Protein Family IF09967

Metagenome Isolate
197 Members
53 Samples
189 Scaffolds
290.33 Avg Length

🧬 Representative Sequence

ID
3300042652|Ga0466708_300694|Ga0466708_300694_7389_8384
Length
331 aa
Sequence
VKASSVKRLALGRGLERPVLGMAPECLEPAEKGGIMIVLHQLINGLSLGSIYALIALGYTMVYGIVLLINFAHGDILMVGAYTAFFVLGAAGPGPLGMFAAFVASALLCAVFGITIERLAYRPLRSAPRLNSLITAIAVSLILENGARVLPFIGPNPRQFPQPAVVTIDLGGGLSVSNIQIIVIVLSALLMLALNLLVNYTRRGKAMRAVSFDQGAASLMGISVNRVIAFTFALGSVLAAAGGVLYASAYPQVNPLMGMMPGLKAFVAAVLGGIGSIPGAMLGGFILGIAETMTKGFLSSQYSDAISFSILIIVLLIKPTGILGKKLNVKV

📊 Sample Types

Isolate 4.1%
Metagenome 95.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 42.3%
Kalotermitidae 26.9%
Unclassified 17.3%
Rhinotermitidae 5.8%
Termopsidae 5.8%
Hodotermitidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 176
Eukaryota 0
Viruses 0
Unclassified 21

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
2 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
3 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
4 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
5 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
6 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
7 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
8 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
9 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
10 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
11 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
12 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
13 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
14 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
15 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
16 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
17 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
18 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
19 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
20 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
21 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
22 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
23 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
24 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
25 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
26 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
27 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
28 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
29 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
30 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
31 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
32 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
33 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
34 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
35 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
36 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
37 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
38 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
39 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
40 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
41 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
