Protein Family IF09942
Metagenome
Isolate
128
Members
62
Samples
111
Scaffolds
143.01
Avg Length
Representative Sequence
- ID
- 3300042652|Ga0466708_243982|Ga0466708_243982_77_577
- Length
- 166 aa
- Sequence
- MYICHLKIISQKMPITYQAEGINFPAINRTKTGIWIKKIARIYRKKIGEIAYIFCSDEKILEINNRYLQHDYYTDIITFDYSEKDAIAGDIFISIDTVKSNSERFQTDFNEELHRVIIHGILHLCGLTDKTPKEEKMMREKENEALQLIDWETISPHANNIPPEQL
Sample Types
Isolate
13.3%
Metagenome
86.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
22.6%
Kalotermitidae
19.4%
Unclassified
16.1%
Blattidae
11.3%
Armadillidiidae
9.7%
Rhinotermitidae
8.1%
Passalidae
4.8%
Termopsidae
3.2%
Hydrophilidae
1.6%
Tenebrionidae
1.6%
Hodotermitidae
1.6%
Taxonomy
Archaea
0
Bacteria
123
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 2 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 3 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 12 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 13 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 14 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 15 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 16 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 17 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 18 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 19 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 20 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 21 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 22 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 23 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 24 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 25 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 28 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 29 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 30 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 31 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 32 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 33 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 34 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 35 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 36 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 37 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 38 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 39 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 40 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 41 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 42 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 43 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 44 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 45 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 46 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 47 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 48 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 49 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 50 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 51 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 52 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 53 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 54 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 55 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 56 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 57 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 58 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 59 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 60 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 61 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 62 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466722_023960 | 3300042609 | Bacteria | 61916 |
| 2 | 2227178028 | 2225789004 | Bacteria | 8096 |
| 3 | Ga0466715_171247 | 3300042616 | Bacteria | 13328 |
| 4 | Ga0160455_102813 | 3300012837 | Bacteria | 3214 |
| 5 | Ga0160444_101661 | 3300012841 | Bacteria | 3911 |
| 6 | Ga0466691_013562 | 3300042593 | Bacteria | 36888 |
| 7 | Ga0466696_003763 | 3300042596 | Bacteria | 106079 |
| 8 | Ga0123355_10013247 | 3300009826 | Bacteria | 12817 |
| 9 | Ga0466703_261827 | 3300042636 | Bacteria | 4327 |
| 10 | Ga0466703_402408 | 3300042636 | Bacteria | 12984 |
| 11 | Ga0466705_065977 | 3300042612 | Bacteria | 24694 |
| 12 | Ga0466706_140857 | 3300042599 | Bacteria | 123527 |
| 13 | Ga0466707_168180 | 3300042601 | Bacteria | 4839 |
| 14 | Ga0466713_046176 | 3300042602 | Bacteria | 36375 |
| 15 | Ga0466714_079066 | 3300042603 | Bacteria | 11411 |
| 16 | Ga0466722_035543 | 3300042609 | Bacteria | 116913 |
| 17 | Ga0466722_157355 | 3300042609 | Bacteria | 7271 |
| 18 | JGI24702J35022_10003405 | 3300002462 | Bacteria | 9595 |
| 19 | Ga0466711_082855 | 3300042615 | Bacteria | 19507 |
| 20 | Ga0466711_498380 | 3300042615 | Bacteria | 2505 |
| 21 | Ga0160469_104516 | 3300012824 | Bacteria | 1602 |
| 22 | Ga0160445_103654 | 3300012847 | Unclassified | 3020 |
| 23 | Ga0466735_161478 | 3300042624 | Bacteria | 1394 |
| 24 | Ga0466703_020008 | 3300042636 | Bacteria | 4661 |
| 25 | Ga0466705_043883 | 3300042612 | Bacteria | 44680 |
| 26 | Ga0466705_049178 | 3300042612 | Bacteria | 14509 |
