Protein Family IF09993

Metagenome Isolate
159 Members
85 Samples
123 Scaffolds
701.61 Avg Length

🧬 Representative Sequence

ID
3300042652|Ga0466708_358292|Ga0466708_358292_800_3529
Length
775 aa
Sequence
LSIFINHNIADKPFFFYYRCNKVTFNSQLHCLQIHPVCRANHEIFYTFANYNLLTILSINNFTMRMKTIIATGFIVALLSACTSSNKSADESDTNNPFFTEYATPFGVPPFDKIKIEHYKPAIEKGIEEQAKEIEAITASQEEPSFENTIVALDQSGKLLSKATIVFSAQNSANTNDEMEALSREISPLLTQHRDNISLNAALFARVKALYDKRDGLGLDKEQAKLLEETYKDFVRGGANLNADDQAKLRELNGRIALLQLTFGQNMLKETNAFQLIIDNEADLSGLTEAQIANAADAAKKAGLEGKWLFTLQNPSIMPFLQNSDKRELREKIFKGYIMRGNNDNEXXNKDVVKQLVTLRLEKAKLMGYADFASFVLEDRMAKNANSVYALLDEIWEPALKVTGQELADIQSEIQKEGSDFTAEGWDWRYYFEKAKKAKFDLDESQVRPYLKLENVREGAFYVANKLYGITFTPISDIPLPHPEAQAFECKDADGSHLGVLYMDFFPRAAKRGGAWCGGYRSQKYEDGKRVSPIVTIVCNFTPPAAGEPALLSLDEAETLFHEFGHGLHSLFRDVHYGGVAGVPRDFVELPSQIMEHWVLEPEVLKVYAKHYQTGEEIPADLIEKLDRSSKYGQGFATTEYLAASLLDMDYHVLQNLPANAENVNLDVVAFEAETLNKRGLPSQIPPRYRSTYFNHTMGGGYTAGYYSYIWSEVLDADAFEAFKETGDIFNPEVAARFRKYVLTPGGIDDAMDMYKNFRGKEPGTGPLLKNRGLN

📊 Sample Types

Isolate 22.6%
Metagenome 77.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 30.0%
Termitidae 23.8%
Kalotermitidae 16.2%
Unclassified 8.8%
Termopsidae 5.0%
Rhinotermitidae 3.8%
Passalidae 3.8%
Drosophilidae 3.8%
Formicidae 2.5%
Hodotermitidae 1.2%
Bombycidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 147
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
2 2923982719 Parabacteroides sp. 52 Isolate Blattidae
3 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
4 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
5 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
6 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
7 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
8 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
9 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
10 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
11 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
12 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
13 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
14 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
15 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
16 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
17 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
18 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
19 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
20 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
21 2820735654 Unclassified Bacteroidetes Th196P4bin9 Isolate Unclassified
22 3004672520 Bacteroides sp. 51 Isolate Blattidae
23 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
24 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
25 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
26 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
27 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
28 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
29 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
30 2896330536 Sphingobacterium sp. xlx-96 Isolate
31 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
32 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
33 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
34 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
35 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
36 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
37 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
38 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
39 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