42 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
43 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
44 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
45 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
46 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
47 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
48 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
49 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
50 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
51 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
52 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
53 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_234843 3300042656 Bacteria 3069
2 Ga0466732_369303 3300042656 Bacteria 1327
3 Ga0466705_510487 3300042612 Bacteria 4277
4 Ga0466712_116951 3300042614 Bacteria 17570
5 Ga0466711_040360 3300042615 Bacteria 9484
6 Ga0466711_201299 3300042615 Bacteria 38820
7 Ga0466715_174494 3300042616 Bacteria 12675
8 Ga0466715_349608 3300042616 Bacteria 7044
9 Ga0466718_002188 3300042617 Bacteria 15261
10 Ga0466718_099063 3300042617 Bacteria 2038
11 Ga0466723_135943 3300042618 Bacteria 3049
12 Ga0466726_274373 3300042619 Unclassified 4542
13 Ga0466728_049539 3300042620 Unclassified 7517
14 Ga0466690_068664 3300042590 Bacteria 1860
15 Ga0466696_316742 3300042596 Bacteria 3280
16 Ga0466699_284454 3300042597 Bacteria 4223
17 Ga0466735_039265 3300042624 Bacteria 2400
18 Ga0466703_257371 3300042636 Bacteria 18409
19 Ga0466704_268625 3300042643 Bacteria 59494
20 Ga0466709_088976 3300042648 Bacteria 16281
21 Ga0466709_296303 3300042648 Bacteria 26634
22 Ga0466708_265181 3300042652 Bacteria 8979
23 Ga0466708_300694 3300042652 Bacteria 12759
24 Ga0466707_276844 3300042601 Bacteria 5727
25 Ga0466714_154842 3300042603 Bacteria 1142
26 Ga0466716_086720 3300042605 Bacteria 4571
27 AustNasuHG_c1012251 3300000089 Bacteria 2961
28 JGI24698J34947_10008110 3300002449 Bacteria 5765
29 Ga0466712_306328 3300042614 Unclassified 1889
30 Ga0466718_117073 3300042617 Bacteria 8273
31 Ga0466723_049330 3300042618 Bacteria 29056
32 Ga0466726_009573 3300042619 Bacteria 2457
33 Ga0466726_100664 3300042619 Bacteria 7024
34 Ga0466726_307282 3300042619 Bacteria 1209
35 Ga0466728_058412 3300042620 Unclassified 1258
36 Ga0466728_116104 3300042620 Bacteria 6483
37 Ga0123357_10438849 3300009784 Bacteria 1145
38 Ga0123356_10014268 3300010049 Bacteria 7643
39 Ga0466691_119382 3300042593 Bacteria 6859
40 Ga0466691_140233 3300042593 Bacteria 4821
41 Ga0466691_140235 3300042593 Bacteria 7355
42 Ga0466694_383733 3300042594 Bacteria 1981
43 Ga0466696_302222 3300042596 Bacteria 5580
44 Ga0466696_424335 3300042596 Bacteria 4967
45 Ga0466709_126954 3300042648 Bacteria 6950
46 Ga0466708_139336 3300042652 Bacteria 48639
47 Ga0466708_163304 3300042652 Bacteria 33834
48 Ga0466700_475539 3300042600 Bacteria 6391
49 Ga0466719_152423 3300042606 Bacteria 16922
50 Ga0466720_043043 3300042607 Unclassified 2425
51 Ga0466705_172022 3300042612 Bacteria 22969
52 Ga0466711_223051 3300042615 Bacteria 6846
53 Ga0466715_003247 3300042616 Bacteria 3793