| 27 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 28 | Ga0466700_353416 | 3300042600 | Bacteria | 3720 |
| 29 | Ga0466707_144321 | 3300042601 | Bacteria | 17726 |
| 30 | Ga0466707_187402 | 3300042601 | Bacteria | 29769 |
| 31 | Ga0466719_348582 | 3300042606 | Bacteria | 3205 |
| 32 | IMNBL1DRAFT_c0114937 | 3300000062 | Bacteria | 712 |
| 33 | JGI24699J35502_11134056 | 3300002509 | Bacteria | 27277 |
| 34 | Ga0068305_10252695 | 3300005083 | Bacteria | 9634 |
| 35 | Ga0466711_089372 | 3300042615 | Bacteria | 20709 |
| 36 | Ga0466715_231121 | 3300042616 | Bacteria | 27941 |
| 37 | Ga0160433_101031 | 3300012846 | Bacteria | 8872 |
| 38 | Ga0466691_070505 | 3300042593 | Bacteria | 29315 |
| 39 | Ga0123356_12232274 | 3300010049 | Bacteria | 684 |
| 40 | Ga0123353_12100629 | 3300010167 | Bacteria | 688 |
| 41 | Ga0466735_007920 | 3300042624 | Bacteria | 16709 |
| 42 | Ga0466735_089701 | 3300042624 | Bacteria | 3874 |
| 43 | Ga0466735_149185 | 3300042624 | Bacteria | 7270 |
| 44 | Ga0466704_027068 | 3300042643 | Bacteria | 38856 |
| 45 | Ga0466727_281328 | 3300042655 | Bacteria | 1456 |
| 46 | Ga0466727_334100 | 3300042655 | Bacteria | 5846 |
| 47 | Ga0466707_403730 | 3300042601 | Bacteria | 1183 |
| 48 | Ga0466713_124887 | 3300042602 | Bacteria | 13976 |
| 49 | Ga0466714_001486 | 3300042603 | Bacteria | 5249 |
| 50 | Ga0466714_114156 | 3300042603 | Bacteria | 41644 |
| 51 | 2227570208 | 2225789004 | Bacteria | 2620 |
| 52 | Ga0123357_10000085 | 3300009784 | Bacteria | 75372 |
| 53 | Ga0466712_286106 | 3300042614 | Unclassified | 1409 |
| 54 | Ga0466711_100503 | 3300042615 | Bacteria | 21089 |
| 55 | Ga0466690_251600 | 3300042590 | Bacteria | 1861 |
| 56 | Ga0123356_10086027 | 3300010049 | Bacteria | 2983 |
| 57 | Ga0466730_087142 | 3300042625 | Bacteria | 1883 |
| 58 | Ga0466703_011037 | 3300042636 | Bacteria | 1061 |
| 59 | Ga0466704_363280 | 3300042643 | Bacteria | 7638 |
| 60 | Ga0466701_055658 | 3300042598 | Bacteria | 38151 |
| 61 | Ga0466706_012879 | 3300042599 | Bacteria | 6474 |
| 62 | Ga0466706_242910 | 3300042599 | Bacteria | 5337 |
| 63 | Ga0466707_306289 | 3300042601 | Bacteria | 6338 |
| 64 | Ga0466714_058811 | 3300042603 | Bacteria | 71979 |
| 65 | Ga0466716_358881 | 3300042605 | Bacteria | 4787 |
| 66 | Ga0466716_410584 | 3300042605 | Bacteria | 58331 |
| 67 | IMNBL1DRAFT_c0000010 | 3300000062 | Bacteria | 201282 |
| 68 | JGI24702J35022_10270827 | 3300002462 | Bacteria | 994 |
| 69 | Ga0123353_10140639 | 3300010167 | Bacteria | 3867 |
| 70 | Ga0466735_104917 | 3300042624 | Bacteria | 4543 |
| 71 | Ga0466703_398893 | 3300042636 | Bacteria | 1279 |
| 72 | Ga0466704_460153 | 3300042643 | Bacteria | 10237 |
| 73 | Ga0466733_093258 | 3300042659 | Bacteria | 8899 |
| 74 | Ga0466713_011019 | 3300042602 | Bacteria | 19476 |
| 75 | Ga0466716_279502 | 3300042605 | Bacteria | 16930 |
| 76 | Ga0466719_522950 | 3300042606 | Bacteria | 2742 |
| 77 | Ga0466722_053445 | 3300042609 | Bacteria | 38463 |
| 78 | IMNBL1DRAFT_c0024666 | 3300000062 | Bacteria | 2324 |
| 79 | JGI24699J35502_11134081 | 3300002509 | Bacteria | 28828 |
| 80 | Ga0068305_10012270 | 3300005083 | Unclassified | 3387 |
| 81 | Ga0466715_366812 | 3300042616 | Bacteria | 14293 |
| 82 | Ga0160468_100065 | 3300012819 | Bacteria | 140978 |
| 83 | Ga0160445_100268 | 3300012847 | Bacteria | 35665 |
| 84 | Ga0466656_373695 | 3300042550 | Bacteria | 1881 |
| 85 | Ga0466692_140391 | 3300042591 | Bacteria | 136970 |
| 86 | Ga0123353_10282340 | 3300010167 | Bacteria | 2549 |
| 87 | Ga0466709_352149 | 3300042648 | Bacteria | 153873 |
| 88 | Ga0466701_075009 | 3300042598 | Bacteria | 10130 |
| 89 | Ga0466706_110737 | 3300042599 | Bacteria | 1777 |
| 90 | Ga0466713_012284 | 3300042602 | Unclassified | 15686 |
| 91 | 2227172479 | 2225789004 | Bacteria | 8175 |
| 92 | IMNBL1DRAFT_c0000112 | 3300000062 | Bacteria | 72967 |
| 93 | IMNBL1DRAFT_c0144526 | 3300000062 | Bacteria | 613 |
| 94 | Ga0160433_100862 | 3300012846 | Bacteria | 10612 |
| 95 | Ga0123356_10186614 | 3300010049 | Bacteria | 2100 |
| 96 | Ga0123353_10677737 | 3300010167 | Bacteria | 1453 |
| 97 | Ga0466735_155484 | 3300042624 | Bacteria | 1342 |
| 98 | Ga0466703_039792 | 3300042636 | Bacteria | 28795 |
| 99 | Ga0466708_243982 | 3300042652 | Bacteria | 25514 |
| 100 | Ga0466727_342006 | 3300042655 | Bacteria | 6229 |
| 101 | Ga0466733_073117 | 3300042659 | Bacteria | 5276 |
| 102 | 2227004266 | 2225789003 | Unclassified | 1259 |
| 103 | 2227463822 | 2225789004 | Bacteria | 5295 |
| 104 | IMNBL1DRAFT_c0010739 | 3300000062 | Bacteria | 4344 |
| 105 | IMNBL1DRAFT_c0027020 | 3300000062 | Bacteria | 2168 |
| 106 | Ga0466705_435478 | 3300042612 | Bacteria | 9537 |
| 107 | Ga0466710_009682 | 3300042613 | Bacteria | 7788 |
| 108 | Ga0466729_094177 | 3300042621 | Bacteria | 18601 |
| 109 | Ga0466692_013335 | 3300042591 | Bacteria | 18802 |
| 110 | Ga0466696_240564 | 3300042596 | Bacteria | 5413 |
| 111 | Ga0466729_198321 | 3300042621 | Bacteria | 8895 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02130 | YbeY | Endoribonuclease YbeY | 44 | 147 | 0.91 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.