40 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
41 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
42 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
43 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
44 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
45 2898741527 Sphingobacterium sp. xlx-73 Isolate
46 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
47 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
48 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
49 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
50 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
51 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
52 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
53 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
54 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
55 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
56 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
57 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
58 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
59 2896321640 Sphingobacterium sp. xlx-130 Isolate
60 2922326829 Bacteroides sp. 224 Isolate Blattidae
61 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
62 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
63 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
64 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
65 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
66 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
67 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
68 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
69 2579779088 Sphingobacterium paucimobilis HER1398 Isolate Bombycidae
70 3004677695 Bacteroides sp. 214 Isolate Blattidae
71 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
72 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
73 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
74 2896350215 Sphingobacterium sp. xlx-183 Isolate
75 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
76 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
77 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
78 2820753519 Unclassified Bacteroidetes Nc150P4bin20 Isolate Unclassified
79 3004667792 Bacteroides sp. 519 Isolate Blattidae
80 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
81 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
82 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
83 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
84 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
85 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466703_219311 3300042636 Bacteria 22299
2 Ga0466724_06797 3300042649 Bacteria 3881
3 Ga0466724_20964 3300042649 Bacteria 2331
4 Ga0123353_10243973 3300010167 Bacteria 2789
5 Ga0466656_133375 3300042550 Bacteria 2612
6 Ga0466657_018508 3300042582 Bacteria 12026
7 Ga0466694_013838 3300042594 Bacteria 12222
8 Ga0466706_115523 3300042599 Bacteria 21375
9 Ga0466705_389141 3300042612 Bacteria 9150
10 Ga0466711_081938 3300042615 Bacteria 9061
11 Ga0466711_187981 3300042615 Bacteria 27209
12 JGI24702J35022_10000817 3300002462 Bacteria 19253
13 JGI24705J35276_12220859 3300002504 Bacteria 2294
14 Ga0104019_1001441 3300007150 Unclassified 10143
15 Ga0466703_290445 3300042636 Bacteria 6148
16 Ga0466704_091020 3300042643 Unclassified 5761
17 Ga0466709_080263 3300042648 Bacteria 5033
18 Ga0466724_61421 3300042649 Bacteria 30351
19 Ga0466727_137710 3300042655 Bacteria 2153
20 Ga0123357_10009704 3300009784 Bacteria 12168