54 Ga0466715_559985 3300042616 Bacteria 52926
55 Ga0466723_075462 3300042618 Bacteria 18487
56 Ga0466723_264634 3300042618 Bacteria 4404
57 Ga0123354_10215242 3300010882 Bacteria 2061
58 Ga0466690_413721 3300042590 Bacteria 7303
59 Ga0466691_155306 3300042593 Bacteria 8318
60 Ga0466691_224835 3300042593 Bacteria 7338
61 Ga0466699_242977 3300042597 Bacteria 3025
62 Ga0466699_393234 3300042597 Bacteria 1661
63 Ga0466729_216415 3300042621 Unclassified 2665
64 Ga0466704_302462 3300042643 Unclassified 1234
65 Ga0466708_175839 3300042652 Bacteria 10526
66 Ga0466727_260997 3300042655 Bacteria 4783
67 Ga0466706_117630 3300042599 Bacteria 15050
68 Ga0466720_004755 3300042607 Bacteria 4682
69 JGI24698J34947_10006467 3300002449 Bacteria 6429
70 JGI24702J35022_10149711 3300002462 Bacteria 1309
71 Ga0072941_1001954 3300005201 Bacteria 13981
72 Ga0072941_1007506 3300005201 Bacteria 17619
73 Ga0466705_321325 3300042612 Bacteria 10416
74 Ga0466733_063506 3300042659 Bacteria 3925
75 Ga0466711_017640 3300042615 Bacteria 5281
76 Ga0466715_031524 3300042616 Bacteria 20895
77 Ga0466715_182927 3300042616 Unclassified 1492
78 Ga0466718_080676 3300042617 Bacteria 4559
79 Ga0466718_103056 3300042617 Bacteria 34191
80 Ga0466726_150295 3300042619 Unclassified 2491
81 Ga0466728_176584 3300042620 Bacteria 3796
82 Ga0123357_10005733 3300009784 Bacteria 14950
83 Ga0123353_10816551 3300010167 Bacteria 1285
84 Ga0123353_11191186 3300010167 Unclassified 1001
85 Ga0466690_287972 3300042590 Bacteria 6211
86 Ga0466692_020292 3300042591 Bacteria 4530
87 Ga0466691_022054 3300042593 Bacteria 6880
88 Ga0466691_048050 3300042593 Unclassified 2723
89 Ga0466703_022028 3300042636 Bacteria 12366
90 Ga0466708_252715 3300042652 Bacteria 4353
91 Ga0466727_300915 3300042655 Bacteria 2872
92 Ga0466716_265588 3300042605 Unclassified 4905
93 Ga0466719_141738 3300042606 Bacteria 2907
94 AustNasuHG_c1000442 3300000089 Bacteria 14523
95 JGI24698J34947_10000213 3300002449 Bacteria 23882
96 JGI24695J34938_10007878 3300002450 Bacteria 6164
97 JGI24702J35022_10002389 3300002462 Bacteria 11487
98 Ga0466705_101951 3300042612 Bacteria 11451
99 Ga0466711_384308 3300042615 Bacteria 3127
100 Ga0466718_037403 3300042617 Bacteria 33069
101 Ga0466718_062280 3300042617 Bacteria 1364
102 Ga0466723_091159 3300042618 Bacteria 15344
103 Ga0466723_265950 3300042618 Bacteria 7471
104 Ga0466726_046162 3300042619 Bacteria 6787
105 Ga0466726_154022 3300042619 Bacteria 1449
106 Ga0466726_252664 3300042619 Bacteria 2165
107 Ga0466728_175081 3300042620 Bacteria 2890
108 Ga0466690_144618 3300042590 Bacteria 1438
109 Ga0466690_214466 3300042590 Unclassified 4250
110 Ga0466691_057288 3300042593 Bacteria 3042
111 Ga0466694_030604 3300042594 Unclassified 3229
112 Ga0466696_205482 3300042596 Bacteria 15324
113 Ga0466734_047717 3300042623 Bacteria 1024
114 Ga0466734_140872 3300042623 Bacteria 1492
115 Ga0466704_180564 3300042643 Bacteria 35870
116 Ga0466709_043357 3300042648 Bacteria 20072
117 Ga0466708_051869 3300042652 Bacteria 3947
118 Ga0466708_060787 3300042652 Bacteria 11369
119 Ga0466708_134102 3300042652 Bacteria 4154
120 Ga0466727_090020 3300042655 Bacteria 10792
