Protein Family IF09989
Metagenome
Isolate
247
Members
60
Samples
238
Scaffolds
393.21
Avg Length
Representative Sequence
- ID
- 3300042652|Ga0466708_350441|Ga0466708_350441_138_1499
- Length
- 453 aa
- Sequence
- VSSEGEGAGRYGGAAPVEGGSGSGAERGWSEGGDFPPTKERRFQRNETKIRKRGYMISMKNPVVEMDGDEMTRVLWGLVKERLITPYVELKTEYYDVGLRNRDETDDKVTAEAAYAVKRLGVGVKCATITSNTARKKEYGLKRLHPSPNATIRAILDGTVFRKPIAVSCITPSVSTWKKPIVIGRHAYGDVYKNAELLIPGPGKVELVYTSADGGEEMRIVVAEMKGSGVAQGMYNTDDSIRNFVRSCFLYAIDEKLPVWFATKDTISKTYDGRFKELFNEVXXTEFKESCEAAGVSYFYTLIDDAVARAVKGEGGFLWACKNYDGDVMSDMIASASGSLAMMTSVLVSPCGAVEYEAAHGTVQRHYYKYLKGEKTSTNPVALIFAWTGALAKRGELDNTSDLVAFAKKLEGAVIQTIEGGEMTGDLARLAHPAPVKARDSWEFTDAVAKRLA
Sample Types
Isolate
3.6%
Metagenome
96.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.3%
Kalotermitidae
23.3%
Unclassified
20.0%
Rhinotermitidae
6.7%
Termopsidae
5.0%
Passalidae
3.3%
Hodotermitidae
1.7%
Tenebrionidae
1.7%
Taxonomy
Archaea
0
Bacteria
236
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2820907832 | Unclassified Actinobacteria Emb289P4bin29 | Isolate | Unclassified |
| 11 | 2772190890 | Unclassified Elusimicrobia Lab288P4_bin46 | Isolate | Unclassified |
| 12 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 18 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 19 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 20 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 21 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 22 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 23 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 24 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 25 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 26 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 27 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 28 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 29 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 30 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 31 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 32 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 33 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 34 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 35 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 36 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 37 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 38 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 39 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 40 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 41 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 42 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 43 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 44 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 45 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 46 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 47 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 48 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 49 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 50 | 2820321184 | Unclassified Firmicutes Nt197P3bin86 | Isolate | Unclassified |
