Protein Family IF09956

Metagenome Isolate
116 Members
33 Samples
112 Scaffolds
381.43 Avg Length

🧬 Representative Sequence

ID
3300042652|Ga0466708_281187|Ga0466708_281187_307_1638
Length
430 aa
Sequence
MKRYANPAGPGFFFIKVKAGIHGGTETGTKKAAAAAEAGMKKLRFFISGEVQSETPQPEGGRETRRDFFVALVSFLLTVLFFIIPTGFEGASQTAGGERARGYVTEVNNERIINAGPVKQGEQQLEVEIRSGRFKGQVFSGSNNLMGKIELDKIFAPGDSVLVVISVSEEGGIRHAQVYDHYRTGKTIMGWMGVKIVISFVFTAAALIRVLFPAMLRGWDPIFASVILVTILTAVIIFLVGGITRRGLTAFAGSMGGVLLTSCLAFFFTWWFKIHGAVRPFAEALLYSGYTHLNLVHLFISGIFLASSGAMMDLSMDIASAMDEIKKQYPAISRLNLIKSGVSVSRHVAGTMSTTLLLAYSAEYTAMIMTFIAQGIPLENVINMVWVSSEVVHTLVGCFGLVLVAPLTVFAGGIILGGSGKTARKNEQPG

πŸ“Š Sample Types

Isolate 3.5%
Metagenome 96.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Kalotermitidae 43.8%
Termitidae 34.4%
Unclassified 12.5%
Rhinotermitidae 9.4%

