Protein Family IF09939
Metagenome
Isolate
607
Members
224
Samples
476
Scaffolds
415.63
Avg Length
Representative Sequence
- ID
- 3300042652|Ga0466708_238897|Ga0466708_238897_12106_13569
- Length
- 472 aa
- Sequence
- MAKKEQTISMIDTLAEFKELKNIDKETMINVLEESFRNVIARMFGTDENYDVIINPAKGDFEIWRNRIVVEDGRVEDSNLQISISEAHAIDPDCEVGEEVTDEVHFADFGRRAILNLRQTLSSKIMELQKDSLFAKYKGLIGFIVIAEVYQVWKKEVLLLDDRGNELLLPKSEQIPGDFYAKGQSIRAVVQRVESENNNTRIYLSRTDKIFLQRLFELEVPEINDGLITIKAIARIPGERAKIAVESYDDRIDPVGACVGMKGSRIRGIVRELRNENIDVVNYSTNTALFIQRSLSPAKISSIRLYEDERKAEVSLRPEEVSLAIGKSGLNIKLACMLTDYTIDVFRDIDAMDEEDIYLDEFADEIDTWVIDALKNIGCNTAKAVLALKREEIIERADLEEQTVDDLISVLASEFEDEMINRTEEVPEKNPEEIKYLDETAAPQPENDVEQTACAVIHEAENRVEPEAGDQE
Sample Types
Isolate
21.6%
Metagenome
78.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
16.7%
Termitidae
14.8%
Unclassified
11.0%
Kalotermitidae
6.7%
Cryptocercidae
5.7%
Formicidae
5.2%
Elmidae
4.3%
Blaberidae
4.3%
Culicidae
3.3%
Blattellidae
3.3%
Armadillidiidae
3.3%
Pseudophyllodromiidae
2.4%
Rhinotermitidae
2.4%
Passalidae
1.9%
Termopsidae
1.9%
Hydrophilidae
1.4%
Corydiidae
1.4%
Drosophilidae
1.4%
Daphniidae
1.0%
Tenebrionidae
1.0%
Ectobiidae
1.0%
Nyctiboridae
1.0%
Anaplectidae
1.0%
Cambaridae
1.0%
Aphididae
0.5%
Nephropidae
0.5%
Lamproblattidae
0.5%
Tryonicidae
0.5%
Hodotermitidae
0.5%
Bombycidae
0.5%
Taxonomy
Archaea
0
Bacteria
528
Eukaryota
0
Viruses
0
Unclassified
79
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 2 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 3 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 4 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 5 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 6 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 7 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 8 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 9 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 10 | 2998929858 | Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 | Isolate | Aphididae |
| 11 | 3002026852 | Blattabacterium cuenoti BEYBkur | Isolate | Blattellidae |
| 12 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 13 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 14 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 15 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 16 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 17 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 18 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 19 | 2518645548 | Blattabacterium sp. (Blaberus giganteus) | Isolate | Blaberidae |
| 20 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 21 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 22 | 2833033236 | Blattabacterium sp. CKYod | Isolate | Cryptocercidae |
| 23 | 2833047020 | Blattabacterium punctulatus CPUbt | Isolate | Cryptocercidae |
| 24 | 2833050843 | Blattabacterium punctulatus CPUmc | Isolate | Cryptocercidae |
| 25 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 26 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 27 | 3002002726 | Blattabacterium cuenoti PARATEMsp | Isolate | Blattellidae |
| 28 | 3002027480 | Blattabacterium cuenoti SCHULTlam | Isolate | Unclassified |
| 29 | 3002031819 | Blattabacterium cuenoti SHELFORDIsp | Isolate | Pseudophyllodromiidae |
| 30 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 31 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 32 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 33 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 34 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 35 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 36 | 650716011 | Blattabacterium sp. Bge | Isolate | Blattellidae |
| 37 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 38 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 39 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 40 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 41 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 42 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 43 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 44 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 45 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 46 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 47 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 48 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 49 | 2833037493 | Blattabacterium punctulatus CPUsv | Isolate | Cryptocercidae |
| 50 | 2833042786 | Blattabacterium punctulatus CPUsm | Isolate | Cryptocercidae |
| 51 | 2833051446 | Blattabacterium punctulatus CPUml | Isolate | Cryptocercidae |
| 52 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 53 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 54 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 55 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 56 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 57 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 58 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 59 | 3002002099 | Blattabacterium cuenoti ECTONUhan | Isolate | Ectobiidae |
| 60 | 3002004002 | Blattabacterium cuenoti EUPOLsin | Isolate | Corydiidae |
| 61 | 3002006476 | Blattabacterium cuenoti GYNAcap | Isolate | Blaberidae |
| 62 | 3002032411 | Blattabacterium cuenoti POLYPHAGsp | Isolate | Corydiidae |
