706 540
107 3300042622 Ga0466731_178797 Ga0466731_178797_8258_9880 540
108 3300005201 Ga0072941_1029365 Ga0072941_10293655 541
109 3300005201 Ga0072941_1082826 Ga0072941_10828261 541
110 3300042591 Ga0466692_012723 Ga0466692_012723_722_2347 541
111 3300042609 Ga0466722_214743 Ga0466722_214743_3726_5351 541
112 3300042619 Ga0466726_418717 Ga0466726_418717_4760_6385 541
113 3300042591 Ga0466692_014609 Ga0466692_014609_139_1767 542
114 3300042591 Ga0466692_022555 Ga0466692_022555_2107_3735 542
115 3300042596 Ga0466696_037623 Ga0466696_037623_1458_3086 542
116 3300042599 Ga0466706_249494 Ga0466706_249494_3116_4819 542
117 3300042609 Ga0466722_015416 Ga0466722_015416_4005_5633 542
118 3300042614 Ga0466712_256792 Ga0466712_256792_41_1669 542
119 3300042618 Ga0466723_266186 Ga0466723_266186_573_2201 542
120 iso_pr_bacteria 2781125655 2781318323 542
121 iso_pr_bacteria 2781125686 2781418728 542
122 3300009826 Ga0123355_10004470 Ga0123355_100044708 543
123 3300010167 Ga0123353_10091039 Ga0123353_100910395 543
124 3300042590 Ga0466690_336516 Ga0466690_336516_1123_2754 543
125 3300042606 Ga0466719_166339 Ga0466719_166339_544_2175 543
126 3300042612 Ga0466705_303983 Ga0466705_303983_780_2411 543
127 3300042618 Ga0466723_203772 Ga0466723_203772_4475_6106 543
128 3300042643 Ga0466704_046904 Ga0466704_046904_50212_51843 543
129 iso_pr_bacteria 2781125652 2781312109 543
130 3300010167 Ga0123353_10352112 Ga0123353_103521122 544
131 3300042601 Ga0466707_229553 Ga0466707_229553_304_1938 544
132 3300042605 Ga0466716_236050 Ga0466716_236050_11322_12956 544
133 3300042606 Ga0466719_023777 Ga0466719_023777_2835_4469 544
134 3300042609 Ga0466722_230071 Ga0466722_230071_2542_4176 544
135 2225789004 2227535733 2228052634 545
136 3300002449 JGI24698J34947_10019662 JGI24698J34947_100196622 545
137 3300042600 Ga0466700_034560 Ga0466700_034560_415_2052 545
138 3300002462 JGI24702J35022_10000569 JGI24702J35022_1000056916 546
139 3300042591 Ga0466692_116451 Ga0466692_116451_14166_15806 546
140 3300042614 Ga0466712_224220 Ga0466712_224220_100_1740 546
141 3300002449 JGI24698J34947_10002539 JGI24698J34947_100025393 547
142 3300042601 Ga0466707_344354 Ga0466707_344354_10669_12312 547
143 3300042616 Ga0466715_214768 Ga0466715_214768_641_2284 547
144 3300042596 Ga0466696_031779 Ga0466696_031779_364_2010 548
145 3300042624 Ga0466735_206155 Ga0466735_206155_2279_3925 548
146 iso_pr_bacteria 2820321184 2820321280 548
147 3300002449 JGI24698J34947_10006007 JGI24698J34947_100060074 549
148 3300009784 Ga0123357_10238083 Ga0123357_102380831 549
149 3300010167 Ga0123353_10299352 Ga0123353_102993522 551
150 3300042615 Ga0466711_028178 Ga0466711_028178_6595_8250 551
151 3300010167 Ga0123353_10136626 Ga0123353_101366263 552
152 3300010882 Ga0123354_10086389 Ga0123354_100863893 552
153 3300042606 Ga0466719_495967 Ga0466719_495967_29716_31374 552
154 3300042624 Ga0466735_013617 Ga0466735_013617_656_2320 554
155 3300042609 Ga0466722_027767 Ga0466722_027767_9400_11070 556
156 3300009784 Ga0123357_10002505 Ga0123357_1000250516 562
157 3300042652 Ga0466708_394234 Ga0466708_394234_1363_3066 567
158 3300042609 Ga0466722_027106 Ga0466722_027106_11421_13178 585

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01232 Mannitol_dh Mannitol dehydrogenase Rossmann domain 58 329 0.85
PF08125 Mannitol_dh_C Mannitol dehydrogenase C-terminal domain 341 503 0.83

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01232 GO:0016491 oxidoreductase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.91 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.