| 51 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 52 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 53 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 54 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 55 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 56 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 57 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 58 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 59 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 60 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_109474 | 3300042656 | Bacteria | 12285 |
| 2 | Ga0466705_453680 | 3300042612 | Bacteria | 60201 |
| 3 | Ga0466723_011867 | 3300042618 | Bacteria | 5048 |
| 4 | Ga0466723_165188 | 3300042618 | Bacteria | 17124 |
| 5 | Ga0466723_176377 | 3300042618 | Bacteria | 21678 |
| 6 | Ga0466726_371379 | 3300042619 | Unclassified | 7999 |
| 7 | Ga0466703_242353 | 3300042636 | Bacteria | 1674 |
| 8 | Ga0466706_024037 | 3300042599 | Unclassified | 7573 |
| 9 | Ga0466706_046117 | 3300042599 | Bacteria | 1909 |
| 10 | Ga0466707_298841 | 3300042601 | Bacteria | 23255 |
| 11 | Ga0466719_212027 | 3300042606 | Bacteria | 7980 |
| 12 | Ga0466720_014023 | 3300042607 | Bacteria | 18380 |
| 13 | Ga0466720_136279 | 3300042607 | Bacteria | 9333 |
| 14 | Ga0466690_015481 | 3300042590 | Bacteria | 8468 |
| 15 | Ga0466690_411481 | 3300042590 | Bacteria | 2134 |
| 16 | Ga0466696_052570 | 3300042596 | Bacteria | 2055 |
| 17 | Ga0466696_355841 | 3300042596 | Bacteria | 26852 |
| 18 | Ga0466699_119096 | 3300042597 | Bacteria | 13524 |
| 19 | Ga0466699_148236 | 3300042597 | Bacteria | 6718 |
| 20 | Ga0466705_070686 | 3300042612 | Bacteria | 7210 |
| 21 | Ga0466705_281392 | 3300042612 | Bacteria | 11520 |
| 22 | Ga0466733_069149 | 3300042659 | Bacteria | 4132 |
| 23 | Ga0466733_148807 | 3300042659 | Bacteria | 2242 |
| 24 | Ga0562377_0006 | 3300056842 | Bacteria | 3350072 |
| 25 | Ga0466723_022413 | 3300042618 | Bacteria | 7059 |
| 26 | Ga0466723_156282 | 3300042618 | Bacteria | 7468 |
| 27 | Ga0466728_337886 | 3300042620 | Bacteria | 8920 |
| 28 | Ga0123353_10067922 | 3300010167 | Bacteria | 5725 |
| 29 | Ga0466735_065470 | 3300042624 | Bacteria | 10374 |
| 30 | Ga0466703_046786 | 3300042636 | Bacteria | 9773 |
| 31 | Ga0466703_053076 | 3300042636 | Bacteria | 3930 |
| 32 | Ga0466704_314661 | 3300042643 | Bacteria | 5276 |
| 33 | Ga0466709_058801 | 3300042648 | Bacteria | 8658 |
| 34 | Ga0466708_097044 | 3300042652 | Bacteria | 3708 |
| 35 | Ga0466708_175939 | 3300042652 | Bacteria | 8474 |
| 36 | Ga0466706_007516 | 3300042599 | Bacteria | 1942 |
| 37 | Ga0466706_011938 | 3300042599 | Bacteria | 7641 |
| 38 | Ga0466706_013096 | 3300042599 | Bacteria | 63690 |
| 39 | Ga0466706_275230 | 3300042599 | Bacteria | 65415 |