| 63 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 64 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 65 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 66 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 67 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 68 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 69 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 70 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 71 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 72 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 73 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 74 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 75 | 2561511170 | Blattabacterium sp. (Blatta orientalis) Tarazona | Isolate | Unclassified |
| 76 | 2833033875 | Blattabacterium punctulatus CPUpc | Isolate | Cryptocercidae |
| 77 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 78 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 79 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 80 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 81 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 82 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 83 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 84 | 3002005847 | Blattabacterium cuenoti ECTOBIsp | Isolate | Ectobiidae |
| 85 | 3002007740 | Blattabacterium cuenoti NYCTIBsp | Isolate | Nyctiboridae |
| 86 | 3002023891 | Blattabacterium cuenoti MEGALOsp | Isolate | Nyctiboridae |
| 87 | 3002028123 | Blattabacterium cuenoti LAMPROsp | Isolate | Lamproblattidae |
| 88 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 89 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 90 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 91 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 92 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 93 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 94 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 95 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 96 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 97 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 98 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 99 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 100 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 101 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 102 | 2833043393 | Blattabacterium clevelandi CCLhc | Isolate | Cryptocercidae |
| 103 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 104 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 105 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 106 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 107 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 108 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 109 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 110 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 111 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 112 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 113 | 3001995955 | Blattabacterium cuenoti ANAPcal | Isolate | Anaplectidae |
| 114 | 3002008998 | Blattabacterium cuenoti PARCOBvir | Isolate | Blattellidae |
| 115 | 3002022645 | Blattabacterium cuenoti TRYONIpar | Isolate | Tryonicidae |
| 116 | 3002025161 | Blattabacterium cuenoti MEDIASdel | Isolate | Pseudophyllodromiidae |
| 117 | 3002029927 | Blattabacterium cuenoti CHORISOsp | Isolate | Pseudophyllodromiidae |
| 118 | 3002031185 | Blattabacterium cuenoti OPISTHori | Isolate | Blaberidae |
| 119 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 120 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 121 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 122 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 123 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 124 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 125 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 126 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 127 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 128 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 129 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 130 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 131 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 132 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 133 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 134 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 135 | 2833034481 | Blattabacterium punctulatus CPUwf | Isolate | Cryptocercidae |
| 136 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 137 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 138 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 139 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 140 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 141 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 142 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 143 | 3001995318 | Blattabacterium cuenoti DYAKIkur | Isolate | Blattellidae |
| 144 | 3002004631 | Blattabacterium cuenoti ANAPome | Isolate | Anaplectidae |
| 145 | 3002033046 | Blattabacterium cuenoti ANALLAmet | Isolate | Blattellidae |
| 146 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 147 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 148 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 149 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 150 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 151 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 152 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 153 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 154 | 646311912 | Blattabacterium sp. BPLAN | Isolate | Blattidae |
