Protein Family IF09962

Metagenome Isolate
196 Members
62 Samples
180 Scaffolds
357.07 Avg Length

🧬 Representative Sequence

ID
3300042652|Ga0466708_295393|Ga0466708_295393_135_1388
Length
417 aa
Sequence
MKSQISGNGRLPGTTPQKTKNYSINSAVFPKPAGNRAFLFSFFPDIIKRYEKLVPACPGGFILMASASFFSDMLDSRFTPWADLDLSKTGKFLVISDFHMGGGRGDDLEYNGPLLCALLEQRYLEEGWHLVLHGDIEALQKYSLESIRSRWQNLYRIFDLFAAQNRFCKILGNHDETLVFEKGYPYPLYNVVRVETAFIPMYIYHGHQASRIYTNFNHLLRLSARYFLRPFGIHNISSYRNPYRRFYVEKQAYAFSLRNNCISIIGHTHRPLFESLGRFDYIKFEIERLCRDYPSAMPADQARIREEVRALRADLGKLKRSERRDVLRQSLYGDEIPVPCLFNSGCAIGRMGVYALEVDRETISLVYWFTEGAARKFINRGWYSIEELPGTRHRRVVLNRDRLDYIQARIELLGTPE

📊 Sample Types

Isolate 8.2%
Metagenome 91.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 35.0%
Unclassified 31.7%
Kalotermitidae 23.3%
Termopsidae 5.0%
Rhinotermitidae 3.3%
Hodotermitidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 190
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
2 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
3 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
4 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
5 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
6 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
7 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
8 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
9 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
10 2781125685 Treponema sp. Lab288P1bin13 Isolate Unclassified
11 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
12 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
13 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
14 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
15 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
16 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
17 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
18 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
19 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
20 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
21 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
22 2820027804 Unclassified Spirochaetes Lab288P1bin105 Isolate Unclassified
23 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
24 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
25 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
26 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
27 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
28 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
29 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
30 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
31 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
32 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
33 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
34 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
35 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
36 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
37 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
38 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
39 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
40 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
41 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
42 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
43 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
44 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
45 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
46 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
47 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