21 Ga0466656_219454 3300042550 Bacteria 5253
22 Ga0466690_095660 3300042590 Bacteria 15805
23 Ga0466691_131225 3300042593 Bacteria 21948
24 Ga0466713_008663 3300042602 Bacteria 11984
25 Ga0466714_114156 3300042603 Bacteria 41644
26 Ga0466722_044630 3300042609 Bacteria 6805
27 Ga0466711_062198 3300042615 Bacteria 2988
28 Ga0466728_061270 3300042620 Bacteria 28486
29 Ga0466728_199531 3300042620 Bacteria 9785
30 Ga0466697_190550 3300042611 Bacteria 2679
31 Ga0466703_002279 3300042636 Bacteria 5601
32 Ga0466703_016679 3300042636 Bacteria 25517
33 Ga0466704_085956 3300042643 Bacteria 11329
34 Ga0123354_10041602 3300010882 Unclassified 7100
35 Ga0160441_100093 3300012825 Bacteria 106844
36 Ga0466692_181812 3300042591 Unclassified 12498
37 Ga0466716_431029 3300042605 Bacteria 29940
38 Ga0466722_009947 3300042609 Bacteria 58351
39 Ga0466715_003081 3300042616 Bacteria 10111
40 Ga0466715_128212 3300042616 Bacteria 57577
41 Ga0466729_133839 3300042621 Bacteria 16531
42 2227316913 2225789004 Bacteria 6445
43 JGI24705J35276_12235646 3300002504 Bacteria 6779
44 Ga0068302_10113305 3300005071 Bacteria 3044
45 Ga0068305_10009014 3300005083 Bacteria 53295
46 Ga0466727_285268 3300042655 Bacteria 6151
47 Ga0123354_10021623 3300010882 Bacteria 10138
48 Ga0123354_10035187 3300010882 Bacteria 7823
49 Ga0466690_280250 3300042590 Unclassified 6293
50 Ga0466692_100322 3300042591 Bacteria 97018
51 Ga0466696_154185 3300042596 Bacteria 2752
52 Ga0466701_081495 3300042598 Bacteria 3361
53 Ga0466706_028321 3300042599 Bacteria 102705
54 Ga0466717_201543 3300042604 Unclassified 1988
55 Ga0466722_159681 3300042609 Bacteria 66135
56 Ga0466710_205217 3300042613 Bacteria 5667
57 Ga0466728_347955 3300042620 Bacteria 3962
58 Ga0102739_1000087 3300007095 Bacteria 25573
59 Ga0104019_1002922 3300007150 Bacteria 4337
60 Ga0466734_027261 3300042623 Bacteria 2938
61 Ga0466704_545505 3300042643 Bacteria 9272
62 Ga0466709_194271 3300042648 Bacteria 3172
63 Ga0123356_10042424 3300010049 Bacteria 4238
64 Ga0466690_095398 3300042590 Bacteria 8469
65 Ga0466691_077820 3300042593 Bacteria 3040
66 Ga0466713_004273 3300042602 Bacteria 35510
67 Ga0466715_593834 3300042616 Bacteria 11792
68 Ga0466723_342910 3300042618 Bacteria 13624
69 Ga0466726_446219 3300042619 Bacteria 8087
70 2227591288 2225789004 Bacteria 47425
71 JGI24705J35276_12237574 3300002504 Bacteria 11890
72 CVPL010W_10001468 3300002931 Bacteria 27586
73 Ga0466705_024311 3300042612 Unclassified 3142
74 Ga0466705_055692 3300042612 Bacteria 29184
75 Ga0466704_032616 3300042643 Bacteria 11404
76 Ga0466704_209026 3300042643 Bacteria 44176
77 Ga0466704_242291 3300042643 Bacteria 11580
78 Ga0466704_304905 3300042643 Bacteria 13787
79 Ga0466704_519464 3300042643 Bacteria 5675
80 Ga0466708_142463 3300042652 Unclassified 5541
81 Ga0466708_462040 3300042652 Bacteria 2990
82 Ga0123357_10073361 3300009784 Bacteria 4531
83 Ga0466657_358839 3300042582 Bacteria 5519
84 Ga0466691_016200 3300042593 Bacteria 5108
85 Ga0466706_126321 3300042599 Bacteria 6714
86 Ga0466700_265754 3300042600 Bacteria 3734
87 Ga0466711_008154 3300042615 Bacteria 16762
88 2227066904 2225789003 Unclassified 15156
89 IMNBL1DRAFT_c0000751 3300000062 Bacteria 25684
90 IMNBL1DRAFT_c0000880 3300000062 Bacteria 23420
91 Ga0068305_10184636 3300005083 Bacteria 2276
92 Ga0104048_1004075 3300007143 Unclassified 12931
93 Ga0466731_057282 3300042622 Bacteria 2683
94 Ga0466731_195536 3300042622 Bacteria 24605
95 Ga0466703_055385 3300042636 Bacteria 8258
96 Ga0466704_039199 3300042643 Bacteria 3111