| 40 | Ga0466700_234430 | 3300042600 | Bacteria | 1420 |
| 41 | Ga0466700_272622 | 3300042600 | Bacteria | 2141 |
| 42 | Ga0466716_035191 | 3300042605 | Bacteria | 11018 |
| 43 | Ga0466716_174209 | 3300042605 | Bacteria | 3759 |
| 44 | Ga0466716_216212 | 3300042605 | Bacteria | 1993 |
| 45 | Ga0456237_0002230 | 3300041968 | Bacteria | 3132 |
| 46 | Ga0466690_162364 | 3300042590 | Bacteria | 16870 |
| 47 | Ga0466694_021685 | 3300042594 | Bacteria | 1810 |
| 48 | Ga0466696_217652 | 3300042596 | Bacteria | 3559 |
| 49 | Ga0466696_331250 | 3300042596 | Bacteria | 8189 |
| 50 | Ga0466705_351984 | 3300042612 | Unclassified | 3135 |
| 51 | Ga0466732_021227 | 3300042656 | Bacteria | 16813 |
| 52 | Ga0466705_522668 | 3300042612 | Bacteria | 9508 |
| 53 | Ga0466712_175784 | 3300042614 | Unclassified | 1656 |
| 54 | Ga0466715_174686 | 3300042616 | Bacteria | 2808 |
| 55 | Ga0466715_322260 | 3300042616 | Bacteria | 13704 |
| 56 | Ga0466715_639027 | 3300042616 | Bacteria | 3923 |
| 57 | Ga0466718_011030 | 3300042617 | Bacteria | 12848 |
| 58 | Ga0466723_035023 | 3300042618 | Bacteria | 1733 |
| 59 | Ga0123355_10103664 | 3300009826 | Bacteria | 4470 |
| 60 | Ga0123353_10653221 | 3300010167 | Bacteria | 1488 |
| 61 | Ga0123354_10032544 | 3300010882 | Bacteria | 8172 |
| 62 | Ga0466703_148492 | 3300042636 | Bacteria | 11799 |
| 63 | Ga0466703_251947 | 3300042636 | Bacteria | 13328 |
| 64 | Ga0466704_417721 | 3300042643 | Bacteria | 3242 |
| 65 | Ga0466708_162467 | 3300042652 | Bacteria | 15143 |
| 66 | Ga0466706_018017 | 3300042599 | Bacteria | 65893 |
| 67 | Ga0466706_126136 | 3300042599 | Bacteria | 9354 |
| 68 | Ga0466706_128882 | 3300042599 | Bacteria | 1941 |
| 69 | Ga0466706_142044 | 3300042599 | Unclassified | 2515 |
| 70 | Ga0466706_180251 | 3300042599 | Unclassified | 12597 |
| 71 | Ga0466713_021881 | 3300042602 | Bacteria | 6362 |
| 72 | Ga0466716_039408 | 3300042605 | Bacteria | 3528 |
| 73 | Ga0466716_045135 | 3300042605 | Bacteria | 9963 |
| 74 | Ga0466722_204727 | 3300042609 | Bacteria | 1404 |
| 75 | Ga0466692_185129 | 3300042591 | Bacteria | 3878 |
| 76 | Ga0466691_011303 | 3300042593 | Bacteria | 20236 |
| 77 | Ga0466691_036633 | 3300042593 | Bacteria | 19315 |
| 78 | Ga0466695_099115 | 3300042595 | Bacteria | 4708 |
| 79 | Ga0466696_097975 | 3300042596 | Bacteria | 3068 |
| 80 | Ga0466699_325243 | 3300042597 | Bacteria | 1531 |
| 81 | Ga0466699_368439 | 3300042597 | Bacteria | 6419 |
| 82 | Ga0466699_399630 | 3300042597 | Bacteria | 19282 |
| 83 | IMNBL1DRAFT_c0000028 | 3300000062 | Bacteria | 135353 |
| 84 | JGI24698J34947_10023265 | 3300002449 | Bacteria | 3316 |
| 85 | Ga0466715_022476 | 3300042616 | Bacteria | 6267 |
| 86 | Ga0466715_040013 | 3300042616 | Bacteria | 12098 |
| 87 | Ga0466723_042720 | 3300042618 | Bacteria | 12105 |
| 88 | Ga0466723_162917 | 3300042618 | Bacteria | 35021 |
| 89 | Ga0466723_344779 | 3300042618 | Bacteria | 3760 |
| 90 | Ga0466726_029585 | 3300042619 | Bacteria | 4943 |