121 Ga0466716_238682 3300042605 Bacteria 13996
122 Ga0466719_107225 3300042606 Unclassified 1894
123 Ga0466720_092111 3300042607 Unclassified 1182
124 Ga0466722_122446 3300042609 Bacteria 10691
125 JGI24695J34938_10019036 3300002450 Bacteria 3413
126 Ga0466705_045297 3300042612 Bacteria 4793
127 Ga0466705_326321 3300042612 Unclassified 1018
128 Ga0466705_425315 3300042612 Bacteria 8908
129 Ga0466711_030216 3300042615 Bacteria 14469
130 Ga0466715_327556 3300042616 Bacteria 6013
131 Ga0466715_414587 3300042616 Bacteria 17703
132 Ga0466718_016770 3300042617 Bacteria 4687
133 Ga0466723_194938 3300042618 Bacteria 4763
134 Ga0466723_205487 3300042618 Bacteria 7760
135 Ga0466723_273696 3300042618 Bacteria 7640
136 Ga0466726_227272 3300042619 Bacteria 2519
137 Ga0123356_10121841 3300010049 Bacteria 2538
138 Ga0466693_378756 3300042592 Bacteria 10021
139 Ga0466691_014085 3300042593 Bacteria 15763
140 Ga0466696_066795 3300042596 Bacteria 20973
141 Ga0466703_245615 3300042636 Bacteria 7970
142 Ga0466703_258157 3300042636 Bacteria 3331
143 Ga0466704_494829 3300042643 Bacteria 21929
144 Ga0466709_254776 3300042648 Bacteria 1253
145 Ga0466709_274967 3300042648 Bacteria 1254
146 Ga0466716_187233 3300042605 Bacteria 6308
147 Ga0466720_126859 3300042607 Bacteria 3687
148 Ga0466722_008261 3300042609 Bacteria 3331
149 Ga0466698_289982 3300042610 Bacteria 2060
150 JGI24695J34938_10000164 3300002450 Bacteria 61824
151 JGI24699J35502_11109291 3300002509 Bacteria 2627
152 Ga0072941_1001351 3300005201 Bacteria 33692
153 Ga0466712_046872 3300042614 Bacteria 9838
154 Ga0466715_183915 3300042616 Unclassified 2350
155 Ga0466718_149843 3300042617 Unclassified 1322
156 Ga0123356_10506557 3300010049 Bacteria 1364
157 Ga0466692_031136 3300042591 Bacteria 4762
158 Ga0466692_035034 3300042591 Bacteria 1174
159 Ga0466699_119978 3300042597 Bacteria 26184
160 Ga0466704_545342 3300042643 Bacteria 14429
161 Ga0466709_103928 3300042648 Bacteria 6052
162 Ga0466709_129240 3300042648 Bacteria 2987
163 Ga0466708_374433 3300042652 Bacteria 4323
164 Ga0466708_420427 3300042652 Bacteria 1176
165 Ga0466716_015948 3300042605 Bacteria 8574
166 Ga0466719_304044 3300042606 Bacteria 13674
167 Ga0466722_060724 3300042609 Bacteria 12153
168 AustNasuHG_c1006166 3300000089 Unclassified 4285
169 JGI24695J34938_10007056 3300002450 Bacteria 6645
170 Ga0466732_251152 3300042656 Bacteria 12936
171 Ga0466705_438321 3300042612 Bacteria 6150
172 Ga0466711_451068 3300042615 Bacteria 23955
173 Ga0466715_559060 3300042616 Bacteria 2226
174 Ga0466723_052242 3300042618 Bacteria 24414
175 Ga0466723_100064 3300042618 Bacteria 25786
176 Ga0466723_159412 3300042618 Bacteria 5368
177 Ga0466728_032303 3300042620 Bacteria 3767
178 Ga0466729_063535 3300042621 Bacteria 1580
179 Ga0466692_067993 3300042591 Unclassified 1479
180 Ga0466692_083913 3300042591 Bacteria 1355
181 Ga0466692_113761 3300042591 Bacteria 1041
182 Ga0466692_151397 3300042591 Bacteria 15083
183 Ga0466691_139147 3300042593 Bacteria 13177
184 Ga0466716_341112 3300042605 Bacteria 6287
185 Ga0466716_368582 3300042605 Bacteria 5893
186 Ga0466722_106538 3300042609 Bacteria 8786