| 155 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 156 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 157 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 158 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 159 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 160 | 2833030225 | Blattabacterium punctulatus CPUmp | Isolate | Cryptocercidae |
| 161 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 162 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 163 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 164 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 165 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 166 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 167 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 168 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 169 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 170 | 3002024525 | Blattabacterium cuenoti EPILAmay | Isolate | Blaberidae |
| 171 | 3002025727 | Blattabacterium cuenoti EUPHYsp | Isolate | Pseudophyllodromiidae |
| 172 | 3002026254 | Blattabacterium cuenoti BALTAsp | Isolate | Pseudophyllodromiidae |
| 173 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 174 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 175 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 176 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 177 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 178 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 179 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 180 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 181 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 182 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 183 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 184 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 185 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 186 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 187 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 188 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 189 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 190 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 191 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 192 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 193 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 194 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 195 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 196 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 197 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 198 | 2511231112 | Blattabacterium punctulatus Cpu | Isolate | Cryptocercidae |
| 199 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 200 | 2833044002 | Blattabacterium punctulatus CPUbr | Isolate | Cryptocercidae |
| 201 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 202 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 203 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 204 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 205 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 206 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 207 | 3002003370 | Blattabacterium cuenoti THEREAreg | Isolate | Corydiidae |
| 208 | 3002005207 | Blattabacterium cuenoti MELANOZsp | Isolate | Blattidae |
| 209 | 3002007112 | Blattabacterium cuenoti CYRTOsp | Isolate | Blaberidae |
| 210 | 3002008367 | Blattabacterium cuenoti PARANAUcir | Isolate | Blaberidae |
| 211 | 3002023256 | Blattabacterium cuenoti RHABDOBsp | Isolate | Blaberidae |
| 212 | 3002028747 | Blattabacterium cuenoti ESCALves | Isolate | Blattellidae |
| 213 | 3002030550 | Blattabacterium cuenoti NEOLAXmac | Isolate | Blaberidae |
| 214 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 215 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 216 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 217 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 218 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 219 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 220 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 221 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 222 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 223 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 224 | 8071415077 | Blattabacterium cuenoti MACROPArhi | Isolate | Blaberidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_158452 | 3300042611 | Unclassified | 6864 |
| 2 | Ga0466733_033301 | 3300042659 | Bacteria | 13216 |
| 3 | Ga0466733_150172 | 3300042659 | Bacteria | 2207 |
| 4 | Ga0466733_170857 | 3300042659 | Bacteria | 3017 |
| 5 | Ga0466710_430141 | 3300042613 | Unclassified | 12841 |
| 6 | Ga0466711_018272 | 3300042615 | Bacteria | 27429 |
| 7 | Ga0466711_032755 | 3300042615 | Bacteria | 36049 |
| 8 | Ga0466711_108824 | 3300042615 | Unclassified | 6423 |
| 9 | Ga0466711_210711 | 3300042615 | Bacteria | 21747 |
| 10 | Ga0466715_073307 | 3300042616 | Bacteria | 12271 |
| 11 | Ga0466715_084874 | 3300042616 | Bacteria | 15251 |
| 12 | Ga0466715_108456 | 3300042616 | Bacteria | 10412 |
| 13 | Ga0466715_432183 | 3300042616 | Bacteria | 6993 |
| 14 | Ga0466723_052612 | 3300042618 | Bacteria | 8958 |
| 15 | Ga0466723_094741 | 3300042618 | Bacteria | 15823 |
| 16 | Ga0466723_105990 | 3300042618 | Bacteria | 27776 |
| 17 | Ga0466723_232821 | 3300042618 | Bacteria | 24451 |