🌳 Taxonomy

Archaea 1
Bacteria 111
Eukaryota 0
Viruses 0
Unclassified 4

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
4 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
5 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
6 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
7 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
8 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
9 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
10 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
11 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
12 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
13 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
14 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
15 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
16 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
17 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
18 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
19 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
20 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
21 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
22 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
23 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
24 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
25 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
26 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
27 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
28 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
29 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
30 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
31 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
32 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
33 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466719_022465 3300042606 Bacteria 3771
2 Ga0466711_382308 3300042615 Bacteria 7496
3 Ga0466723_164847 3300042618 Bacteria 38657
4 Ga0466702_053883 3300042635 Bacteria 4773
5 Ga0466693_323139 3300042592 Bacteria 2327
6 Ga0466695_295531 3300042595 Bacteria 145433
7 Ga0466696_193499 3300042596 Bacteria 6813
8 Ga0466696_477753 3300042596 Bacteria 2743
9 Ga0466699_142749 3300042597 Bacteria 2918
10 JGI24695J34938_10000042 3300002450 Bacteria 95222
11 Ga0466711_318694 3300042615 Bacteria 4693
12 Ga0466704_385875 3300042643 Unclassified 1773
13 Ga0466709_015811 3300042648 Bacteria 9178
14 Ga0466709_142732 3300042648 Bacteria 4752
15 Ga0466709_361519 3300042648 Bacteria 14108
16 Ga0466708_281187 3300042652 Bacteria 2062
17 Ga0123353_10149268 3300010167 Bacteria 3734
18 Ga0466690_031134 3300042590 Bacteria 2357
19 Ga0466691_024570 3300042593 Bacteria 8679
20 JGI24695J34938_10001294 3300002450 Bacteria 21934
21 JGI24695J34938_10006669 3300002450 Unclassified 6881
22 Ga0466716_192667 3300042605 Bacteria 5195
23 Ga0466716_266539 3300042605 Bacteria 1462
24 Ga0466705_436590 3300042612 Bacteria 7500
25 Ga0466715_061201 3300042616 Bacteria 4930
26 Ga0466704_189681 3300042643 Bacteria 5067
27 Ga0466708_072135 3300042652 Bacteria 3130
28 Ga0466708_227258 3300042652 Bacteria 10072
29 Ga0466690_144009 3300042590 Bacteria 13365
30 Ga0466692_020331 3300042591 Bacteria 7565
31 Ga0466691_091123 3300042593 Bacteria 8604
32 Ga0466699_124356 3300042597 Bacteria 6321
33 Ga0466699_176601 3300042597 Bacteria 3549
34 Ga0466699_208229 3300042597 Bacteria 1490
35 Ga0466699_398393 3300042597 Bacteria 23102
36 AustNasuHG_c1003648 3300000089 Bacteria 5552
37 JGI24698J34947_10029226 3300002449 Bacteria 2912