187 AustNasuHG_c1003333 3300000089 Bacteria 5796
188 JGI24695J34938_10004667 3300002450 Bacteria 8897
189 Ga0074263_110455 3300005485 Bacteria 5569

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042616 Ga0466715_182927 Ga0466715_182927_707_1468 253
2 3300042652 Ga0466708_051869 Ga0466708_051869_48_809 253
3 3300042652 Ga0466708_420427 Ga0466708_420427_368_1129 253
4 3300042612 Ga0466705_326321 Ga0466705_326321_170_982 262
5 3300042612 Ga0466705_045297 Ga0466705_045297_719_1609 266
6 iso_pr_bacteria 2781125681 2781407345 268
7 3300005201 Ga0072941_1001954 Ga0072941_100195412 269
8 3300042619 Ga0466726_274373 Ga0466726_274373_2984_3793 269
9 3300042655 Ga0466727_300915 Ga0466727_300915_1113_1922 269
10 3300042593 Ga0466691_140233 Ga0466691_140233_521_1411 270
11 3300042643 Ga0466704_302462 Ga0466704_302462_68_880 270
12 3300042590 Ga0466690_287972 Ga0466690_287972_12_827 271
13 3300042591 Ga0466692_035034 Ga0466692_035034_320_1135 271
14 3300042591 Ga0466692_151397 Ga0466692_151397_5810_6625 271
15 3300042605 Ga0466716_368582 Ga0466716_368582_2978_3793 271
16 3300042616 Ga0466715_003247 Ga0466715_003247_2203_3018 271
17 3300042618 Ga0466723_265950 Ga0466723_265950_4228_5043 271
18 3300005201 Ga0072941_1001351 Ga0072941_100135119 273
19 3300042603 Ga0466714_154842 Ga0466714_154842_53_943 273
20 3300042593 Ga0466691_224835 Ga0466691_224835_2942_3832 275
21 3300042619 Ga0466726_252664 Ga0466726_252664_1254_2150 275
22 3300042610 Ga0466698_289982 Ga0466698_289982_124_1014 276
23 3300042591 Ga0466692_067993 Ga0466692_067993_321_1211 278
24 3300042620 Ga0466728_032303 Ga0466728_032303_2129_3019 278
25 3300042648 Ga0466709_296303 Ga0466709_296303_1587_2477 279
26 3300042593 Ga0466691_155306 Ga0466691_155306_6959_7849 281
27 3300042607 Ga0466720_092111 Ga0466720_092111_233_1123 281
28 3300042612 Ga0466705_425315 Ga0466705_425315_1047_1937 281
29 3300042616 Ga0466715_559985 Ga0466715_559985_12101_12988 281
30 3300042618 Ga0466723_194938 Ga0466723_194938_2025_2915 281
31 3300042636 Ga0466703_258157 Ga0466703_258157_629_1519 281
32 3300042643 Ga0466704_180564 Ga0466704_180564_5387_6277 281
33 3300042652 Ga0466708_139336 Ga0466708_139336_26249_27139 281
34 3300042597 Ga0466699_393234 Ga0466699_393234_155_1045 282
35 3300042607 Ga0466720_004755 Ga0466720_004755_878_1768 282
36 3300042617 Ga0466718_149843 Ga0466718_149843_348_1238 283
37 3300042655 Ga0466727_090020 Ga0466727_090020_7802_8689 283
38 3300005201 Ga0072941_1007506 Ga0072941_10075064 284
39 3300042594 Ga0466694_030604 Ga0466694_030604_651_1541 284
40 3300042594 Ga0466694_383733 Ga0466694_383733_928_1818 284
41 3300042607 Ga0466720_043043 Ga0466720_043043_847_1737 284
42 3300042607 Ga0466720_126859 Ga0466720_126859_1813_2703 284
43 3300042617 Ga0466718_002188 Ga0466718_002188_6137_7027 284
44 3300042617 Ga0466718_016770 Ga0466718_016770_1751_2641 284
45 3300042617 Ga0466718_037403 Ga0466718_037403_1280_2170 284
46 3300042617 Ga0466718_099063 Ga0466718_099063_182_1072 284
47 3300042617 Ga0466718_103056 Ga0466718_103056_30081_30971 284
48 3300042623 Ga0466734_140872 Ga0466734_140872_554_1450 284
49 3300000089 AustNasuHG_c1003333 AustNasuHG_10033335 285