| 18 | Ga0466726_162037 | 3300042619 | Bacteria | 4311 |
| 19 | Ga0466728_098738 | 3300042620 | Bacteria | 9357 |
| 20 | Ga0466729_307362 | 3300042621 | Bacteria | 2693 |
| 21 | Ga0466735_064324 | 3300042624 | Bacteria | 4541 |
| 22 | Ga0466703_226129 | 3300042636 | Bacteria | 3373 |
| 23 | Ga0466703_356630 | 3300042636 | Bacteria | 16626 |
| 24 | Ga0466704_053282 | 3300042643 | Bacteria | 17608 |
| 25 | Ga0466704_054707 | 3300042643 | Unclassified | 1903 |
| 26 | Ga0466704_055644 | 3300042643 | Unclassified | 9614 |
| 27 | Ga0466724_23859 | 3300042649 | Unclassified | 7265 |
| 28 | Ga0466724_30779 | 3300042649 | Bacteria | 8562 |
| 29 | Ga0466708_130948 | 3300042652 | Bacteria | 10649 |
| 30 | Ga0466708_205475 | 3300042652 | Bacteria | 21324 |
| 31 | Ga0123356_10010842 | 3300010049 | Bacteria | 8912 |
| 32 | Ga0123356_10789001 | 3300010049 | Bacteria | 1121 |
| 33 | Ga0123353_10025349 | 3300010167 | Unclassified | 9035 |
| 34 | Ga0123353_10038071 | 3300010167 | Unclassified | 7553 |
| 35 | Ga0123354_10000257 | 3300010882 | Bacteria | 47636 |
| 36 | Ga0123354_10155801 | 3300010882 | Bacteria | 2741 |
| 37 | Ga0160440_100890 | 3300012815 | Unclassified | 5423 |
| 38 | Ga0160441_100011 | 3300012825 | Bacteria | 461375 |
| 39 | Ga0466656_167287 | 3300042550 | Unclassified | 2912 |
| 40 | Ga0466690_082899 | 3300042590 | Bacteria | 3037 |
| 41 | Ga0466691_021379 | 3300042593 | Unclassified | 11330 |
| 42 | Ga0466706_090116 | 3300042599 | Bacteria | 12663 |
| 43 | Ga0466706_138680 | 3300042599 | Bacteria | 4712 |
| 44 | Ga0466706_144964 | 3300042599 | Bacteria | 38907 |
| 45 | Ga0466707_422281 | 3300042601 | Bacteria | 2145 |
| 46 | Ga0466713_024071 | 3300042602 | Bacteria | 10549 |
| 47 | Ga0466713_035886 | 3300042602 | Bacteria | 236629 |
| 48 | Ga0466713_074235 | 3300042602 | Bacteria | 17987 |
| 49 | Ga0466714_112143 | 3300042603 | Unclassified | 6284 |
| 50 | Ga0466719_070911 | 3300042606 | Bacteria | 7741 |
| 51 | Ga0466722_261554 | 3300042609 | Bacteria | 74167 |
| 52 | Ga0466698_290858 | 3300042610 | Bacteria | 2610 |
| 53 | 2227080834 | 2225789004 | Bacteria | 10074 |
| 54 | 2227380800 | 2225789004 | Bacteria | 5932 |
| 55 | IMNBL1DRAFT_c0000562 | 3300000062 | Bacteria | 29997 |
| 56 | JGI24702J35022_10047209 | 3300002462 | Bacteria | 2292 |
| 57 | Ga0068305_10090528 | 3300005083 | Bacteria | 8735 |
| 58 | Ga0103264_1000015 | 3300007188 | Bacteria | 118328 |
| 59 | Ga0466697_266885 | 3300042611 | Bacteria | 1398 |
| 60 | Ga0466705_000239 | 3300042612 | Bacteria | 4931 |
| 61 | Ga0466705_036932 | 3300042612 | Bacteria | 13829 |
| 62 | Ga0466705_084255 | 3300042612 | Unclassified | 3194 |
| 63 | Ga0466733_027181 | 3300042659 | Bacteria | 2005 |
| 64 | Ga0466733_039523 | 3300042659 | Bacteria | 11021 |
| 65 | Ga0466733_080200 | 3300042659 | Bacteria | 17486 |
| 66 | Ga0466733_120574 | 3300042659 | Bacteria | 105258 |
| 67 | Ga0466733_136080 | 3300042659 | Unclassified | 7631 |
| 68 | Ga0466733_221141 | 3300042659 | Bacteria | 323281 |
| 69 | Ga0466710_027511 | 3300042613 | Bacteria | 1506 |
| 70 | Ga0466710_082979 | 3300042613 | Bacteria | 2530 |
| 71 | Ga0466711_227741 | 3300042615 | Bacteria | 5858 |
| 72 | Ga0466723_286459 | 3300042618 | Bacteria | 22404 |
| 73 | Ga0466723_341877 | 3300042618 | Bacteria | 10081 |
| 74 | Ga0466728_306748 | 3300042620 | Bacteria | 24885 |
| 75 | Ga0466731_295592 | 3300042622 | Bacteria | 5295 |
| 76 | Ga0466735_066918 | 3300042624 | Bacteria | 5723 |
| 77 | Ga0466730_071786 | 3300042625 | Bacteria | 741189 |
| 78 | Ga0466703_085574 | 3300042636 | Bacteria | 12708 |
| 79 | Ga0466703_155289 | 3300042636 | Bacteria | 19973 |
| 80 | Ga0466703_200475 | 3300042636 | Bacteria | 8238 |
| 81 | Ga0466704_013389 | 3300042643 | Unclassified | 4097 |
| 82 | Ga0466704_063452 | 3300042643 | Unclassified | 8950 |
| 83 | Ga0466704_115623 | 3300042643 | Bacteria | 6631 |
| 84 | Ga0466704_481091 | 3300042643 | Bacteria | 6992 |
| 85 | Ga0466709_393507 | 3300042648 | Unclassified | 19365 |
| 86 | Ga0466708_160114 | 3300042652 | Bacteria | 24888 |
| 87 | Ga0466708_444813 | 3300042652 | Bacteria | 7650 |
| 88 | Ga0466725_162563 | 3300042654 | Bacteria | 7207 |
| 89 | Ga0466727_017891 | 3300042655 | Bacteria | 15821 |
| 90 | Ga0466727_135287 | 3300042655 | Bacteria | 1316 |
| 91 | Ga0123355_10000223 | 3300009826 | Bacteria | 71620 |
| 92 | Ga0123356_10239999 | 3300010049 | Bacteria | 1883 |
| 93 | Ga0123356_10430095 | 3300010049 | Unclassified | 1464 |
| 94 | Ga0123353_10082272 | 3300010167 | Bacteria | 5178 |
| 95 | Ga0160456_100015 | 3300012820 | Bacteria | 326465 |
| 96 | Ga0160467_100491 | 3300012829 | Bacteria | 38207 |
| 97 | Ga0160455_100185 | 3300012837 | Bacteria | 59944 |
| 98 | Ga0160445_101435 | 3300012847 | Bacteria | 6748 |
| 99 | Ga0466657_399897 | 3300042582 | Bacteria | 2666 |
| 100 | Ga0466690_015253 | 3300042590 | Bacteria | 11745 |
| 101 | Ga0466690_041478 | 3300042590 | Bacteria | 13260 |
| 102 | Ga0466696_014961 | 3300042596 | Bacteria | 77550 |
| 103 | Ga0466696_182887 | 3300042596 | Bacteria | 17021 |
| 104 | Ga0466696_305479 | 3300042596 | Bacteria | 4264 |
| 105 | Ga0466706_051376 | 3300042599 | Bacteria | 3227 |
| 106 | Ga0466706_140857 | 3300042599 | Bacteria | 123527 |
| 107 | Ga0466706_144559 | 3300042599 | Bacteria | 12682 |
| 108 | Ga0466706_163692 | 3300042599 | Unclassified | 14969 |
| 109 | Ga0466707_107012 | 3300042601 | Bacteria | 2803 |
| 110 | Ga0466713_012978 | 3300042602 | Bacteria | 10060 |
| 111 | Ga0466713_046110 | 3300042602 | Bacteria | 12828 |