| 91 | Ga0466726_207058 | 3300042619 | Bacteria | 2209 |
| 92 | Ga0466728_065750 | 3300042620 | Bacteria | 2147 |
| 93 | Ga0466703_187224 | 3300042636 | Bacteria | 9803 |
| 94 | Ga0466703_207273 | 3300042636 | Unclassified | 2439 |
| 95 | Ga0466703_291625 | 3300042636 | Bacteria | 2007 |
| 96 | Ga0466704_608488 | 3300042643 | Bacteria | 4755 |
| 97 | Ga0466708_019641 | 3300042652 | Bacteria | 4341 |
| 98 | Ga0466708_056792 | 3300042652 | Bacteria | 1828 |
| 99 | Ga0466708_255279 | 3300042652 | Bacteria | 11002 |
| 100 | Ga0466708_350441 | 3300042652 | Bacteria | 2261 |
| 101 | Ga0466727_046387 | 3300042655 | Bacteria | 4557 |
| 102 | Ga0466713_051368 | 3300042602 | Bacteria | 5916 |
| 103 | Ga0466720_060968 | 3300042607 | Bacteria | 18808 |
| 104 | Ga0466720_107909 | 3300042607 | Bacteria | 2662 |
| 105 | Ga0466721_012392 | 3300042608 | Bacteria | 117035 |
| 106 | Ga0466722_050975 | 3300042609 | Bacteria | 14875 |
| 107 | Ga0466722_266387 | 3300042609 | Bacteria | 22057 |
| 108 | Ga0466690_308146 | 3300042590 | Bacteria | 9865 |
| 109 | Ga0466692_037609 | 3300042591 | Bacteria | 3353 |
| 110 | Ga0466691_099482 | 3300042593 | Bacteria | 11697 |
| 111 | Ga0466696_076156 | 3300042596 | Bacteria | 20915 |
| 112 | Ga0466699_060499 | 3300042597 | Bacteria | 22947 |
| 113 | Ga0466705_269333 | 3300042612 | Bacteria | 9886 |
| 114 | Ga0466705_323175 | 3300042612 | Bacteria | 3364 |
| 115 | JGI24695J34938_10012008 | 3300002450 | Bacteria | 4620 |
| 116 | Ga0068305_10026867 | 3300005083 | Bacteria | 10707 |
| 117 | Ga0466712_040651 | 3300042614 | Bacteria | 4391 |
| 118 | Ga0466715_342895 | 3300042616 | Bacteria | 3085 |
| 119 | Ga0466723_067004 | 3300042618 | Bacteria | 15934 |
| 120 | Ga0466723_138806 | 3300042618 | Bacteria | 3525 |
| 121 | Ga0466723_335924 | 3300042618 | Bacteria | 1433 |
| 122 | Ga0466726_401888 | 3300042619 | Bacteria | 18079 |
| 123 | Ga0466729_244325 | 3300042621 | Bacteria | 5550 |
| 124 | Ga0466703_072635 | 3300042636 | Bacteria | 4878 |
| 125 | Ga0466703_111402 | 3300042636 | Bacteria | 1829 |
| 126 | Ga0466703_327478 | 3300042636 | Unclassified | 7475 |
| 127 | Ga0466704_262265 | 3300042643 | Bacteria | 7468 |
| 128 | Ga0466704_285386 | 3300042643 | Bacteria | 59541 |
| 129 | Ga0466704_441158 | 3300042643 | Bacteria | 10702 |
| 130 | Ga0466709_052937 | 3300042648 | Bacteria | 1528 |
| 131 | Ga0466709_077162 | 3300042648 | Bacteria | 1636 |
| 132 | Ga0466709_127823 | 3300042648 | Bacteria | 15182 |
| 133 | Ga0466709_343899 | 3300042648 | Bacteria | 8854 |
| 134 | Ga0466727_173836 | 3300042655 | Bacteria | 1447 |
| 135 | Ga0466713_139765 | 3300042602 | Bacteria | 1185 |
| 136 | Ga0466714_069739 | 3300042603 | Bacteria | 1732 |
| 137 | Ga0466719_117175 | 3300042606 | Bacteria | 9103 |
| 138 | Ga0466722_156293 | 3300042609 | Bacteria | 5492 |
| 139 | Ga0466722_222937 | 3300042609 | Bacteria | 1608 |
| 140 | Ga0466690_337395 | 3300042590 | Bacteria | 4365 |