50 3300000089 AustNasuHG_c1006166 AustNasuHG_10061662 285
51 3300042605 Ga0466716_341112 Ga0466716_341112_5126_6016 285
52 3300042606 Ga0466719_141738 Ga0466719_141738_246_1136 285
53 3300042609 Ga0466722_008261 Ga0466722_008261_880_1770 285
54 3300042618 Ga0466723_100064 Ga0466723_100064_21269_22165 285
55 3300042591 Ga0466692_031136 Ga0466692_031136_420_1307 286
56 3300042596 Ga0466696_066795 Ga0466696_066795_8811_9698 286
57 3300042597 Ga0466699_242977 Ga0466699_242977_1234_2124 286
58 3300042591 Ga0466692_020292 Ga0466692_020292_1377_2267 287
59 3300042593 Ga0466691_048050 Ga0466691_048050_1297_2184 287
60 3300042615 Ga0466711_384308 Ga0466711_384308_2165_3055 287
61 3300042621 Ga0466729_063535 Ga0466729_063535_142_1032 287
62 3300042648 Ga0466709_103928 Ga0466709_103928_3750_4637 287
63 3300042655 Ga0466727_260997 Ga0466727_260997_2327_3217 287
64 3300010882 Ga0123354_10215242 Ga0123354_102152422 288
65 3300042591 Ga0466692_083913 Ga0466692_083913_69_959 288
66 3300042593 Ga0466691_119382 Ga0466691_119382_4509_5399 288
67 3300042606 Ga0466719_304044 Ga0466719_304044_7402_8292 288
68 3300042618 Ga0466723_159412 Ga0466723_159412_1072_1962 288
69 3300042620 Ga0466728_175081 Ga0466728_175081_403_1293 288
70 3300042652 Ga0466708_134102 Ga0466708_134102_570_1460 288
71 3300042617 Ga0466718_062280 Ga0466718_062280_153_1043 289
72 3300042656 Ga0466732_251152 Ga0466732_251152_4301_5191 289
73 3300042656 Ga0466732_369303 Ga0466732_369303_250_1140 289
74 3300000089 AustNasuHG_c1012251 AustNasuHG_10122512 290
75 3300042609 Ga0466722_060724 Ga0466722_060724_7737_8627 290
76 3300042615 Ga0466711_223051 Ga0466711_223051_581_1471 290
77 3300042615 Ga0466711_451068 Ga0466711_451068_13205_14095 290
78 3300042616 Ga0466715_183915 Ga0466715_183915_397_1287 290
79 3300042652 Ga0466708_175839 Ga0466708_175839_1315_2205 290
80 3300000089 AustNasuHG_c1000442 AustNasuHG_100044213 294
81 3300042590 Ga0466690_068664 Ga0466690_068664_507_1391 294
82 3300042590 Ga0466690_214466 Ga0466690_214466_368_1255 295
83 3300042601 Ga0466707_276844 Ga0466707_276844_4774_5661 295
84 3300042605 Ga0466716_265588 Ga0466716_265588_3174_4061 295
85 3300042606 Ga0466719_107225 Ga0466719_107225_526_1413 295
86 3300042606 Ga0466719_152423 Ga0466719_152423_12781_13668 295
87 3300042612 Ga0466705_172022 Ga0466705_172022_13697_14584 295
88 3300042615 Ga0466711_040360 Ga0466711_040360_4255_5142 295
89 3300042616 Ga0466715_349608 Ga0466715_349608_5334_6221 295
90 3300042617 Ga0466718_080676 Ga0466718_080676_2968_3855 295
91 3300042618 Ga0466723_273696 Ga0466723_273696_3385_4272 295
92 3300042619 Ga0466726_154022 Ga0466726_154022_382_1269 295
93 3300042621 Ga0466729_216415 Ga0466729_216415_1500_2387 295
94 3300042643 Ga0466704_268625 Ga0466704_268625_36642_37529 295
95 3300042648 Ga0466709_274967 Ga0466709_274967_58_945 295
96 3300042652 Ga0466708_374433 Ga0466708_374433_3341_4228 295
97 3300042656 Ga0466732_234843 Ga0466732_234843_1523_2410 295
98 iso_pr_bacteria 650716099 650879738 295
99 3300042590 Ga0466690_144618 Ga0466690_144618_150_1040 296
100 3300042590 Ga0466690_413721 Ga0466690_413721_4604_5494 296