| 112 | Ga0466713_072522 | 3300042602 | Bacteria | 16632 |
| 113 | Ga0466714_008761 | 3300042603 | Bacteria | 4478 |
| 114 | Ga0466714_010243 | 3300042603 | Bacteria | 4224 |
| 115 | Ga0466714_011572 | 3300042603 | Bacteria | 31424 |
| 116 | Ga0466714_013319 | 3300042603 | Bacteria | 54625 |
| 117 | Ga0466716_173848 | 3300042605 | Bacteria | 43531 |
| 118 | JGI24702J35022_10002207 | 3300002462 | Bacteria | 11982 |
| 119 | JGI24702J35022_10012390 | 3300002462 | Bacteria | 4742 |
| 120 | JGI24702J35022_10041239 | 3300002462 | Bacteria | 2460 |
| 121 | JGI24705J35276_12237331 | 3300002504 | Bacteria | 10691 |
| 122 | CVPL010W_10001554 | 3300002931 | Bacteria | 26918 |
| 123 | Ga0068305_10021532 | 3300005083 | Bacteria | 6131 |
| 124 | Ga0103267_1000924 | 3300007190 | Unclassified | 12748 |
| 125 | Ga0466705_250597 | 3300042612 | Bacteria | 6956 |
| 126 | Ga0466733_062346 | 3300042659 | Unclassified | 3824 |
| 127 | Ga0466733_148697 | 3300042659 | Bacteria | 2112 |
| 128 | Ga0466733_155305 | 3300042659 | Bacteria | 9095 |
| 129 | Ga0466710_266618 | 3300042613 | Bacteria | 9048 |
| 130 | Ga0466712_209318 | 3300042614 | Bacteria | 1730 |
| 131 | Ga0466711_054247 | 3300042615 | Bacteria | 9298 |
| 132 | Ga0466711_331426 | 3300042615 | Bacteria | 7251 |
| 133 | Ga0466715_109994 | 3300042616 | Unclassified | 5814 |
| 134 | Ga0466723_178988 | 3300042618 | Bacteria | 3829 |
| 135 | Ga0466726_256497 | 3300042619 | Bacteria | 11485 |
| 136 | Ga0466728_132211 | 3300042620 | Bacteria | 29619 |
| 137 | Ga0466728_449234 | 3300042620 | Unclassified | 18284 |
| 138 | Ga0466729_268864 | 3300042621 | Bacteria | 19528 |
| 139 | Ga0466735_000497 | 3300042624 | Unclassified | 5929 |
| 140 | Ga0466735_025673 | 3300042624 | Bacteria | 9839 |
| 141 | Ga0466730_093992 | 3300042625 | Bacteria | 3020 |
| 142 | Ga0466704_165232 | 3300042643 | Bacteria | 12000 |
| 143 | Ga0466704_323827 | 3300042643 | Bacteria | 19479 |
| 144 | Ga0466704_357659 | 3300042643 | Bacteria | 18387 |
| 145 | Ga0466709_009291 | 3300042648 | Bacteria | 5996 |
| 146 | Ga0466725_109204 | 3300042654 | Bacteria | 13512 |
| 147 | Ga0466727_306992 | 3300042655 | Bacteria | 11436 |
| 148 | Ga0123357_10169281 | 3300009784 | Bacteria | 2590 |
| 149 | Ga0123356_10208546 | 3300010049 | Bacteria | 2000 |
| 150 | Ga0123353_10086111 | 3300010167 | Bacteria | 5061 |
| 151 | Ga0160441_100163 | 3300012825 | Unclassified | 71558 |
| 152 | Ga0466656_275607 | 3300042550 | Bacteria | 2082 |
| 153 | Ga0466657_003673 | 3300042582 | Bacteria | 38289 |
| 154 | Ga0466690_089460 | 3300042590 | Unclassified | 5008 |
| 155 | Ga0466690_180075 | 3300042590 | Bacteria | 9602 |
| 156 | Ga0466691_013055 | 3300042593 | Bacteria | 9624 |
| 157 | Ga0466691_021895 | 3300042593 | Bacteria | 10312 |
| 158 | Ga0466691_064449 | 3300042593 | Bacteria | 16917 |
| 159 | Ga0466691_088234 | 3300042593 | Bacteria | 133743 |
| 160 | Ga0466691_154066 | 3300042593 | Unclassified | 3194 |
| 161 | Ga0466695_316165 | 3300042595 | Unclassified | 3395 |
| 162 | Ga0466706_191393 | 3300042599 | Bacteria | 4738 |
| 163 | Ga0466700_036816 | 3300042600 | Bacteria | 2972 |
| 164 | Ga0466707_025476 | 3300042601 | Bacteria | 9966 |
| 165 | Ga0466707_185069 | 3300042601 | Bacteria | 3121 |
| 166 | Ga0466713_009630 | 3300042602 | Bacteria | 134886 |
| 167 | Ga0466713_095390 | 3300042602 | Bacteria | 16392 |
| 168 | Ga0466714_000184 | 3300042603 | Unclassified | 1544 |
| 169 | Ga0466717_216807 | 3300042604 | Bacteria | 4734 |
| 170 | Ga0466716_343428 | 3300042605 | Bacteria | 6247 |
| 171 | Ga0466721_195944 | 3300042608 | Bacteria | 28491 |
| 172 | Ga0466722_110785 | 3300042609 | Bacteria | 32436 |
| 173 | IMNBGM34_c003971 | 3300000036 | Bacteria | 2019 |
| 174 | IMNBL1DRAFT_c0004258 | 3300000062 | Bacteria | 8672 |
| 175 | IMNBL1DRAFT_c0009114 | 3300000062 | Bacteria | 4955 |
| 176 | IMNBL1DRAFT_c0017934 | 3300000062 | Bacteria | 2957 |
| 177 | JGI24702J35022_10001588 | 3300002462 | Bacteria | 14062 |
| 178 | JGI24702J35022_10038443 | 3300002462 | Bacteria | 2555 |
| 179 | JGI24699J35502_11133900 | 3300002509 | Bacteria | 18572 |
| 180 | Ga0072941_1238033 | 3300005201 | Bacteria | 6933 |
| 181 | Ga0103268_1000708 | 3300007192 | Unclassified | 9897 |
| 182 | Ga0466705_009243 | 3300042612 | Bacteria | 15208 |
| 183 | Ga0466705_162352 | 3300042612 | Unclassified | 3670 |
| 184 | Ga0466733_002151 | 3300042659 | Bacteria | 71476 |
| 185 | Ga0466733_203604 | 3300042659 | Bacteria | 66833 |
| 186 | Ga0466710_022041 | 3300042613 | Unclassified | 1547 |
| 187 | Ga0466715_070176 | 3300042616 | Bacteria | 53352 |
| 188 | Ga0466715_107161 | 3300042616 | Bacteria | 33183 |
| 189 | Ga0466723_310256 | 3300042618 | Bacteria | 6501 |
| 190 | Ga0466723_361214 | 3300042618 | Bacteria | 3255 |
| 191 | Ga0466726_060032 | 3300042619 | Unclassified | 3844 |
| 192 | Ga0466726_071227 | 3300042619 | Bacteria | 17109 |
| 193 | Ga0466726_109783 | 3300042619 | Bacteria | 6647 |
| 194 | Ga0466726_201550 | 3300042619 | Bacteria | 7308 |
| 195 | Ga0466728_022952 | 3300042620 | Bacteria | 27241 |
| 196 | Ga0466729_000801 | 3300042621 | Bacteria | 11524 |
| 197 | Ga0466731_398861 | 3300042622 | Unclassified | 3141 |
| 198 | Ga0466735_230353 | 3300042624 | Unclassified | 2134 |
| 199 | Ga0466703_007157 | 3300042636 | Bacteria | 5233 |
| 200 | Ga0466703_280238 | 3300042636 | Bacteria | 14095 |
| 201 | Ga0466704_051440 | 3300042643 | Bacteria | 5364 |
| 202 | Ga0466724_59158 | 3300042649 | Bacteria | 434991 |