97 Ga0466691_033271 3300042593 Unclassified 4415
98 Ga0466691_047346 3300042593 Bacteria 83606
99 Ga0466694_225731 3300042594 Bacteria 3614
100 Ga0466706_255695 3300042599 Bacteria 7338
101 Ga0466711_074861 3300042615 Unclassified 5605
102 Ga0466715_036543 3300042616 Bacteria 6279
103 Ga0104045_1001882 3300007085 Bacteria 2869
104 Ga0104045_1026904 3300007085 Bacteria 3865
105 Ga0466733_179584 3300042659 Bacteria 84251
106 Ga0466735_105432 3300042624 Bacteria 2927
107 Ga0466703_324314 3300042636 Bacteria 40209
108 Ga0466708_358292 3300042652 Bacteria 25849
109 Ga0466727_098012 3300042655 Bacteria 4984
110 Ga0123353_10050804 3300010167 Bacteria 6614
111 Ga0466690_121426 3300042590 Bacteria 23492
112 Ga0466696_151637 3300042596 Bacteria 11754
113 Ga0466696_253210 3300042596 Bacteria 201850
114 Ga0466700_463931 3300042600 Bacteria 9081
115 Ga0466716_203211 3300042605 Bacteria 16066
116 Ga0466716_325389 3300042605 Bacteria 16193
117 Ga0466715_138191 3300042616 Bacteria 23864
118 Ga0466715_225738 3300042616 Bacteria 51802
119 2227588494 2225789004 Bacteria 13117
120 IMNBL1DRAFT_c0023432 3300000062 Bacteria 2419
121 JGI24702J35022_10006354 3300002462 Bacteria 6832
122 JGI24702J35022_10029941 3300002462 Bacteria 2921
123 Ga0104045_1003543 3300007085 Bacteria 9753

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042655 Ga0466727_137710 Ga0466727_137710_20_1714 555
2 3300042604 Ga0466717_201543 Ga0466717_201543_43_1893 616
3 3300042550 Ga0466656_133375 Ga0466656_133375_502_2400 632
4 3300042598 Ga0466701_081495 Ga0466701_081495_37_1989 636
5 3300005083 Ga0068305_10184636 Ga0068305_101846361 646
6 3300042611 Ga0466697_190550 Ga0466697_190550_485_2590 659
7 3300002462 JGI24702J35022_10029941 JGI24702J35022_100299412 660
8 3300010167 Ga0123353_10243973 Ga0123353_102439732 666
9 3300042599 Ga0466706_115523 Ga0466706_115523_17906_19930 674
10 3300002931 CVPL010W_10001468 CVPL010W_1000146816 678
11 3300042593 Ga0466691_047346 Ga0466691_047346_9158_11272 678
12 3300042648 Ga0466709_194271 Ga0466709_194271_996_3137 680
13 3300042600 Ga0466700_265754 Ga0466700_265754_899_2950 683
14 3300042612 Ga0466705_055692 Ga0466705_055692_26643_28775 683
15 3300042594 Ga0466694_225731 Ga0466694_225731_1330_3444 685
16 3300005083 Ga0068305_10009014 Ga0068305_1000901437 686
17 3300042593 Ga0466691_131225 Ga0466691_131225_2010_4118 686
18 3300042616 Ga0466715_593834 Ga0466715_593834_8783_10870 686
19 2225789004 2227316913 2227765875 687
20 2225789004 2227588494 2228145277 689
21 3300042602 Ga0466713_004273 Ga0466713_004273_11018_13087 689
22 3300042648 Ga0466709_080263 Ga0466709_080263_1574_3643 689
23 3300042655 Ga0466727_098012 Ga0466727_098012_434_2536 689
24 3300042643 Ga0466704_039199 Ga0466704_039199_551_2623 690
25 3300010167 Ga0123353_10050804 Ga0123353_100508043 691
26 3300042605 Ga0466716_325389 Ga0466716_325389_3993_6113 691
27 3300042591 Ga0466692_181812 Ga0466692_181812_25_2103 692
28 3300042603 Ga0466714_114156 Ga0466714_114156_15810_17939 692
29 3300042636 Ga0466703_055385 Ga0466703_055385_5789_7909 692
30 3300042591 Ga0466692_100322 Ga0466692_100322_73506_75644 693
31 3300042593 Ga0466691_016200 Ga0466691_016200_328_2466 693
32 3300042599 Ga0466706_028321 Ga0466706_028321_94947_97049 693
33 3300042616 Ga0466715_036543 Ga0466715_036543_3429_5567 693
34 3300042593 Ga0466691_033271 Ga0466691_033271_1015_3147 694
35 3300007085 Ga0104045_1003543 Ga0104045_10035431 696
36 3300010882 Ga0123354_10041602 Ga0123354_100416025 696
37 iso_pr_bacteria 3004667792 3004668648 696