| 141 | Ga0466691_205646 | 3300042593 | Bacteria | 3314 |
| 142 | Ga0466691_219051 | 3300042593 | Bacteria | 16741 |
| 143 | Ga0466694_008376 | 3300042594 | Bacteria | 20127 |
| 144 | Ga0466696_039774 | 3300042596 | Bacteria | 4035 |
| 145 | Ga0466699_075947 | 3300042597 | Bacteria | 20704 |
| 146 | Ga0466732_367767 | 3300042656 | Bacteria | 1578 |
| 147 | AustNasuHG_c1003147 | 3300000089 | Bacteria | 5953 |
| 148 | Ga0068305_10024282 | 3300005083 | Bacteria | 10224 |
| 149 | Ga0466711_064070 | 3300042615 | Bacteria | 3866 |
| 150 | Ga0466715_198642 | 3300042616 | Bacteria | 8660 |
| 151 | Ga0466723_091070 | 3300042618 | Bacteria | 80773 |
| 152 | Ga0466723_183012 | 3300042618 | Bacteria | 6792 |
| 153 | Ga0466726_101876 | 3300042619 | Bacteria | 2350 |
| 154 | Ga0466728_386220 | 3300042620 | Bacteria | 4643 |
| 155 | Ga0123357_10196879 | 3300009784 | Bacteria | 2305 |
| 156 | Ga0466703_179368 | 3300042636 | Bacteria | 3506 |
| 157 | Ga0466704_035310 | 3300042643 | Bacteria | 13086 |
| 158 | Ga0466704_533185 | 3300042643 | Bacteria | 78418 |
| 159 | Ga0466708_156488 | 3300042652 | Bacteria | 8506 |
| 160 | Ga0466708_209530 | 3300042652 | Bacteria | 4447 |
| 161 | Ga0466706_018647 | 3300042599 | Bacteria | 6797 |
| 162 | Ga0466716_399500 | 3300042605 | Bacteria | 7919 |
| 163 | Ga0466719_537587 | 3300042606 | Bacteria | 14234 |
| 164 | Ga0466722_038058 | 3300042609 | Bacteria | 9555 |
| 165 | Ga0456237_0008883 | 3300041968 | Bacteria | 1507 |
| 166 | Ga0466690_079872 | 3300042590 | Bacteria | 4612 |
| 167 | Ga0466690_137906 | 3300042590 | Bacteria | 1399 |
| 168 | Ga0466690_195008 | 3300042590 | Bacteria | 2840 |
| 169 | Ga0466691_047488 | 3300042593 | Unclassified | 4432 |
| 170 | Ga0466691_119563 | 3300042593 | Bacteria | 3221 |
| 171 | Ga0466694_107547 | 3300042594 | Bacteria | 58970 |
| 172 | Ga0466694_307566 | 3300042594 | Bacteria | 3215 |
| 173 | Ga0466705_095637 | 3300042612 | Bacteria | 6432 |
| 174 | 2227100258 | 2225789004 | Bacteria | 9607 |
| 175 | 2227569087 | 2225789004 | Bacteria | 13952 |
| 176 | JGI24698J34947_10013228 | 3300002449 | Bacteria | 4508 |
| 177 | Ga0466711_356575 | 3300042615 | Bacteria | 11015 |
| 178 | Ga0466711_509250 | 3300042615 | Bacteria | 7534 |
| 179 | Ga0466715_223270 | 3300042616 | Bacteria | 4256 |
| 180 | Ga0466715_523671 | 3300042616 | Bacteria | 2712 |
| 181 | Ga0466723_112894 | 3300042618 | Bacteria | 3844 |
| 182 | Ga0466723_148251 | 3300042618 | Bacteria | 9664 |
| 183 | Ga0466723_240484 | 3300042618 | Bacteria | 13502 |
| 184 | Ga0466726_208110 | 3300042619 | Bacteria | 44057 |
| 185 | Ga0123356_10001371 | 3300010049 | Bacteria | 26967 |
| 186 | Ga0123356_10011169 | 3300010049 | Bacteria | 8770 |
| 187 | Ga0466731_076388 | 3300042622 | Bacteria | 3804 |
| 188 | Ga0466734_103172 | 3300042623 | Bacteria | 2241 |
| 189 | Ga0466708_004611 | 3300042652 | Bacteria | 24859 |
| 190 | Ga0466706_150639 | 3300042599 | Bacteria | 14753 |
| 191 | Ga0466706_178287 | 3300042599 | Bacteria | 1743 |