| 203 | Ga0466725_203672 | 3300042654 | Bacteria | 4248 |
| 204 | Ga0466727_291789 | 3300042655 | Bacteria | 2951 |
| 205 | Ga0160452_103286 | 3300012834 | Bacteria | 2920 |
| 206 | Ga0160443_100103 | 3300012848 | Bacteria | 135933 |
| 207 | Ga0160447_100006 | 3300012849 | Bacteria | 523520 |
| 208 | Ga0466657_003508 | 3300042582 | Unclassified | 4509 |
| 209 | Ga0466690_067883 | 3300042590 | Bacteria | 25448 |
| 210 | Ga0466690_151890 | 3300042590 | Bacteria | 10673 |
| 211 | Ga0466690_180464 | 3300042590 | Bacteria | 21519 |
| 212 | Ga0466690_194769 | 3300042590 | Bacteria | 14675 |
| 213 | Ga0466690_331201 | 3300042590 | Bacteria | 3884 |
| 214 | Ga0466690_363702 | 3300042590 | Unclassified | 10205 |
| 215 | Ga0466692_049439 | 3300042591 | Bacteria | 34933 |
| 216 | Ga0466691_007139 | 3300042593 | Bacteria | 16621 |
| 217 | Ga0466695_137738 | 3300042595 | Bacteria | 18247 |
| 218 | Ga0466696_186750 | 3300042596 | Bacteria | 14339 |
| 219 | Ga0466696_227789 | 3300042596 | Bacteria | 19027 |
| 220 | Ga0466696_231483 | 3300042596 | Bacteria | 9190 |
| 221 | Ga0466696_249762 | 3300042596 | Bacteria | 1681 |
| 222 | Ga0466696_251801 | 3300042596 | Bacteria | 32029 |
| 223 | Ga0466696_425966 | 3300042596 | Bacteria | 16995 |
| 224 | Ga0466701_022354 | 3300042598 | Bacteria | 90611 |
| 225 | Ga0466706_232010 | 3300042599 | Bacteria | 12846 |
| 226 | Ga0466707_267473 | 3300042601 | Bacteria | 4821 |
| 227 | Ga0466713_051288 | 3300042602 | Bacteria | 230715 |
| 228 | Ga0466713_053726 | 3300042602 | Bacteria | 131027 |
| 229 | Ga0466714_025046 | 3300042603 | Unclassified | 5405 |
| 230 | Ga0466714_073904 | 3300042603 | Bacteria | 61298 |
| 231 | Ga0466714_138886 | 3300042603 | Unclassified | 9720 |
| 232 | Ga0466716_040681 | 3300042605 | Bacteria | 25826 |
| 233 | Ga0466716_116615 | 3300042605 | Unclassified | 5862 |
| 234 | Ga0466722_092197 | 3300042609 | Bacteria | 4361 |
| 235 | IMNBL1DRAFT_c0003787 | 3300000062 | Bacteria | 9449 |
| 236 | IMNBL1DRAFT_c0004007 | 3300000062 | Bacteria | 9067 |
| 237 | JGI24702J35022_10009358 | 3300002462 | Bacteria | 5502 |
| 238 | JGI24696J40584_12939727 | 3300002834 | Bacteria | 1660 |
| 239 | Ga0068305_10043321 | 3300005083 | Bacteria | 18112 |
| 240 | Ga0068305_10284927 | 3300005083 | Bacteria | 3542 |
| 241 | Ga0072940_1088365 | 3300005200 | Bacteria | 3872 |
| 242 | Ga0102739_1000193 | 3300007095 | Unclassified | 15495 |
| 243 | Ga0102734_1000959 | 3300007129 | Bacteria | 7422 |
| 244 | Ga0104019_1001005 | 3300007150 | Unclassified | 12340 |
| 245 | Ga0127649_100174 | 3300009460 | Bacteria | 78472 |
| 246 | Ga0466697_092882 | 3300042611 | Bacteria | 1627 |
| 247 | Ga0466697_270390 | 3300042611 | Bacteria | 1716 |
| 248 | Ga0466705_132766 | 3300042612 | Bacteria | 3669 |
| 249 | Ga0466705_167707 | 3300042612 | Bacteria | 17711 |
| 250 | Ga0466705_218688 | 3300042612 | Bacteria | 18247 |
| 251 | Ga0466733_058170 | 3300042659 | Bacteria | 4105 |
| 252 | Ga0466733_149506 | 3300042659 | Bacteria | 259198 |
| 253 | Ga0466705_387685 | 3300042612 | Bacteria | 25158 |
| 254 | Ga0466715_013436 | 3300042616 | Bacteria | 15245 |
| 255 | Ga0466715_016212 | 3300042616 | Unclassified | 4014 |
| 256 | Ga0466715_026465 | 3300042616 | Bacteria | 99999 |
| 257 | Ga0466715_093785 | 3300042616 | Unclassified | 8612 |
| 258 | Ga0466723_105590 | 3300042618 | Unclassified | 12718 |
| 259 | Ga0466726_254472 | 3300042619 | Bacteria | 24092 |
| 260 | Ga0466728_079802 | 3300042620 | Unclassified | 5930 |
| 261 | Ga0466729_317602 | 3300042621 | Bacteria | 6614 |
| 262 | Ga0466735_008107 | 3300042624 | Bacteria | 13453 |
| 263 | Ga0466703_226497 | 3300042636 | Bacteria | 6257 |
| 264 | Ga0466703_328965 | 3300042636 | Bacteria | 16920 |
| 265 | Ga0466709_168950 | 3300042648 | Bacteria | 102495 |
| 266 | Ga0123355_10000826 | 3300009826 | Bacteria | 42466 |
| 267 | Ga0123356_10066745 | 3300010049 | Bacteria | 3368 |
| 268 | Ga0123353_10021212 | 3300010167 | Bacteria | 9742 |
| 269 | Ga0160469_100009 | 3300012824 | Bacteria | 501889 |
| 270 | Ga0160457_1000731 | 3300012858 | Unclassified | 12191 |
| 271 | Ga0466656_317927 | 3300042550 | Bacteria | 5145 |
| 272 | Ga0466657_193109 | 3300042582 | Unclassified | 1578 |
| 273 | Ga0466690_061180 | 3300042590 | Bacteria | 3734 |
| 274 | Ga0466690_240553 | 3300042590 | Bacteria | 10530 |
| 275 | Ga0466692_140391 | 3300042591 | Bacteria | 136970 |
| 276 | Ga0466692_164433 | 3300042591 | Bacteria | 17639 |
| 277 | Ga0466693_261588 | 3300042592 | Bacteria | 1408 |
| 278 | Ga0466691_043201 | 3300042593 | Unclassified | 5288 |
| 279 | Ga0466691_062517 | 3300042593 | Bacteria | 6277 |
| 280 | Ga0466694_190897 | 3300042594 | Bacteria | 1539 |
| 281 | Ga0466706_117401 | 3300042599 | Bacteria | 58341 |
| 282 | Ga0466700_047243 | 3300042600 | Bacteria | 3138 |
| 283 | Ga0466713_002968 | 3300042602 | Bacteria | 39868 |
| 284 | Ga0466716_269395 | 3300042605 | Unclassified | 3496 |
| 285 | Ga0466719_164105 | 3300042606 | Bacteria | 16766 |
| 286 | Ga0466719_335540 | 3300042606 | Bacteria | 6964 |
| 287 | Ga0466722_237009 | 3300042609 | Bacteria | 39389 |
| 288 | 2227494079 | 2225789004 | Unclassified | 20129 |
| 289 | IMNBL1DRAFT_c0000385 | 3300000062 | Bacteria | 37776 |
| 290 | IMNBL1DRAFT_c0001216 | 3300000062 | Bacteria | 19460 |
| 291 | IMNBL1DRAFT_c0005283 | 3300000062 | Bacteria | 7440 |
| 292 | JGI24698J34947_10010851 | 3300002449 | Bacteria | 4999 |
| 293 | JGI24702J35022_10038039 | 3300002462 | Bacteria | 2569 |
| 294 | Ga0068302_10022450 | 3300005071 | Bacteria | 3858 |
