Protein Family IF09936

Metagenome Isolate
149 Members
52 Samples
137 Scaffolds
1153.39 Avg Length

🧬 Representative Sequence

ID
3300042652|Ga0466708_228165|Ga0466708_228165_19468_23154
Length
1228 aa
Sequence
MRLFQKQPLNKNTIRKETVFLRGERMARQSYGVTPWGKWFIDVLDSYRMDARLNRGKTYANTGKVLSLEFNERKAVAKVKGNYRPSYKVEIEFPPLEEQEKAEVLRLIEEDTALVAQIAAGELPESFLQKLKRSGINLIPKRWKDMRRSCNCPDYGDPCKHEAAIYYVIAREIDADPHILFRLRGIDLAVLTAKFGAGLETAVIEPPFSVESGPAERETPALPPEFPAIPHCAGLILSLLAEAPFQSGKDFTVALAEFYHRAARADVWQYTGKDEGRESLFSHSQWTLECAPAHRKQKPKPGADLILVRHGISGETEQYTVYEALSFFRSFSSEKGTLSYTFLYYTAKFLGLLCVSEAFIPSVLLEDGELCIVWQPFKALPAIRGALESLSLFDSGILELESGGKRKKAVYADGRSTVTLLASAMLGEYAKRSYTARRGTGELVQVFFQGTSLDVSSPAVRSLPLAVSKWLSVLHTDFSGGRRTPPVPGVVPVSEAVPVAVTADDASPRKAPGSSPVAGSMAGAAYTYRLLMGAPVQKKGGDAAADREPEFSLAMEVLFEREDATEKAPLKDAAKLTGSIEVLKAPTLLSHYLPELRSLLSRKTVKLAGDRLSDFLDNAAPLLETLGIELVFPKSLRRELKPRLVLQASAKEGAKAGSLVSYLNLNSLLDWQWQVAIGDELISREEFAALLAQKRAVVQFHNTFVRIDPAELSRLLRQTEARAPGLNDFLKYHLSGDSVLAFDAKEIIEKLFNEREYTVPPSLKAELRPYQQRGYNWICSLLYAGFGCILADDMGLGKTVQSIAAMLRLNDDGLLGDGCLIIAPAALLSNWERELARFAPSLRVFRYHGAGRHFADACDVMLTTYQTAARDNAKLVQHTFSLLVVDEAHLMKNAEAKSVKAVKQLRSRFTLALSGTPVENRLEDLRSLFDFVLPGYLGTAAQFKDAYRYPVEVMRNREAAEKLKKITAPFLLRRLKTDKAVISDLPEKIISNEYALLEKGQAALYESVVTEILKKSEQIEEGQGRSALILTLLTSLKQICDHPRVYDKESPALSSLSGKAQLLXXLLEEILTGGEKTLIFSQYVETLDCLEQIIRKEMGEAALCYHGGLSQKNRAAVISRFQNDPASRILLVSLRAGGLGLNLTAASRVIHYDLWYNPAVENQATDRSFRIGQTRNVFVHRFITRNSFEEKIDAMLTAKRELADMTVSSGESWLARMSHEELKTLFDR

📊 Sample Types

Isolate 8.1%
Metagenome 92.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 36.0%
Kalotermitidae 28.0%
Unclassified 26.0%
Termopsidae 6.0%
Rhinotermitidae 4.0%