| 192 | Ga0466707_033197 | 3300042601 | Bacteria | 4258 |
| 193 | Ga0466707_209216 | 3300042601 | Bacteria | 10654 |
| 194 | Ga0466716_167340 | 3300042605 | Bacteria | 3100 |
| 195 | Ga0466716_196140 | 3300042605 | Bacteria | 29327 |
| 196 | Ga0466719_145471 | 3300042606 | Bacteria | 2411 |
| 197 | Ga0466719_325650 | 3300042606 | Bacteria | 8302 |
| 198 | Ga0466719_367021 | 3300042606 | Bacteria | 2186 |
| 199 | Ga0466720_010845 | 3300042607 | Bacteria | 17725 |
| 200 | Ga0466720_046061 | 3300042607 | Bacteria | 9587 |
| 201 | Ga0466720_116740 | 3300042607 | Bacteria | 72912 |
| 202 | Ga0466720_143104 | 3300042607 | Bacteria | 24676 |
| 203 | Ga0466692_195927 | 3300042591 | Bacteria | 4849 |
| 204 | Ga0466696_008061 | 3300042596 | Bacteria | 3759 |
| 205 | Ga0466699_050425 | 3300042597 | Bacteria | 17032 |
| 206 | Ga0466699_086144 | 3300042597 | Unclassified | 5696 |
| 207 | Ga0466699_364822 | 3300042597 | Bacteria | 2447 |
| 208 | Ga0466699_390627 | 3300042597 | Bacteria | 19180 |
| 209 | Ga0466697_152904 | 3300042611 | Bacteria | 2740 |
| 210 | Ga0466705_244165 | 3300042612 | Bacteria | 2075 |
| 211 | AustNasuHG_c1004269 | 3300000089 | Bacteria | 5127 |
| 212 | Ga0068305_10023251 | 3300005083 | Bacteria | 105200 |
| 213 | Ga0466715_493755 | 3300042616 | Bacteria | 6283 |
| 214 | Ga0466718_046668 | 3300042617 | Bacteria | 8881 |
| 215 | Ga0466729_155686 | 3300042621 | Bacteria | 8567 |
| 216 | Ga0123354_10000001 | 3300010882 | Bacteria | 474550 |
| 217 | Ga0466729_264269 | 3300042621 | Bacteria | 16388 |
| 218 | Ga0466735_134127 | 3300042624 | Bacteria | 1926 |
| 219 | Ga0466703_115833 | 3300042636 | Bacteria | 8498 |
| 220 | Ga0466704_101322 | 3300042643 | Bacteria | 3396 |
| 221 | Ga0466709_121339 | 3300042648 | Bacteria | 19510 |
| 222 | Ga0466708_018723 | 3300042652 | Bacteria | 15494 |
| 223 | Ga0466727_114512 | 3300042655 | Bacteria | 5857 |
| 224 | Ga0466727_144202 | 3300042655 | Bacteria | 1387 |
| 225 | Ga0466727_224439 | 3300042655 | Bacteria | 1992 |
| 226 | Ga0466706_187752 | 3300042599 | Bacteria | 1748 |
| 227 | Ga0466706_260726 | 3300042599 | Bacteria | 2639 |
| 228 | Ga0466706_278510 | 3300042599 | Bacteria | 21524 |
| 229 | Ga0466707_229006 | 3300042601 | Bacteria | 7631 |
| 230 | Ga0466713_095981 | 3300042602 | Bacteria | 15907 |
| 231 | Ga0466717_157593 | 3300042604 | Bacteria | 1373 |
| 232 | Ga0466690_240285 | 3300042590 | Unclassified | 3696 |
| 233 | Ga0466690_258004 | 3300042590 | Bacteria | 2262 |
| 234 | Ga0466692_101449 | 3300042591 | Bacteria | 6167 |
| 235 | Ga0466692_168314 | 3300042591 | Bacteria | 1338 |
| 236 | Ga0466691_031223 | 3300042593 | Bacteria | 17683 |
| 237 | Ga0466691_181473 | 3300042593 | Bacteria | 3026 |
| 238 | Ga0466694_136666 | 3300042594 | Bacteria | 4360 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00180 | Iso_dh | Isocitrate/isopropylmalate dehydrogenase | 62 | 447 | 0.91 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.