48 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
49 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
50 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
51 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
52 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
53 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
54 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
55 2820023741 Unclassified Spirochaetes Lab288P3bin165 Isolate Unclassified
56 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
57 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
58 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
59 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
60 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
61 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
62 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_189835 3300042612 Bacteria 4916
2 Ga0466705_266113 3300042612 Bacteria 67009
3 Ga0466713_140180 3300042602 Unclassified 1840
4 Ga0466716_087643 3300042605 Bacteria 24320
5 Ga0466719_005782 3300042606 Unclassified 1581
6 Ga0466720_238860 3300042607 Bacteria 102895
7 Ga0466698_046877 3300042610 Bacteria 1418
8 JGI24695J34938_10007766 3300002450 Bacteria 6215
9 Ga0068305_10292446 3300005083 Bacteria 9961
10 Ga0072941_1102666 3300005201 Bacteria 5625
11 Ga0466712_206303 3300042614 Bacteria 3438
12 Ga0466715_214768 3300042616 Bacteria 3836
13 Ga0466723_142627 3300042618 Bacteria 9330
14 Ga0466726_479512 3300042619 Bacteria 2890
15 Ga0466728_126320 3300042620 Bacteria 1684
16 Ga0123355_10091776 3300009826 Bacteria 4813
17 Ga0466690_040531 3300042590 Bacteria 13360
18 Ga0466692_077321 3300042591 Bacteria 4189
19 Ga0466691_155398 3300042593 Bacteria 2147
20 Ga0466691_158049 3300042593 Bacteria 1318
21 Ga0466699_030228 3300042597 Bacteria 5852
22 Ga0466699_102561 3300042597 Bacteria 8395
23 Ga0466699_253585 3300042597 Unclassified 1137
24 Ga0466708_167010 3300042652 Bacteria 9765
25 Ga0466727_322355 3300042655 Bacteria 20773
26 Ga0466733_018340 3300042659 Bacteria 1562
27 Ga0466733_141867 3300042659 Bacteria 123412
28 Ga0466707_344354 3300042601 Bacteria 15444
29 Ga0466722_064604 3300042609 Bacteria 35013
30 Ga0466698_093850 3300042610 Bacteria 4252
31 JGI24698J34947_10014926 3300002449 Bacteria 4229
32 JGI24698J34947_10096231 3300002449 Bacteria 1343
33 JGI24695J34938_10002857 3300002450 Bacteria 12586
34 JGI24695J34938_10008874 3300002450 Bacteria 5679
35 Ga0466712_022445 3300042614 Bacteria 9404
36 Ga0466715_214745 3300042616 Bacteria 4451
37 Ga0466718_071922 3300042617 Bacteria 2930
38 Ga0466726_355133 3300042619 Bacteria 2046
39 Ga0466726_387900 3300042619 Bacteria 4086
40 Ga0123356_10007825 3300010049 Bacteria 10645
41 Ga0123353_10013914 3300010167 Bacteria 11565
42 Ga0466690_052620 3300042590 Bacteria 10154
43 Ga0466693_435930 3300042592 Bacteria 1309
44 Ga0466694_383358 3300042594 Bacteria 7563
45 Ga0466695_093378 3300042595 Bacteria 14476
46 Ga0466699_251864 3300042597 Bacteria 59491
47 Ga0466699_363141 3300042597 Bacteria 4692
48 Ga0466703_124672 3300042636 Bacteria 11654
49 Ga0466703_350923 3300042636 Bacteria 2201
50 Ga0466704_103552 3300042643 Bacteria 2852
51 Ga0466704_313215 3300042643 Bacteria 29544
52 Ga0466708_370495 3300042652 Bacteria 4874
53 Ga0466708_394234 3300042652 Bacteria 4475
54 Ga0466727_262225 3300042655 Unclassified 2194
55 Ga0466733_117030 3300042659 Bacteria 1659
56 Ga0466722_015000 3300042609 Bacteria 11154
57 Ga0466722_015416 3300042609 Bacteria 6021
58 Ga0466722_055765 3300042609 Bacteria 9262