101 3300042591 Ga0466692_113761 Ga0466692_113761_113_1003 296
102 3300042592 Ga0466693_378756 Ga0466693_378756_1860_2750 296
103 3300042593 Ga0466691_014085 Ga0466691_014085_2050_2940 296
104 3300042593 Ga0466691_057288 Ga0466691_057288_1889_2779 296
105 3300042596 Ga0466696_205482 Ga0466696_205482_2230_3120 296
106 3300042596 Ga0466696_302222 Ga0466696_302222_1716_2606 296
107 3300042596 Ga0466696_316742 Ga0466696_316742_2282_3172 296
108 3300042596 Ga0466696_424335 Ga0466696_424335_2638_3528 296
109 3300042597 Ga0466699_119978 Ga0466699_119978_2718_3608 296
110 3300042597 Ga0466699_284454 Ga0466699_284454_1742_2632 296
111 3300042599 Ga0466706_117630 Ga0466706_117630_5169_6059 296
112 3300042600 Ga0466700_475539 Ga0466700_475539_4424_5314 296
113 3300042605 Ga0466716_015948 Ga0466716_015948_6199_7089 296
114 3300042605 Ga0466716_086720 Ga0466716_086720_1271_2161 296
115 3300042605 Ga0466716_187233 Ga0466716_187233_4285_5175 296
116 3300042605 Ga0466716_238682 Ga0466716_238682_3254_4144 296
117 3300042609 Ga0466722_106538 Ga0466722_106538_2942_3832 296
118 3300042609 Ga0466722_122446 Ga0466722_122446_8621_9511 296
119 3300042612 Ga0466705_101951 Ga0466705_101951_8815_9705 296
120 3300042612 Ga0466705_321325 Ga0466705_321325_3426_4316 296
121 3300042612 Ga0466705_438321 Ga0466705_438321_3882_4772 296
122 3300042614 Ga0466712_046872 Ga0466712_046872_7338_8228 296
123 3300042614 Ga0466712_116951 Ga0466712_116951_9893_10783 296
124 3300042614 Ga0466712_306328 Ga0466712_306328_455_1345 296
125 3300042615 Ga0466711_017640 Ga0466711_017640_4004_4894 296
126 3300042615 Ga0466711_030216 Ga0466711_030216_5149_6039 296
127 3300042615 Ga0466711_201299 Ga0466711_201299_26094_26984 296
128 3300042616 Ga0466715_031524 Ga0466715_031524_5714_6604 296
129 3300042616 Ga0466715_174494 Ga0466715_174494_4774_5664 296
130 3300042616 Ga0466715_327556 Ga0466715_327556_1133_2023 296
131 3300042616 Ga0466715_414587 Ga0466715_414587_291_1181 296
132 3300042617 Ga0466718_117073 Ga0466718_117073_5747_6637 296
133 3300042618 Ga0466723_049330 Ga0466723_049330_9360_10250 296
134 3300042618 Ga0466723_135943 Ga0466723_135943_1134_2024 296
135 3300042618 Ga0466723_205487 Ga0466723_205487_4562_5452 296
136 3300042618 Ga0466723_264634 Ga0466723_264634_694_1584 296
137 3300042619 Ga0466726_009573 Ga0466726_009573_193_1083 296
138 3300042619 Ga0466726_046162 Ga0466726_046162_4717_5607 296
139 3300042619 Ga0466726_100664 Ga0466726_100664_3643_4533 296
140 3300042619 Ga0466726_150295 Ga0466726_150295_979_1869 296
141 3300042619 Ga0466726_307282 Ga0466726_307282_12_902 296
142 3300042620 Ga0466728_049539 Ga0466728_049539_735_1625 296
143 3300042620 Ga0466728_058412 Ga0466728_058412_89_979 296
144 3300042620 Ga0466728_116104 Ga0466728_116104_3511_4401 296
145 3300042620 Ga0466728_176584 Ga0466728_176584_1568_2458 296
146 3300042624 Ga0466735_039265 Ga0466735_039265_1165_2055 296
147 3300042636 Ga0466703_022028 Ga0466703_022028_3641_4531 296
148 3300042636 Ga0466703_245615 Ga0466703_245615_1043_1933 296
149 3300042636 Ga0466703_257371 Ga0466703_257371_12946_13836 296
150 3300042643 Ga0466704_494829 Ga0466704_494829_1465_2355 296