| 295 | Ga0068305_10004429 | 3300005083 | Bacteria | 74318 |
| 296 | Ga0102736_1000105 | 3300007052 | Bacteria | 20707 |
| 297 | Ga0102735_1000469 | 3300007080 | Unclassified | 8615 |
| 298 | Ga0102735_1002040 | 3300007080 | Bacteria | 3217 |
| 299 | Ga0104045_1004203 | 3300007085 | Bacteria | 28908 |
| 300 | Ga0102734_1000018 | 3300007129 | Bacteria | 153503 |
| 301 | Ga0466705_087122 | 3300042612 | Bacteria | 8134 |
| 302 | Ga0466705_189690 | 3300042612 | Bacteria | 49890 |
| 303 | Ga0466733_061268 | 3300042659 | Bacteria | 3185 |
| 304 | Ga0466733_134872 | 3300042659 | Bacteria | 1375 |
| 305 | Ga0466733_171714 | 3300042659 | Bacteria | 6474 |
| 306 | Ga0466711_134684 | 3300042615 | Bacteria | 7473 |
| 307 | Ga0466711_430183 | 3300042615 | Bacteria | 17883 |
| 308 | Ga0466715_252590 | 3300042616 | Bacteria | 4884 |
| 309 | Ga0466715_390893 | 3300042616 | Bacteria | 20476 |
| 310 | Ga0466723_115330 | 3300042618 | Bacteria | 13796 |
| 311 | Ga0466723_235844 | 3300042618 | Bacteria | 9611 |
| 312 | Ga0466726_083930 | 3300042619 | Bacteria | 23331 |
| 313 | Ga0466726_322645 | 3300042619 | Bacteria | 1647 |
| 314 | Ga0466728_014191 | 3300042620 | Bacteria | 23709 |
| 315 | Ga0466728_057961 | 3300042620 | Bacteria | 56835 |
| 316 | Ga0466728_080946 | 3300042620 | Unclassified | 4012 |
| 317 | Ga0466728_209203 | 3300042620 | Unclassified | 2175 |
| 318 | Ga0466734_131868 | 3300042623 | Bacteria | 9244 |
| 319 | Ga0466735_112054 | 3300042624 | Bacteria | 4479 |
| 320 | Ga0466735_183094 | 3300042624 | Bacteria | 1722 |
| 321 | Ga0466704_147711 | 3300042643 | Bacteria | 31590 |
| 322 | Ga0466704_243226 | 3300042643 | Bacteria | 34984 |
| 323 | Ga0466708_238897 | 3300042652 | Bacteria | 18116 |
| 324 | Ga0466708_339067 | 3300042652 | Bacteria | 18104 |
| 325 | Ga0466708_346087 | 3300042652 | Bacteria | 11427 |
| 326 | Ga0123356_10207614 | 3300010049 | Bacteria | 2004 |
| 327 | Ga0123356_10265608 | 3300010049 | Unclassified | 1803 |
| 328 | Ga0123353_10010171 | 3300010167 | Bacteria | 13084 |
| 329 | Ga0123353_10203409 | 3300010167 | Unclassified | 3113 |
| 330 | Ga0123354_10230169 | 3300010882 | Bacteria | 1940 |
| 331 | Ga0160458_100060 | 3300012832 | Bacteria | 140698 |
| 332 | Ga0160472_101483 | 3300012839 | Unclassified | 6802 |
| 333 | Ga0466657_076460 | 3300042582 | Bacteria | 2130 |
| 334 | Ga0466690_034492 | 3300042590 | Bacteria | 29612 |
| 335 | Ga0466690_204755 | 3300042590 | Bacteria | 15717 |
| 336 | Ga0466693_057383 | 3300042592 | Bacteria | 5104 |
| 337 | Ga0466696_027720 | 3300042596 | Bacteria | 2050 |
| 338 | Ga0466701_042299 | 3300042598 | Bacteria | 109601 |
| 339 | Ga0466701_089590 | 3300042598 | Bacteria | 18273 |
| 340 | Ga0466706_023445 | 3300042599 | Bacteria | 17085 |
| 341 | Ga0466706_119637 | 3300042599 | Bacteria | 69405 |
| 342 | Ga0466706_180985 | 3300042599 | Bacteria | 37102 |
| 343 | Ga0466714_139082 | 3300042603 | Bacteria | 1649 |
| 344 | Ga0466714_167921 | 3300042603 | Bacteria | 2068 |
| 345 | Ga0466716_088098 | 3300042605 | Unclassified | 5048 |
| 346 | Ga0466716_131712 | 3300042605 | Bacteria | 12897 |
| 347 | Ga0466722_059385 | 3300042609 | Bacteria | 7658 |
| 348 | Ga0466722_149542 | 3300042609 | Bacteria | 4478 |
| 349 | 2226980370 | 2225789003 | Bacteria | 34275 |
| 350 | 2227591283 | 2225789004 | Bacteria | 48146 |
| 351 | JGI24702J35022_10000272 | 3300002462 | Bacteria | 29833 |
| 352 | JGI24702J35022_10013458 | 3300002462 | Bacteria | 4533 |
| 353 | Ga0072941_1051957 | 3300005201 | Bacteria | 5227 |
| 354 | Ga0466697_197874 | 3300042611 | Bacteria | 1764 |
| 355 | Ga0466697_197952 | 3300042611 | Bacteria | 1839 |
| 356 | Ga0466697_258576 | 3300042611 | Bacteria | 357278 |
| 357 | Ga0466733_004006 | 3300042659 | Bacteria | 20198 |
| 358 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 359 | Ga0466711_049876 | 3300042615 | Bacteria | 15188 |
| 360 | Ga0466711_060056 | 3300042615 | Bacteria | 6933 |
| 361 | Ga0466711_064762 | 3300042615 | Bacteria | 8041 |
| 362 | Ga0466715_030152 | 3300042616 | Bacteria | 18234 |
| 363 | Ga0466715_057287 | 3300042616 | Bacteria | 64422 |
| 364 | Ga0466715_120111 | 3300042616 | Bacteria | 5676 |
| 365 | Ga0466715_162315 | 3300042616 | Bacteria | 3831 |
| 366 | Ga0466723_173895 | 3300042618 | Bacteria | 21466 |
| 367 | Ga0466728_045299 | 3300042620 | Bacteria | 12846 |
| 368 | Ga0466728_089018 | 3300042620 | Unclassified | 8019 |
| 369 | Ga0466728_368316 | 3300042620 | Unclassified | 2181 |
| 370 | Ga0466734_014527 | 3300042623 | Bacteria | 1671 |
| 371 | Ga0466735_043752 | 3300042624 | Bacteria | 2865 |
| 372 | Ga0466735_138548 | 3300042624 | Bacteria | 3338 |
| 373 | Ga0466704_049875 | 3300042643 | Bacteria | 80175 |
| 374 | Ga0466704_055014 | 3300042643 | Unclassified | 3291 |
| 375 | Ga0466704_400901 | 3300042643 | Bacteria | 1882 |
| 376 | Ga0466709_029951 | 3300042648 | Bacteria | 9902 |
| 377 | Ga0466709_290682 | 3300042648 | Bacteria | 11675 |
| 378 | Ga0466709_305172 | 3300042648 | Bacteria | 3531 |
| 379 | Ga0466709_309548 | 3300042648 | Bacteria | 4439 |
| 380 | Ga0466708_109208 | 3300042652 | Unclassified | 4243 |
| 381 | Ga0466708_361052 | 3300042652 | Bacteria | 8255 |
| 382 | Ga0466727_086473 | 3300042655 | Bacteria | 79442 |
| 383 | Ga0466727_177004 | 3300042655 | Bacteria | 13775 |
| 384 | Ga0123356_10214886 | 3300010049 | Bacteria | 1975 |
| 385 | Ga0123353_10013963 | 3300010167 | Bacteria | 11550 |
| 386 | Ga0123353_10064763 | 3300010167 | Bacteria | 5866 |
| 387 | Ga0160453_100001 | 3300012814 | Bacteria | 1272344 |