38 3300042624 Ga0466735_105432 Ga0466735_105432_655_2748 697
39 3300042636 Ga0466703_290445 Ga0466703_290445_3575_5716 697
40 3300042649 Ga0466724_61421 Ga0466724_61421_21744_23858 697
41 3300007085 Ga0104045_1001882 Ga0104045_10018822 698
42 3300042612 Ga0466705_389141 Ga0466705_389141_3575_5674 699
43 iso_pr_bacteria 2922326829 2922330551 699
44 2225789003 2227066904 2227425204 700
45 3300042582 Ga0466657_358839 Ga0466657_358839_296_2398 700
46 3300042590 Ga0466690_280250 Ga0466690_280250_3824_5956 700
47 3300042649 Ga0466724_20964 Ga0466724_20964_196_2298 700
48 3300000062 IMNBL1DRAFT_c0000880 IMNBL1DRAFT_000088011 701
49 3300042600 Ga0466700_463931 Ga0466700_463931_6553_8658 701
50 3300042623 Ga0466734_027261 Ga0466734_027261_692_2797 701
51 iso_pr_bacteria 2910949487 2910952322 701
52 iso_pr_bacteria 2922326829 2922326901 701
53 2225789004 2227591288 2228150824 702
54 3300009784 Ga0123357_10073361 Ga0123357_100733614 702
55 3300042616 Ga0466715_003081 Ga0466715_003081_6356_8464 702
56 3300042621 Ga0466729_133839 Ga0466729_133839_9810_11945 702
57 3300042652 Ga0466708_142463 Ga0466708_142463_490_2598 702
58 3300042652 Ga0466708_462040 Ga0466708_462040_63_2171 702
59 iso_pr_bacteria 2923982719 2923984763 702
60 iso_pr_bacteria 2940371297 2940372446 702
61 iso_pr_bacteria 3004667792 3004669084 702
62 iso_pr_bacteria 3004672520 3004673187 702
63 iso_pr_bacteria 3004677695 3004678240 702
64 3300000062 IMNBL1DRAFT_c0000751 IMNBL1DRAFT_000075113 703
65 3300005071 Ga0068302_10113305 Ga0068302_101133052 703
66 3300042612 Ga0466705_024311 Ga0466705_024311_354_2486 703
67 3300042613 Ga0466710_205217 Ga0466710_205217_2804_4915 703
68 3300042616 Ga0466715_225738 Ga0466715_225738_9366_11498 703
69 3300042620 Ga0466728_061270 Ga0466728_061270_19751_21883 703
70 iso_pr_bacteria 2820753519 2820754722 703
71 iso_pr_bacteria 2820755292 2820756132 703
72 iso_pr_bacteria 2940199050 2940200731 703
73 iso_pr_bacteria 2940346213 2940347765 703
74 3300000062 IMNBL1DRAFT_c0023432 IMNBL1DRAFT_00234321 704
75 3300002504 JGI24705J35276_12237574 JGI24705J35276_122375748 704
76 3300007150 Ga0104019_1001441 Ga0104019_10014414 704
77 3300042590 Ga0466690_095398 Ga0466690_095398_868_3006 704
78 3300042599 Ga0466706_126321 Ga0466706_126321_95_2209 704
79 3300042619 Ga0466726_446219 Ga0466726_446219_2543_4657 704
80 3300042636 Ga0466703_219311 Ga0466703_219311_17931_20045 704
81 iso_pr_bacteria 2579779088 2582239140 704
82 iso_pr_bacteria 2896321640 2896324114 704
83 iso_pr_bacteria 2896330536 2896332678 704
84 iso_pr_bacteria 2896350215 2896352491 704
85 iso_pr_bacteria 2898741527 2898744103 704
86 iso_pr_bacteria 2940209341 2940211271 704
87 3300042599 Ga0466706_255695 Ga0466706_255695_1801_3918 705
88 iso_pr_bacteria 2940202316 2940202617 705
89 3300010882 Ga0123354_10021623 Ga0123354_1002162311 706
90 3300010882 Ga0123354_10035187 Ga0123354_100351874 706
91 3300042590 Ga0466690_121426 Ga0466690_121426_3097_5217 706
92 3300042596 Ga0466696_154185 Ga0466696_154185_259_2379 706
93 3300042615 Ga0466711_062198 Ga0466711_062198_230_2374 706
94 3300042615 Ga0466711_074861 Ga0466711_074861_377_2518 706
95 3300042620 Ga0466728_347955 Ga0466728_347955_1626_3746 706
96 3300042655 Ga0466727_285268 Ga0466727_285268_2773_4893 706
97 3300042659 Ga0466733_179584 Ga0466733_179584_80781_82901 706
98 iso_pr_bacteria 2820792843 2820793120 706
99 iso_pr_bacteria 2820795054 2820797131 706
100 iso_pr_bacteria 2940195863 2940198909 706
101 3300002462 JGI24702J35022_10006354 JGI24702J35022_100063544 707
102 3300042593 Ga0466691_077820 Ga0466691_077820_650_2773 707