38 Ga0466719_372197 3300042606 Bacteria 5816
39 Ga0466711_013326 3300042615 Bacteria 11577
40 Ga0466728_067704 3300042620 Archaea 2701
41 Ga0466702_290462 3300042635 Bacteria 7762
42 Ga0466704_503977 3300042643 Bacteria 51073
43 Ga0466690_095451 3300042590 Bacteria 2510
44 Ga0466705_144653 3300042612 Bacteria 18156
45 AustNasuHG_c1000131 3300000089 Bacteria 23214
46 AustNasuHG_c1002102 3300000089 Bacteria 7196
47 AustNasuHG_c1035701 3300000089 Bacteria 1305
48 JGI24698J34947_10004147 3300002449 Bacteria 7864
49 JGI24695J34938_10001263 3300002450 Bacteria 22240
50 JGI24695J34938_10002702 3300002450 Bacteria 13143
51 Ga0466716_289672 3300042605 Bacteria 4744
52 Ga0466720_111533 3300042607 Bacteria 18124
53 Ga0466722_063243 3300042609 Bacteria 3545
54 Ga0466711_007794 3300042615 Bacteria 6950
55 Ga0466718_063950 3300042617 Bacteria 2017
56 Ga0466723_312578 3300042618 Bacteria 13019
57 Ga0123353_10231327 3300010167 Bacteria 2882
58 Ga0466692_035547 3300042591 Bacteria 24918
59 Ga0466691_007012 3300042593 Bacteria 4570
60 Ga0466691_048291 3300042593 Bacteria 7484
61 Ga0466691_188926 3300042593 Bacteria 3874
62 Ga0466699_351348 3300042597 Bacteria 43572
63 Ga0466705_318593 3300042612 Bacteria 4450
64 JGI24695J34938_10000093 3300002450 Bacteria 78486
65 JGI24695J34938_10004974 3300002450 Bacteria 8482
66 Ga0466719_053774 3300042606 Bacteria 1834
67 Ga0466711_151136 3300042615 Bacteria 1833
68 Ga0466711_251718 3300042615 Bacteria 2787
69 Ga0466715_014467 3300042616 Bacteria 2474
70 Ga0466723_243688 3300042618 Bacteria 83097
71 Ga0466703_161480 3300042636 Bacteria 28463
72 Ga0466704_210075 3300042643 Bacteria 3828
73 Ga0466704_344209 3300042643 Bacteria 13864
74 Ga0466709_415780 3300042648 Bacteria 9895
75 Ga0466693_434569 3300042592 Bacteria 2947
76 Ga0466691_008800 3300042593 Bacteria 15279
77 Ga0466699_034177 3300042597 Bacteria 7973
78 Ga0466699_308444 3300042597 Bacteria 2164
79 AustNasuHG_c1001303 3300000089 Bacteria 8950
80 JGI24695J34938_10006571 3300002450 Bacteria 6947
81 Ga0072941_1078707 3300005201 Bacteria 8824
82 Ga0466716_044054 3300042605 Bacteria 3673
83 Ga0466719_378020 3300042606 Bacteria 4470
84 Ga0466711_126144 3300042615 Bacteria 4612
85 Ga0466718_071945 3300042617 Bacteria 3059
86 Ga0466723_328702 3300042618 Bacteria 7909
87 Ga0466728_009282 3300042620 Bacteria 21850
88 Ga0466728_121493 3300042620 Unclassified 1578
89 Ga0466703_029976 3300042636 Bacteria 24131
90 Ga0466709_040405 3300042648 Bacteria 15003
91 Ga0466709_042450 3300042648 Bacteria 1163
92 Ga0466708_094298 3300042652 Bacteria 34608
93 Ga0466708_328999 3300042652 Bacteria 34433
94 Ga0466690_326029 3300042590 Bacteria 3259
95 Ga0466691_025943 3300042593 Bacteria 16864
96 Ga0466696_026430 3300042596 Bacteria 6209
97 Ga0466699_070933 3300042597 Bacteria 1701
98 Ga0466705_006708 3300042612 Bacteria 1585
99 AustNasuHG_c1012835 3300000089 Unclassified 2885
100 JGI24695J34938_10004707 3300002450 Bacteria 8833
101 Ga0466716_048789 3300042605 Bacteria 6638
102 Ga0466722_115371 3300042609 Bacteria 14386
103 Ga0466712_007374 3300042614 Bacteria 2952
104 Ga0466723_347129 3300042618 Bacteria 2615
105 Ga0466728_096261 3300042620 Bacteria 4443
106 Ga0466703_003934 3300042636 Bacteria 8967
107 Ga0466708_069635 3300042652 Bacteria 9335
108 Ga0466708_343333 3300042652 Bacteria 2688
109 Ga0123353_10272267 3300010167 Bacteria 2608
110 Ga0456237_0005307 3300041968 Bacteria 2046
111 Ga0466691_032165 3300042593 Bacteria 9027
112 Ga0466699_192873 3300042597 Bacteria 2184