| 388 | Ga0160432_100021 | 3300012818 | Bacteria | 277406 |
| 389 | Ga0160445_100314 | 3300012847 | Bacteria | 29216 |
| 390 | Ga0160443_100171 | 3300012848 | Bacteria | 88828 |
| 391 | Ga0466656_040575 | 3300042550 | Bacteria | 1221 |
| 392 | Ga0466656_157152 | 3300042550 | Unclassified | 6041 |
| 393 | Ga0466690_006496 | 3300042590 | Unclassified | 5051 |
| 394 | Ga0466692_160784 | 3300042591 | Bacteria | 15201 |
| 395 | Ga0466691_025844 | 3300042593 | Bacteria | 10655 |
| 396 | Ga0466691_057084 | 3300042593 | Unclassified | 7152 |
| 397 | Ga0466695_384124 | 3300042595 | Bacteria | 90029 |
| 398 | Ga0466696_089569 | 3300042596 | Bacteria | 9739 |
| 399 | Ga0466696_235855 | 3300042596 | Bacteria | 10581 |
| 400 | Ga0466706_004878 | 3300042599 | Bacteria | 43826 |
| 401 | Ga0466706_084442 | 3300042599 | Bacteria | 7933 |
| 402 | Ga0466706_133651 | 3300042599 | Bacteria | 2575 |
| 403 | Ga0466713_008124 | 3300042602 | Bacteria | 13696 |
| 404 | Ga0466713_047540 | 3300042602 | Bacteria | 17647 |
| 405 | Ga0466713_140312 | 3300042602 | Bacteria | 9594 |
| 406 | Ga0466714_158208 | 3300042603 | Bacteria | 17679 |
| 407 | Ga0466716_219107 | 3300042605 | Bacteria | 5919 |
| 408 | Ga0466716_546477 | 3300042605 | Bacteria | 2203 |
| 409 | Ga0466719_154290 | 3300042606 | Bacteria | 1582 |
| 410 | Ga0466722_036184 | 3300042609 | Bacteria | 3484 |
| 411 | Ga0466722_159443 | 3300042609 | Bacteria | 1425 |
| 412 | Ga0466698_454823 | 3300042610 | Bacteria | 1647 |
| 413 | IMNBL1DRAFT_c0000563 | 3300000062 | Bacteria | 29996 |
| 414 | IMNBL1DRAFT_c0006020 | 3300000062 | Unclassified | 6761 |
| 415 | IMNBL1DRAFT_c0020771 | 3300000062 | Unclassified | 2647 |
| 416 | JGI24705J35276_12212192 | 3300002504 | Bacteria | 1881 |
| 417 | Ga0068305_10122642 | 3300005083 | Unclassified | 5177 |
| 418 | Ga0103265_1000004 | 3300007068 | Bacteria | 111958 |
| 419 | Ga0104045_1004299 | 3300007085 | Bacteria | 6859 |
| 420 | Ga0102740_1000713 | 3300007140 | Unclassified | 9635 |
| 421 | Ga0102737_1000070 | 3300007142 | Bacteria | 41738 |
| 422 | Ga0466705_057337 | 3300042612 | Bacteria | 16149 |
| 423 | Ga0466705_099249 | 3300042612 | Bacteria | 16129 |
| 424 | Ga0466733_042684 | 3300042659 | Unclassified | 3746 |
| 425 | Ga0466733_104753 | 3300042659 | Bacteria | 8628 |
| 426 | Ga0466733_121932 | 3300042659 | Bacteria | 10286 |
| 427 | Ga0466710_299403 | 3300042613 | Bacteria | 1261 |
| 428 | Ga0466710_367408 | 3300042613 | Unclassified | 1953 |
| 429 | Ga0466711_251215 | 3300042615 | Bacteria | 5494 |
| 430 | Ga0466715_430888 | 3300042616 | Bacteria | 10127 |
| 431 | Ga0466715_502879 | 3300042616 | Bacteria | 8243 |
| 432 | Ga0466723_046692 | 3300042618 | Bacteria | 31931 |
| 433 | Ga0466723_075423 | 3300042618 | Bacteria | 9386 |
| 434 | Ga0466735_079459 | 3300042624 | Unclassified | 4164 |
| 435 | Ga0466703_302960 | 3300042636 | Bacteria | 6569 |
| 436 | Ga0466703_395369 | 3300042636 | Bacteria | 13597 |
| 437 | Ga0466703_399369 | 3300042636 | Bacteria | 29558 |
| 438 | Ga0466704_184392 | 3300042643 | Bacteria | 15465 |
| 439 | Ga0466704_186162 | 3300042643 | Bacteria | 33085 |
| 440 | Ga0466709_041136 | 3300042648 | Unclassified | 3999 |
| 441 | Ga0466709_169139 | 3300042648 | Bacteria | 148698 |
| 442 | Ga0466724_67935 | 3300042649 | Bacteria | 3784 |
| 443 | Ga0466708_039357 | 3300042652 | Bacteria | 5322 |
| 444 | Ga0466708_080877 | 3300042652 | Bacteria | 32642 |
| 445 | Ga0466708_225613 | 3300042652 | Unclassified | 4162 |
| 446 | Ga0466725_063274 | 3300042654 | Unclassified | 2470 |
| 447 | Ga0466725_211317 | 3300042654 | Bacteria | 17907 |
| 448 | Ga0466727_091545 | 3300042655 | Bacteria | 15378 |
| 449 | Ga0466727_167399 | 3300042655 | Bacteria | 32565 |
| 450 | Ga0123356_10091058 | 3300010049 | Bacteria | 2906 |
| 451 | Ga0123353_10000002 | 3300010167 | Bacteria | 351672 |
| 452 | Ga0123353_10083564 | 3300010167 | Bacteria | 5138 |
| 453 | Ga0123353_10123585 | 3300010167 | Bacteria | 4160 |
| 454 | Ga0123353_10162318 | 3300010167 | Bacteria | 3556 |
| 455 | Ga0123354_10164792 | 3300010882 | Bacteria | 2611 |
| 456 | Ga0160455_103542 | 3300012837 | Unclassified | 2320 |
| 457 | Ga0264413_151040 | 3300024493 | Bacteria | 2598 |
| 458 | Ga0466690_006206 | 3300042590 | Unclassified | 5741 |
| 459 | Ga0466690_287825 | 3300042590 | Unclassified | 7174 |
| 460 | Ga0466696_011713 | 3300042596 | Bacteria | 3716 |
| 461 | Ga0466701_097648 | 3300042598 | Unclassified | 7746 |
| 462 | Ga0466706_170625 | 3300042599 | Bacteria | 21733 |
| 463 | Ga0466707_029505 | 3300042601 | Bacteria | 2005 |
| 464 | Ga0466714_035808 | 3300042603 | Bacteria | 5129 |
| 465 | Ga0466716_519086 | 3300042605 | Bacteria | 9567 |
| 466 | Ga0466722_176107 | 3300042609 | Bacteria | 9411 |
| 467 | JGI24702J35022_10002270 | 3300002462 | Bacteria | 11793 |
| 468 | JGI24702J35022_10004890 | 3300002462 | Bacteria | 7904 |
| 469 | CVPL010W_10004441 | 3300002931 | Bacteria | 15550 |
| 470 | Ga0068305_10000087 | 3300005083 | Bacteria | 586632 |
| 471 | Ga0072941_1266814 | 3300005201 | Bacteria | 3920 |
| 472 | Ga0103265_1002560 | 3300007068 | Bacteria | 5114 |
| 473 | Ga0102734_1007120 | 3300007129 | Bacteria | 2522 |
| 474 | Ga0102740_1000450 | 3300007140 | Bacteria | 11404 |
| 475 | Ga0104050_1001501 | 3300007153 | Bacteria | 4799 |
| 476 | Ga0103267_1000438 | 3300007190 | Bacteria | 25685 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF13184 | GO:0003723 | RNA binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.