59 Ga0466722_180837 3300042609 Bacteria 11935
60 AustNasuHG_c1002674 3300000089 Bacteria 6441
61 AustNasuHG_c1008661 3300000089 Unclassified 3599
62 JGI24698J34947_10005147 3300002449 Bacteria 7164
63 JGI24695J34938_10032224 3300002450 Bacteria 2423
64 JGI24695J34938_10044749 3300002450 Bacteria 1967
65 Ga0072940_1047586 3300005200 Bacteria 2070
66 Ga0072941_1024765 3300005201 Bacteria 6926
67 Ga0466718_133077 3300042617 Bacteria 67767
68 Ga0466723_005863 3300042618 Bacteria 10321
69 Ga0466728_014175 3300042620 Bacteria 3271
70 Ga0123356_10004686 3300010049 Bacteria 14080
71 Ga0466692_201539 3300042591 Bacteria 3509
72 Ga0466694_169580 3300042594 Bacteria 12464
73 Ga0466699_026652 3300042597 Bacteria 5858
74 Ga0466699_085186 3300042597 Bacteria 1981
75 Ga0466699_374794 3300042597 Bacteria 4977
76 Ga0466704_140178 3300042643 Bacteria 60046
77 Ga0466709_027715 3300042648 Bacteria 1617
78 Ga0466708_295393 3300042652 Bacteria 2240
79 Ga0466732_382113 3300042656 Bacteria 18383
80 Ga0466706_099739 3300042599 Bacteria 2067
81 Ga0466707_021408 3300042601 Bacteria 2379
82 Ga0466720_053201 3300042607 Bacteria 23315
83 Ga0466722_082350 3300042609 Bacteria 4775
84 Ga0466722_166454 3300042609 Bacteria 10490
85 JGI24698J34947_10103307 3300002449 Bacteria 1275
86 JGI24695J34938_10000016 3300002450 Bacteria 116336
87 JGI24695J34938_10007782 3300002450 Bacteria 6209
88 Ga0466705_392962 3300042612 Bacteria 2951
89 Ga0466712_220252 3300042614 Bacteria 7552
90 Ga0466712_276900 3300042614 Bacteria 27524
91 Ga0466711_159473 3300042615 Bacteria 7483
92 Ga0466715_417255 3300042616 Bacteria 7156
93 Ga0123356_10016074 3300010049 Bacteria 7152
94 Ga0123354_10021106 3300010882 Bacteria 10261
95 Ga0466692_039053 3300042591 Bacteria 10267
96 Ga0466694_086094 3300042594 Bacteria 23416
97 Ga0466694_139847 3300042594 Bacteria 19575
98 Ga0466699_170788 3300042597 Bacteria 3429
99 Ga0466699_263505 3300042597 Bacteria 10346
100 Ga0466731_436042 3300042622 Bacteria 4555
101 Ga0466698_051275 3300042610 Unclassified 1591
102 AustNasuHG_c1011202 3300000089 Bacteria 3110
103 JGI24698J34947_10007930 3300002449 Bacteria 5832
104 JGI24698J34947_10027503 3300002449 Bacteria 3017
105 JGI24698J34947_10048742 3300002449 Bacteria 2143
106 JGI24695J34938_10000031 3300002450 Bacteria 105176
107 JGI24695J34938_10074658 3300002450 Bacteria 1410
108 Ga0072941_1028887 3300005201 Bacteria 19122
109 Ga0466712_105809 3300042614 Bacteria 6592
110 Ga0466712_222354 3300042614 Bacteria 29962
111 Ga0466726_346823 3300042619 Bacteria 2623
112 Ga0123355_10134478 3300009826 Bacteria 3800
113 Ga0123356_10026020 3300010049 Bacteria 5500
114 Ga0123353_10002009 3300010167 Bacteria 25145
115 Ga0123353_10180994 3300010167 Bacteria 3337
116 Ga0415639_042883 3300038395 Bacteria 9963
117 Ga0466692_000048 3300042591 Bacteria 8574
118 Ga0466694_080957 3300042594 Bacteria 3050
119 Ga0466694_112678 3300042594 Bacteria 1668
120 Ga0466699_257644 3300042597 Bacteria 9755
121 Ga0466703_241216 3300042636 Bacteria 2620
122 Ga0466704_242622 3300042643 Bacteria 1773
123 Ga0466704_373248 3300042643 Bacteria 4882
124 Ga0466727_057285 3300042655 Bacteria 9296
125 Ga0466722_070642 3300042609 Bacteria 1629
126 AustNasuHG_c1012664 3300000089 Bacteria 2909
127 Ga0466715_328830 3300042616 Bacteria 30843
128 Ga0466715_475280 3300042616 Bacteria 3382
129 Ga0466726_466276 3300042619 Bacteria 2267
130 Ga0466728_215584 3300042620 Bacteria 35980
131 Ga0123356_10000264 3300010049 Bacteria 60568
132 Ga0123356_10001628 3300010049 Bacteria 24648
133 Ga0466696_040882 3300042596 Bacteria 10782
134 Ga0466696_172318 3300042596 Bacteria 1691