151 3300042643 Ga0466704_545342 Ga0466704_545342_3543_4433 296
152 3300042648 Ga0466709_043357 Ga0466709_043357_701_1591 296
153 3300042648 Ga0466709_088976 Ga0466709_088976_2317_3207 296
154 3300042648 Ga0466709_126954 Ga0466709_126954_4959_5849 296
155 3300042648 Ga0466709_129240 Ga0466709_129240_1397_2287 296
156 3300042652 Ga0466708_060787 Ga0466708_060787_7422_8312 296
157 3300042652 Ga0466708_163304 Ga0466708_163304_8715_9605 296
158 3300042652 Ga0466708_252715 Ga0466708_252715_3095_3985 296
159 3300042652 Ga0466708_265181 Ga0466708_265181_6231_7121 296
160 iso_pr_bacteria 2781125634 2781273940 296
161 iso_pr_bacteria 2781125644 2781295501 296
162 iso_pr_bacteria 2781125651 2781309817 296
163 iso_pr_bacteria 2781125666 2781345596 296
164 iso_pr_bacteria 2819992462 2819993936 296
165 iso_pr_bacteria 2820020240 2820020974 296
166 3300002449 JGI24698J34947_10000213 JGI24698J34947_1000021320 297
167 3300002449 JGI24698J34947_10006467 JGI24698J34947_100064677 297
168 3300002449 JGI24698J34947_10008110 JGI24698J34947_100081104 297
169 3300002450 JGI24695J34938_10000164 JGI24695J34938_1000016420 297
170 3300002450 JGI24695J34938_10004667 JGI24695J34938_100046673 297
171 3300002450 JGI24695J34938_10007056 JGI24695J34938_100070568 297
172 3300002450 JGI24695J34938_10007878 JGI24695J34938_100078782 297
173 3300002450 JGI24695J34938_10019036 JGI24695J34938_100190362 297
174 3300002462 JGI24702J35022_10002389 JGI24702J35022_100023893 297
175 3300002462 JGI24702J35022_10149711 JGI24702J35022_101497111 297
176 3300002509 JGI24699J35502_11109291 JGI24699J35502_111092913 297
177 3300005485 Ga0074263_110455 Ga0074263_1104556 297
178 3300009784 Ga0123357_10005733 Ga0123357_100057337 297
179 3300009784 Ga0123357_10438849 Ga0123357_104388491 297
180 3300010049 Ga0123356_10014268 Ga0123356_100142683 297
181 3300010049 Ga0123356_10506557 Ga0123356_105065572 297
182 3300010167 Ga0123353_11191186 Ga0123353_111911861 297
183 3300042612 Ga0466705_510487 Ga0466705_510487_2011_2904 297
184 3300042648 Ga0466709_254776 Ga0466709_254776_153_1064 297
185 3300042618 Ga0466723_052242 Ga0466723_052242_5284_6180 298
186 3300042618 Ga0466723_091159 Ga0466723_091159_3604_4518 298
187 3300042623 Ga0466734_047717 Ga0466734_047717_48_944 298
188 3300010049 Ga0123356_10121841 Ga0123356_101218411 299
189 3300010167 Ga0123353_10816551 Ga0123353_108165511 299
190 3300042619 Ga0466726_227272 Ga0466726_227272_478_1377 299
191 3300042659 Ga0466733_063506 Ga0466733_063506_519_1418 299
192 3300042616 Ga0466715_559060 Ga0466715_559060_397_1326 303
193 3300042593 Ga0466691_140235 Ga0466691_140235_4199_5113 304
194 3300042618 Ga0466723_075462 Ga0466723_075462_7052_7966 304
195 3300042593 Ga0466691_022054 Ga0466691_022054_2404_3324 306
196 3300042593 Ga0466691_139147 Ga0466691_139147_6607_7596 329
197 3300042652 Ga0466708_300694 Ga0466708_300694_7389_8384 331

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02653 BPD_transp_2 Branched-chain amino acid transport system / permease component 42 315 0.87

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.78 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.