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300000089 AustNasuHG_c1035701 AustNasuHG_10357011 322
2 3300042605 Ga0466716_192667 Ga0466716_192667_279_1406 324
3 3300042618 Ga0466723_164847 Ga0466723_164847_12288_13448 333
4 3300042648 Ga0466709_042450 Ga0466709_042450_51_1112 342
5 3300042620 Ga0466728_096261 Ga0466728_096261_288_1463 344
6 3300042652 Ga0466708_227258 Ga0466708_227258_1248_2447 346
7 3300042597 Ga0466699_308444 Ga0466699_308444_433_1614 347
8 3300042593 Ga0466691_007012 Ga0466691_007012_3259_4416 351
9 3300042597 Ga0466699_070933 Ga0466699_070933_484_1581 355
10 3300042597 Ga0466699_034177 Ga0466699_034177_1894_3093 356
11 3300042607 Ga0466720_111533 Ga0466720_111533_4194_5291 357
12 3300042606 Ga0466719_053774 Ga0466719_053774_201_1355 358
13 3300002449 JGI24698J34947_10029226 JGI24698J34947_100292262 361
14 3300042597 Ga0466699_351348 Ga0466699_351348_26523_27764 361
15 3300042612 Ga0466705_006708 Ga0466705_006708_233_1408 362
16 3300002450 JGI24695J34938_10001294 JGI24695J34938_100012945 365
17 3300002450 JGI24695J34938_10002702 JGI24695J34938_100027023 366
18 3300042636 Ga0466703_161480 Ga0466703_161480_12057_13283 366
19 3300042590 Ga0466690_144009 Ga0466690_144009_2495_3598 367
20 3300042616 Ga0466715_061201 Ga0466715_061201_2063_3244 367
21 3300042606 Ga0466719_372197 Ga0466719_372197_3940_5085 368
22 3300042615 Ga0466711_126144 Ga0466711_126144_2283_3476 368
23 3300042597 Ga0466699_142749 Ga0466699_142749_1572_2729 369
24 3300042618 Ga0466723_347129 Ga0466723_347129_1170_2339 369
25 3300042593 Ga0466691_188926 Ga0466691_188926_2411_3556 370
26 3300005201 Ga0072941_1078707 Ga0072941_10787077 371
27 3300042593 Ga0466691_025943 Ga0466691_025943_11005_12165 372
28 3300042593 Ga0466691_048291 Ga0466691_048291_4063_5181 372
29 3300042597 Ga0466699_176601 Ga0466699_176601_2031_3212 372
30 3300002450 JGI24695J34938_10006669 JGI24695J34938_100066692 373
31 3300042617 Ga0466718_071945 Ga0466718_071945_1591_2775 373
32 3300002450 JGI24695J34938_10001263 JGI24695J34938_1000126313 374
33 3300042620 Ga0466728_121493 Ga0466728_121493_121_1272 374
34 3300000089 AustNasuHG_c1012835 AustNasuHG_10128352 375
35 3300042635 Ga0466702_290462 Ga0466702_290462_3179_4384 376
36 3300042652 Ga0466708_328999 Ga0466708_328999_11769_12944 376
37 3300000089 AustNasuHG_c1001303 AustNasuHG_10013032 377
38 3300010167 Ga0123353_10149268 Ga0123353_101492682 377
39 3300042591 Ga0466692_035547 Ga0466692_035547_5233_6366 377
40 3300042593 Ga0466691_008800 Ga0466691_008800_1288_2448 377
41 3300042596 Ga0466696_026430 Ga0466696_026430_1422_2600 377
42 3300042615 Ga0466711_151136 Ga0466711_151136_43_1233 378
43 3300042595 Ga0466695_295531 Ga0466695_295531_119511_120683 379
44 3300042597 Ga0466699_398393 Ga0466699_398393_16097_17266 379
45 3300042618 Ga0466723_328702 Ga0466723_328702_1086_2255 379
46 3300042597 Ga0466699_192873 Ga0466699_192873_130_1302 380
47 3300042605 Ga0466716_289672 Ga0466716_289672_1286_2428 380
48 3300042648 Ga0466709_415780 Ga0466709_415780_1919_3085 380
49 3300042652 Ga0466708_094298 Ga0466708_094298_29629_30825 380
50 3300042590 Ga0466690_031134 Ga0466690_031134_842_1987 381
51 3300042590 Ga0466690_095451 Ga0466690_095451_1259_2431 381
52 3300000089 AustNasuHG_c1000131 AustNasuHG_100013116 382
53 3300042616 Ga0466715_014467 Ga0466715_014467_1093_2265 382
54 3300042643 Ga0466704_189681 Ga0466704_189681_3483_4658 382
55 3300002450 JGI24695J34938_10000093 JGI24695J34938_1000009356 383
56 3300010167 Ga0123353_10231327 Ga0123353_102313273 383
57 3300042609 Ga0466722_063243 Ga0466722_063243_1715_2866 383
58 3300042617 Ga0466718_063950 Ga0466718_063950_91_1272 383
59 iso_pr_bacteria 2781125637 2781281847 383