135 Ga0466699_003210 3300042597 Bacteria 2011
136 Ga0466704_131011 3300042643 Bacteria 7065
137 Ga0466708_220073 3300042652 Bacteria 4928
138 Ga0466707_386706 3300042601 Bacteria 3165
139 Ga0466716_151056 3300042605 Bacteria 2363
140 Ga0466719_528823 3300042606 Bacteria 4466
141 Ga0466722_174543 3300042609 Bacteria 6793
142 Ga0466722_230071 3300042609 Bacteria 9442
143 JGI24695J34938_10000012 3300002450 Bacteria 126955
144 JGI24695J34938_10040666 3300002450 Bacteria 2092
145 JGI24695J34938_10071912 3300002450 Bacteria 1444
146 Ga0466718_040599 3300042617 Bacteria 11063
147 Ga0466723_181730 3300042618 Bacteria 2332
148 Ga0466723_257819 3300042618 Bacteria 13810
149 Ga0466726_008193 3300042619 Bacteria 2323
150 Ga0466726_310394 3300042619 Bacteria 1440
151 Ga0123356_10495627 3300010049 Bacteria 1377
152 Ga0123353_10115147 3300010167 Bacteria 4328
153 Ga0264413_133412 3300024493 Bacteria 1443
154 Ga0415639_000455 3300038395 Bacteria 14447
155 Ga0415639_012800 3300038395 Bacteria 1477
156 Ga0466691_014189 3300042593 Bacteria 5105
157 Ga0466691_055505 3300042593 Bacteria 18967
158 Ga0466699_117413 3300042597 Bacteria 2159
159 Ga0466735_112516 3300042624 Bacteria 2494
160 Ga0466703_049913 3300042636 Bacteria 15746
161 Ga0466709_258556 3300042648 Bacteria 37873
162 Ga0466708_041843 3300042652 Bacteria 23218
163 Ga0466708_334651 3300042652 Bacteria 78030
164 Ga0466705_087237 3300042612 Bacteria 2251
165 Ga0466732_300817 3300042656 Bacteria 1458
166 Ga0466706_209677 3300042599 Bacteria 1338
167 Ga0466716_123592 3300042605 Bacteria 1915
168 JGI24698J34947_10001101 3300002449 Bacteria 13934
169 JGI24698J34947_10108211 3300002449 Bacteria 1233
170 JGI24695J34938_10013961 3300002450 Bacteria 4192
171 Ga0466712_067748 3300042614 Bacteria 5000
172 Ga0466711_058612 3300042615 Bacteria 1915
173 Ga0466723_023395 3300042618 Bacteria 2917
174 Ga0123353_10000346 3300010167 Bacteria 56678
175 Ga0415639_149081 3300038395 Bacteria 1899
176 Ga0466690_120581 3300042590 Bacteria 5384
177 Ga0466693_157196 3300042592 Bacteria 53244
178 Ga0466699_289164 3300042597 Bacteria 9734
179 Ga0466702_332782 3300042635 Bacteria 6987
180 Ga0466704_051511 3300042643 Bacteria 2347

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042614 Ga0466712_022445 Ga0466712_022445_46_963 305
2 3300042602 Ga0466713_140180 Ga0466713_140180_824_1771 315
3 3300042597 Ga0466699_253585 Ga0466699_253585_106_1059 317
4 3300042610 Ga0466698_051275 Ga0466698_051275_616_1569 317
5 3300002449 JGI24698J34947_10096231 JGI24698J34947_100962311 320
6 3300002450 JGI24695J34938_10007766 JGI24695J34938_100077667 326
7 iso_pr_bacteria 2781125688 2781422662 335
8 3300042659 Ga0466733_018340 Ga0466733_018340_268_1332 337
9 3300042591 Ga0466692_201539 Ga0466692_201539_713_1741 342
10 3300042591 Ga0466692_039053 Ga0466692_039053_7829_8863 344
11 3300042656 Ga0466732_382113 Ga0466732_382113_6156_7226 345
12 3300042610 Ga0466698_093850 Ga0466698_093850_3017_4057 346
13 3300042620 Ga0466728_014175 Ga0466728_014175_1610_2680 346
14 3300042620 Ga0466728_215584 Ga0466728_215584_4431_5471 346
15 3300005201 Ga0072941_1102666 Ga0072941_11026661 347
16 3300042624 Ga0466735_112516 Ga0466735_112516_1272_2315 347
17 3300042595 Ga0466695_093378 Ga0466695_093378_5756_6808 350
18 3300042597 Ga0466699_170788 Ga0466699_170788_1796_2851 351
19 3300042606 Ga0466719_528823 Ga0466719_528823_495_1550 351
20 3300042609 Ga0466722_015000 Ga0466722_015000_8581_9636 351
21 3300042609 Ga0466722_055765 Ga0466722_055765_4122_5177 351
22 3300042609 Ga0466722_230071 Ga0466722_230071_4341_5396 351