103 3300042616 Ga0466715_128212 Ga0466715_128212_24248_26371 707
104 3300042636 Ga0466703_016679 Ga0466703_016679_9757_11898 707
105 3300042643 Ga0466704_209026 Ga0466704_209026_19422_21545 707
106 3300009784 Ga0123357_10009704 Ga0123357_100097048 708
107 3300042550 Ga0466656_219454 Ga0466656_219454_2752_4878 708
108 3300042596 Ga0466696_151637 Ga0466696_151637_8307_10433 708
109 3300042649 Ga0466724_06797 Ga0466724_06797_656_2785 709
110 3300042596 Ga0466696_253210 Ga0466696_253210_84826_86958 710
111 3300042643 Ga0466704_085956 Ga0466704_085956_4243_6375 710
112 3300042643 Ga0466704_091020 Ga0466704_091020_1810_3942 710
113 3300042643 Ga0466704_242291 Ga0466704_242291_7288_9420 710
114 3300042643 Ga0466704_304905 Ga0466704_304905_11557_13689 710
115 3300042643 Ga0466704_519464 Ga0466704_519464_140_2272 710
116 3300042643 Ga0466704_545505 Ga0466704_545505_769_2901 710
117 iso_pr_bacteria 2940205530 2940206701 710
118 iso_pr_bacteria 2940212447 2940213598 710
119 iso_pr_bacteria 2940298504 2940299652 710
120 iso_pr_bacteria 2940302308 2940303477 710
121 iso_pr_bacteria 2940306115 2940307497 710
122 iso_pr_bacteria 2940309933 2940311031 710
123 iso_pr_bacteria 2940313741 2940314825 710
124 iso_pr_bacteria 2940317558 2940318640 710
125 iso_pr_bacteria 2940321370 2940322469 710
126 iso_pr_bacteria 2940325180 2940326331 710
127 iso_pr_bacteria 2940328985 2940330137 710
128 iso_pr_bacteria 2940332795 2940333895 710
129 3300042605 Ga0466716_203211 Ga0466716_203211_8795_10933 712
130 3300042605 Ga0466716_431029 Ga0466716_431029_4808_6946 712
131 3300042609 Ga0466722_009947 Ga0466722_009947_54885_57023 712
132 3300042609 Ga0466722_159681 Ga0466722_159681_43368_45506 712
133 3300042615 Ga0466711_081938 Ga0466711_081938_985_3123 712
134 3300042636 Ga0466703_324314 Ga0466703_324314_23392_25530 712
135 3300042609 Ga0466722_044630 Ga0466722_044630_3355_5496 713
136 3300042615 Ga0466711_008154 Ga0466711_008154_2381_4522 713
137 3300042615 Ga0466711_187981 Ga0466711_187981_1571_3712 713
138 3300042618 Ga0466723_342910 Ga0466723_342910_10902_13043 713
139 3300007143 Ga0104048_1004075 Ga0104048_10040757 714
140 3300007150 Ga0104019_1002922 Ga0104019_10029223 714
141 3300042616 Ga0466715_138191 Ga0466715_138191_18869_21013 714
142 3300042582 Ga0466657_018508 Ga0466657_018508_7377_9527 716
143 3300042602 Ga0466713_008663 Ga0466713_008663_171_2324 717
144 3300042636 Ga0466703_002279 Ga0466703_002279_2809_4962 717
145 3300010049 Ga0123356_10042424 Ga0123356_100424242 718
146 3300042622 Ga0466731_195536 Ga0466731_195536_13885_16041 718
147 3300007095 Ga0102739_1000087 Ga0102739_10000877 719
148 3300042620 Ga0466728_199531 Ga0466728_199531_5996_8155 719
149 iso_pr_bacteria 2820735654 2820735950 720
150 3300002462 JGI24702J35022_10000817 JGI24702J35022_100008174 721
151 3300042594 Ga0466694_013838 Ga0466694_013838_511_2679 722
152 3300002504 JGI24705J35276_12235646 JGI24705J35276_122356462 725
153 3300002504 JGI24705J35276_12220859 JGI24705J35276_122208591 734
154 3300012825 Ga0160441_100093 Ga0160441_10009395 734
155 3300042622 Ga0466731_057282 Ga0466731_057282_351_2573 735
156 3300042643 Ga0466704_032616 Ga0466704_032616_4049_6262 737
157 3300007085 Ga0104045_1026904 Ga0104045_10269043 741
158 3300042590 Ga0466690_095660 Ga0466690_095660_2103_4379 752
159 3300042652 Ga0466708_358292 Ga0466708_358292_800_3529 775

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01432 Peptidase_M3 Peptidase family M3 321 773 0.94

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.