60 iso_pr_bacteria 2781125649 2781307337 383
61 3300002450 JGI24695J34938_10006571 JGI24695J34938_100065712 384
62 3300042609 Ga0466722_115371 Ga0466722_115371_4232_5416 384
63 3300042648 Ga0466709_040405 Ga0466709_040405_3893_5074 384
64 iso_pr_bacteria 2781125642 2781292906 384
65 3300000089 AustNasuHG_c1003648 AustNasuHG_10036486 385
66 3300002450 JGI24695J34938_10004974 JGI24695J34938_100049746 385
67 3300042618 Ga0466723_243688 Ga0466723_243688_63695_64879 385
68 3300042636 Ga0466703_029976 Ga0466703_029976_13711_14910 387
69 3300042643 Ga0466704_503977 Ga0466704_503977_26445_27644 387
70 3300042597 Ga0466699_208229 Ga0466699_208229_130_1326 388
71 3300042615 Ga0466711_013326 Ga0466711_013326_5530_6738 388
72 3300042652 Ga0466708_072135 Ga0466708_072135_1783_2949 388
73 3300000089 AustNasuHG_c1002102 AustNasuHG_10021022 389
74 3300042615 Ga0466711_382308 Ga0466711_382308_6217_7422 389
75 3300042620 Ga0466728_009282 Ga0466728_009282_4333_5502 389
76 3300042635 Ga0466702_053883 Ga0466702_053883_679_1872 389
77 3300042652 Ga0466708_069635 Ga0466708_069635_3948_5117 389
78 3300042643 Ga0466704_210075 Ga0466704_210075_2261_3448 390
79 3300042648 Ga0466709_361519 Ga0466709_361519_3841_5040 390
80 3300041968 Ga0456237_0005307 Ga0456237_0005307_717_1892 391
81 3300042592 Ga0466693_323139 Ga0466693_323139_842_2074 391
82 3300042592 Ga0466693_434569 Ga0466693_434569_1532_2707 391
83 3300042606 Ga0466719_378020 Ga0466719_378020_1781_2959 392
84 3300042612 Ga0466705_144653 Ga0466705_144653_10867_12072 392
85 3300042615 Ga0466711_251718 Ga0466711_251718_1329_2507 392
86 3300042618 Ga0466723_312578 Ga0466723_312578_10035_11213 392
87 3300042593 Ga0466691_024570 Ga0466691_024570_3384_4592 393
88 3300042612 Ga0466705_318593 Ga0466705_318593_2286_3467 393
89 3300002449 JGI24698J34947_10004147 JGI24698J34947_100041474 394
90 3300042591 Ga0466692_020331 Ga0466692_020331_4488_5672 394
91 3300042605 Ga0466716_044054 Ga0466716_044054_181_1365 394
92 3300042606 Ga0466719_022465 Ga0466719_022465_929_2203 394
93 3300042597 Ga0466699_124356 Ga0466699_124356_4588_5805 395
94 3300042614 Ga0466712_007374 Ga0466712_007374_1227_2444 395
95 3300042648 Ga0466709_142732 Ga0466709_142732_1001_2188 395
96 3300042605 Ga0466716_266539 Ga0466716_266539_248_1438 396
97 3300042620 Ga0466728_067704 Ga0466728_067704_1014_2204 396
98 3300042593 Ga0466691_091123 Ga0466691_091123_7025_8218 397
99 3300042596 Ga0466696_193499 Ga0466696_193499_4144_5337 397
100 3300042636 Ga0466703_003934 Ga0466703_003934_7723_8931 397
101 3300042593 Ga0466691_032165 Ga0466691_032165_4255_5451 398
102 3300042615 Ga0466711_007794 Ga0466711_007794_678_1874 398
103 3300042615 Ga0466711_318694 Ga0466711_318694_1162_2421 398
104 3300010167 Ga0123353_10272267 Ga0123353_102722672 399
105 3300042648 Ga0466709_015811 Ga0466709_015811_359_1558 399
106 iso_pr_bacteria 2781125646 2781300596 399
107 3300002450 JGI24695J34938_10000042 JGI24695J34938_100000422 400
108 3300042643 Ga0466704_344209 Ga0466704_344209_10024_11253 400
109 3300042605 Ga0466716_048789 Ga0466716_048789_3457_4671 404
110 3300002450 JGI24695J34938_10004707 JGI24695J34938_100047073 408
111 3300042596 Ga0466696_477753 Ga0466696_477753_1345_2571 408
112 3300042590 Ga0466690_326029 Ga0466690_326029_958_2190 410
113 3300042643 Ga0466704_385875 Ga0466704_385875_329_1564 411
114 3300042652 Ga0466708_343333 Ga0466708_343333_99_1337 412
115 3300042612 Ga0466705_436590 Ga0466705_436590_3845_5104 419
116 3300042652 Ga0466708_281187 Ga0466708_281187_307_1638 430

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF07907 YibE_F YibE/F-like protein 188 411 0.99

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.61 0.7 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.