23 3300042612 Ga0466705_189835 Ga0466705_189835_1607_2662 351
24 3300042619 Ga0466726_310394 Ga0466726_310394_342_1397 351
25 3300042619 Ga0466726_466276 Ga0466726_466276_945_2000 351
26 3300042643 Ga0466704_131011 Ga0466704_131011_761_1816 351
27 3300038395 Ga0415639_012800 Ga0415639_012800_400_1458 352
28 3300042596 Ga0466696_040882 Ga0466696_040882_9432_10490 352
29 3300042605 Ga0466716_087643 Ga0466716_087643_14518_15576 352
30 3300042606 Ga0466719_005782 Ga0466719_005782_176_1234 352
31 3300042615 Ga0466711_058612 Ga0466711_058612_397_1455 352
32 3300042618 Ga0466723_023395 Ga0466723_023395_76_1134 352
33 3300042618 Ga0466723_257819 Ga0466723_257819_422_1480 352
34 3300042643 Ga0466704_242622 Ga0466704_242622_394_1452 352
35 3300042643 Ga0466704_313215 Ga0466704_313215_26593_27651 352
36 iso_pr_bacteria 2781125656 2781321557 352
37 iso_pr_bacteria 2781125693 2781432913 352
38 3300000089 AustNasuHG_c1002674 AustNasuHG_10026748 353
39 3300002450 JGI24695J34938_10000031 JGI24695J34938_1000003130 353
40 3300009826 Ga0123355_10091776 Ga0123355_100917768 353
41 3300010167 Ga0123353_10180994 Ga0123353_101809941 353
42 3300042594 Ga0466694_080957 Ga0466694_080957_1629_2690 353
43 3300042597 Ga0466699_003210 Ga0466699_003210_97_1158 353
44 3300042597 Ga0466699_026652 Ga0466699_026652_85_1146 353
45 3300042597 Ga0466699_030228 Ga0466699_030228_85_1146 353
46 3300042597 Ga0466699_257644 Ga0466699_257644_8598_9659 353
47 3300042601 Ga0466707_386706 Ga0466707_386706_57_1118 353
48 3300042609 Ga0466722_070642 Ga0466722_070642_210_1271 353
49 3300042616 Ga0466715_475280 Ga0466715_475280_2116_3177 353
50 3300042622 Ga0466731_436042 Ga0466731_436042_2757_3818 353
51 3300042643 Ga0466704_051511 Ga0466704_051511_639_1700 353
52 iso_pr_bacteria 2781125633 2781272325 353
53 iso_pr_bacteria 2781125640 2781288424 353
54 3300002450 JGI24695J34938_10044749 JGI24695J34938_100447492 354
55 3300010167 Ga0123353_10002009 Ga0123353_100020096 354
56 3300038395 Ga0415639_149081 Ga0415639_149081_816_1880 354
57 3300042592 Ga0466693_435930 Ga0466693_435930_183_1247 354
58 3300042597 Ga0466699_085186 Ga0466699_085186_313_1377 354
59 3300042597 Ga0466699_102561 Ga0466699_102561_804_1868 354
60 3300042597 Ga0466699_263505 Ga0466699_263505_3418_4482 354
61 3300042597 Ga0466699_289164 Ga0466699_289164_1681_2745 354
62 3300042597 Ga0466699_363141 Ga0466699_363141_1322_2386 354
63 3300042597 Ga0466699_374794 Ga0466699_374794_493_1557 354
64 3300042607 Ga0466720_053201 Ga0466720_053201_2240_3304 354
65 3300042614 Ga0466712_276900 Ga0466712_276900_17520_18584 354
66 3300042619 Ga0466726_008193 Ga0466726_008193_258_1322 354
67 3300042652 Ga0466708_334651 Ga0466708_334651_16676_17740 354
68 3300042655 Ga0466727_057285 Ga0466727_057285_4851_5915 354
69 iso_pr_bacteria 2781125634 2781274110 354
70 iso_pr_bacteria 2781125646 2781300296 354
71 3300002450 JGI24695J34938_10000016 JGI24695J34938_10000016103 355
72 3300005083 Ga0068305_10292446 Ga0068305_102924462 355
73 3300010049 Ga0123356_10026020 Ga0123356_100260202 355
74 3300010882 Ga0123354_10021106 Ga0123354_100211061 355
75 3300042594 Ga0466694_086094 Ga0466694_086094_17101_18168 355
76 3300042594 Ga0466694_139847 Ga0466694_139847_18433_19500 355
77 3300042594 Ga0466694_169580 Ga0466694_169580_11322_12389 355
78 3300042594 Ga0466694_383358 Ga0466694_383358_4564_5631 355
79 3300042597 Ga0466699_117413 Ga0466699_117413_112_1179 355
80 3300042599 Ga0466706_209677 Ga0466706_209677_22_1089 355
81 3300042601 Ga0466707_021408 Ga0466707_021408_879_1946 355
82 3300042601 Ga0466707_344354 Ga0466707_344354_12392_13459 355
83 3300042607 Ga0466720_238860 Ga0466720_238860_57184_58251 355
84 3300042610 Ga0466698_046877 Ga0466698_046877_32_1099 355
85 3300042614 Ga0466712_067748 Ga0466712_067748_2910_3977 355
86 3300042614 Ga0466712_206303 Ga0466712_206303_79_1146 355
87 3300042614 Ga0466712_222354 Ga0466712_222354_7304_8371 355
88 3300042616 Ga0466715_328830 Ga0466715_328830_22857_23924 355
89 3300042617 Ga0466718_040599 Ga0466718_040599_8262_9329 355
90 3300042619 Ga0466726_479512 Ga0466726_479512_774_1841 355
91 3300042648 Ga0466709_027715 Ga0466709_027715_185_1252 355
92 iso_pr_bacteria 2781125658 2781325325 355
93 3300002449 JGI24698J34947_10007930 JGI24698J34947_100079307 356
94 3300002449 JGI24698J34947_10014926 JGI24698J34947_100149266 356
95 3300002449 JGI24698J34947_10027503 JGI24698J34947_100275033 356
96 3300002449 JGI24698J34947_10048742 JGI24698J34947_100487421 356
97 3300002449 JGI24698J34947_10103307 JGI24698J34947_101033072 356
98 3300002449 JGI24698J34947_10108211 JGI24698J34947_101082112 356
99 3300002450 JGI24695J34938_10002857 JGI24695J34938_1000285712 356
100 3300002450 JGI24695J34938_10071912 JGI24695J34938_100719121 356
101 3300005201 Ga0072941_1028887 Ga0072941_102888710 356
102 3300010049 Ga0123356_10000264 Ga0123356_1000026451 356
103 3300010049 Ga0123356_10001628 Ga0123356_100016283 356
104 3300010049 Ga0123356_10016074 Ga0123356_100160742 356
105 3300024493 Ga0264413_133412 Ga0264413_1334122 356
106 3300042590 Ga0466690_052620 Ga0466690_052620_843_1913 356
107 3300042592 Ga0466693_157196 Ga0466693_157196_12968_14038 356
108 3300042593 Ga0466691_055505 Ga0466691_055505_11709_12779 356
109 3300042605 Ga0466716_123592 Ga0466716_123592_173_1243 356
110 3300042609 Ga0466722_174543 Ga0466722_174543_232_1302 356
111 3300042612 Ga0466705_266113 Ga0466705_266113_396_1466 356
112 3300042614 Ga0466712_105809 Ga0466712_105809_2853_3923 356
113 3300042614 Ga0466712_220252 Ga0466712_220252_2652_3722 356
114 3300042617 Ga0466718_071922 Ga0466718_071922_1684_2754 356
115 3300042618 Ga0466723_005863 Ga0466723_005863_5918_6988 356
116 3300042619 Ga0466726_346823 Ga0466726_346823_770_1840 356
117 3300042635 Ga0466702_332782 Ga0466702_332782_2148_3218 356
118 3300042643 Ga0466704_140178 Ga0466704_140178_58766_59836 356
119 iso_pr_bacteria 2781125643 2781293888 356
120 3300000089 AustNasuHG_c1011202 AustNasuHG_10112023 357
121 3300002450 JGI24695J34938_10007782 JGI24695J34938_100077825 357
122 3300005201 Ga0072941_1024765 Ga0072941_10247653 357
123 3300010049 Ga0123356_10004686 Ga0123356_1000468613 357
124 3300010167 Ga0123353_10115147 Ga0123353_101151472 357
125 3300042597 Ga0466699_251864 Ga0466699_251864_48144_49217 357
126 3300042609 Ga0466722_015416 Ga0466722_015416_2635_3708 357
127 3300042655 Ga0466727_262225 Ga0466727_262225_456_1529 357
128 3300042659 Ga0466733_117030 Ga0466733_117030_523_1596 357
129 3300000089 AustNasuHG_c1008661 AustNasuHG_10086613 358
130 3300000089 AustNasuHG_c1012664 AustNasuHG_10126643 358
131 3300002450 JGI24695J34938_10008874 JGI24695J34938_100088747 358
132 3300002450 JGI24695J34938_10013961 JGI24695J34938_100139613 358
133 3300010049 Ga0123356_10007825 Ga0123356_100078255 358
134 3300010049 Ga0123356_10495627 Ga0123356_104956272 358
135 3300038395 Ga0415639_000455 Ga0415639_000455_3634_4710 358
136 3300042593 Ga0466691_155398 Ga0466691_155398_576_1652 358
137 3300042609 Ga0466722_064604 Ga0466722_064604_182_1258 358
138 3300042612 Ga0466705_087237 Ga0466705_087237_209_1285 358
139 3300042636 Ga0466703_124672 Ga0466703_124672_6143_7219 358
140 3300042643 Ga0466704_373248 Ga0466704_373248_3503_4579 358
141 3300042655 Ga0466727_322355 Ga0466727_322355_5285_6361 358
142 iso_pr_bacteria 2781125641 2781290787 358
143 3300042618 Ga0466723_142627 Ga0466723_142627_14_1093 359
144 3300042656 Ga0466732_300817 Ga0466732_300817_331_1440 359
145 3300002450 JGI24695J34938_10040666 JGI24695J34938_100406661 360
146 3300005200 Ga0072940_1047586 Ga0072940_10475862 360
147 3300042659 Ga0466733_141867 Ga0466733_141867_105954_107036 360
148 iso_pr_bacteria 2781125661 2781332143 360
149 3300002449 JGI24698J34947_10005147 JGI24698J34947_100051472 361
150 3300009826 Ga0123355_10134478 Ga0123355_101344784 361
151 3300042652 Ga0466708_370495 Ga0466708_370495_3763_4848 361
152 3300042652 Ga0466708_394234 Ga0466708_394234_224_1309 361
153 3300042609 Ga0466722_166454 Ga0466722_166454_2618_3706 362
154 3300042612 Ga0466705_392962 Ga0466705_392962_1832_2920 362
155 3300042615 Ga0466711_159473 Ga0466711_159473_5270_6358 362
156 3300042619 Ga0466726_387900 Ga0466726_387900_692_1780 362
157 3300042636 Ga0466703_241216 Ga0466703_241216_579_1667 362
158 iso_pr_bacteria 2781125635 2781277094 362
159 iso_pr_bacteria 2781125645 2781297605 362
160 3300002449 JGI24698J34947_10001101 JGI24698J34947_1000110113 363
161 3300038395 Ga0415639_042883 Ga0415639_042883_8434_9525 363
162 3300042599 Ga0466706_099739 Ga0466706_099739_72_1163 363
163 3300042617 Ga0466718_133077 Ga0466718_133077_59495_60586 363
164 3300042643 Ga0466704_103552 Ga0466704_103552_875_1966 363
165 3300010167 Ga0123353_10000346 Ga0123353_100003463 364
166 3300042593 Ga0466691_014189 Ga0466691_014189_1193_2287 364
167 3300042594 Ga0466694_112678 Ga0466694_112678_164_1258 364
168 3300042618 Ga0466723_181730 Ga0466723_181730_929_2023 364
169 3300042636 Ga0466703_049913 Ga0466703_049913_14096_15190 364
170 3300042636 Ga0466703_350923 Ga0466703_350923_208_1302 364
171 3300042648 Ga0466709_258556 Ga0466709_258556_9729_10823 364
172 3300042652 Ga0466708_041843 Ga0466708_041843_822_1916 364
173 3300042591 Ga0466692_077321 Ga0466692_077321_2949_4049 366
174 3300042616 Ga0466715_214768 Ga0466715_214768_2437_3537 366
175 iso_pr_bacteria 2781125685 2781416668 366
176 3300042590 Ga0466690_120581 Ga0466690_120581_3489_4592 367
177 3300042593 Ga0466691_158049 Ga0466691_158049_54_1157 367
178 3300042616 Ga0466715_214745 Ga0466715_214745_1478_2581 367
179 3300010167 Ga0123353_10013914 Ga0123353_100139143 368
180 3300042616 Ga0466715_417255 Ga0466715_417255_957_2063 368
181 iso_pr_bacteria 2820023741 2820024050 368
182 3300002450 JGI24695J34938_10000012 JGI24695J34938_10000012110 369
183 3300002450 JGI24695J34938_10032224 JGI24695J34938_100322243 369
184 3300042605 Ga0466716_151056 Ga0466716_151056_1048_2157 369
185 3300042609 Ga0466722_082350 Ga0466722_082350_1919_3034 371
186 3300002450 JGI24695J34938_10074658 JGI24695J34938_100746581 379
187 3300042590 Ga0466690_040531 Ga0466690_040531_2769_3911 380
188 3300042620 Ga0466728_126320 Ga0466728_126320_295_1437 380
189 3300042591 Ga0466692_000048 Ga0466692_000048_1096_2244 382
190 3300042609 Ga0466722_180837 Ga0466722_180837_5022_6170 382
191 3300042652 Ga0466708_220073 Ga0466708_220073_3313_4494 384
192 iso_pr_bacteria 2820027804 2820029755 388
193 3300042652 Ga0466708_167010 Ga0466708_167010_913_2091 392
194 3300042596 Ga0466696_172318 Ga0466696_172318_24_1256 410
195 3300042652 Ga0466708_295393 Ga0466708_295393_135_1388 417
196 3300042619 Ga0466726_355133 Ga0466726_355133_774_2030 418

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.74 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.