🌳 Taxonomy

Archaea 0
Bacteria 145
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
2 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
3 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
4 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
5 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
6 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
7 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
8 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
9 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
10 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
11 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
12 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
13 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
14 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
15 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
16 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
17 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
18 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
19 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
20 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
21 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
22 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
23 2781125639 Treponema sp. Co191P1bin44 Isolate Unclassified
24 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
25 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
26 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
27 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
28 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
29 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
30 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
31 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
32 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
33 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
34 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
35 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
36 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
37 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
38 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
39 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
40 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
41 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
42 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
43 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
44 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
45 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
46 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
47 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
48 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
49 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
50 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
51 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
52 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466690_110429 3300042590 Bacteria 63009
2 Ga0466690_414749 3300042590 Bacteria 14351
3 Ga0466691_001806 3300042593 Bacteria 16193
4 Ga0466691_010702 3300042593 Bacteria 18609
5 Ga0466691_216086 3300042593 Bacteria 33762
6 Ga0466694_055111 3300042594 Bacteria 6060
7 Ga0466696_023207 3300042596 Bacteria 24784
8 Ga0466704_111914 3300042643 Bacteria 32572
9 Ga0466712_211291 3300042614 Bacteria 16887
10 Ga0466712_314711 3300042614 Bacteria 28321
11 Ga0466715_253208 3300042616 Bacteria 4031
12 Ga0466718_024492 3300042617 Bacteria 8459
13 Ga0466723_195288 3300042618 Bacteria 39093
14 Ga0466726_046320 3300042619 Bacteria 3644
15 Ga0123357_10007863 3300009784 Bacteria 13250
16 JGI24698J34947_10000275 3300002449 Bacteria 22092
17 JGI24695J34938_10012039 3300002450 Bacteria 4611
18 Ga0466705_029237 3300042612 Bacteria 16966
19 Ga0466693_074523 3300042592 Bacteria 6519
20 Ga0466693_118917 3300042592 Bacteria 16184
21 Ga0466691_017652 3300042593 Bacteria 8785
22 Ga0466694_097391 3300042594 Bacteria 28972
23 Ga0466709_134433 3300042648 Bacteria 13650
24 Ga0466709_394506 3300042648 Bacteria 15199
25 Ga0466708_275417 3300042652 Bacteria 3876
26 Ga0466727_192939 3300042655 Bacteria 5377
27 Ga0466716_000750 3300042605 Bacteria 8585
28 Ga0466716_103555 3300042605 Bacteria 28428
29 Ga0466719_054906 3300042606 Unclassified 20233
30 Ga0466719_114180 3300042606 Bacteria 19353
31 Ga0466720_146325 3300042607 Bacteria 5274
32 Ga0466711_107634 3300042615 Bacteria 27645
33 Ga0466711_511149 3300042615 Bacteria 5233
34 Ga0466715_450562 3300042616 Bacteria 17198
35 Ga0466718_006290 3300042617 Bacteria 4418
36 Ga0466726_170186 3300042619 Bacteria 11009
37 Ga0123356_10001263 3300010049 Bacteria 27963
38 JGI24698J34947_10002317 3300002449 Bacteria 10227
39 JGI24698J34947_10004126 3300002449 Bacteria 7878
40 JGI24695J34938_10006420 3300002450 Bacteria 7069
41 JGI24695J34938_10007923 3300002450 Bacteria 6142
42 JGI24695J34938_10008463 3300002450 Bacteria 5862
43 Ga0264413_100634 3300024493 Bacteria 21808
44 Ga0466692_031254 3300042591 Bacteria 11990
45 Ga0466703_097389 3300042636 Bacteria 65902
46 Ga0466719_111220 3300042606 Bacteria 6388
47 Ga0466721_202594 3300042608 Bacteria 33171
48 Ga0466711_196122 3300042615 Bacteria 16619
49 Ga0466723_025107 3300042618 Bacteria 5360
50 Ga0123355_10002514 3300009826 Bacteria 25962
51 Ga0466690_110383 3300042590 Bacteria 12698
52 Ga0466692_058889 3300042591 Bacteria 41705
53 Ga0466694_286193 3300042594 Bacteria 3746
54 Ga0466696_352339 3300042596 Bacteria 5923
55 Ga0466699_133344 3300042597 Bacteria 12324
56 Ga0466716_363303 3300042605 Bacteria 4581
57 Ga0466723_090735 3300042618 Bacteria 19426
58 Ga0466726_158377 3300042619 Bacteria 8665
59 Ga0466726_451350 3300042619 Bacteria 4307
60 JGI24695J34938_10000485 3300002450 Unclassified 38557
61 JGI24695J34938_10000612 3300002450 Bacteria 34215
62 JGI24695J34938_10016056 3300002450 Bacteria 3823
63 Ga0072940_1029207 3300005200 Bacteria 10311
64 Ga0466732_047537 3300042656 Bacteria 7187
65 Ga0466690_031446 3300042590 Unclassified 3891
66 Ga0466691_133046 3300042593 Bacteria 13605
67 Ga0466704_246533 3300042643 Bacteria 11903
68 Ga0466708_064747 3300042652 Bacteria 12481
69 Ga0466720_222971 3300042607 Bacteria 6854
70 Ga0466698_170825 3300042610 Bacteria 29162
71 Ga0466712_014717 3300042614 Bacteria 3229
72 Ga0466723_131749 3300042618 Bacteria 25706
73 Ga0466726_005380 3300042619 Bacteria 8558
74 Ga0466726_437084 3300042619 Bacteria 13982
75 Ga0466728_217777 3300042620 Bacteria 16071
76 JGI24698J34947_10001060 3300002449 Bacteria 14152
77 JGI24698J34947_10002258 3300002449 Bacteria 10321
78 JGI24695J34938_10002485 3300002450 Bacteria 14065
79 JGI24695J34938_10006175 3300002450 Bacteria 7280
80 Ga0072941_1004016 3300005201 Bacteria 18352
81 Ga0466705_150694 3300042612 Bacteria 5764
82 Ga0264413_101923 3300024493 Bacteria 13183
83 Ga0264413_113985 3300024493 Bacteria 28252
84 Ga0466735_090030 3300042624 Bacteria 5418
85 Ga0466703_016621 3300042636 Bacteria 8403
86 Ga0466703_126419 3300042636 Bacteria 30129
87 Ga0466713_075514 3300042602 Bacteria 32547
88 Ga0466716_319149 3300042605 Bacteria 14086
89 Ga0466716_366123 3300042605 Bacteria 6597
90 Ga0466720_049778 3300042607 Bacteria 14957
91 Ga0466720_088923 3300042607 Bacteria 14463
92 Ga0466720_146393 3300042607 Unclassified 4444
93 Ga0466705_397724 3300042612 Bacteria 6860
94 Ga0466712_115862 3300042614 Bacteria 12334
95 Ga0466712_162753 3300042614 Bacteria 24897
96 Ga0466718_038687 3300042617 Bacteria 45428
97 Ga0466723_068107 3300042618 Bacteria 6116
98 Ga0466723_273170 3300042618 Bacteria 8503
99 Ga0466726_222121 3300042619 Bacteria 5418
100 Ga0123356_10000435 3300010049 Bacteria 47721
101 Ga0123356_10000619 3300010049 Bacteria 39296
102 JGI24695J34938_10001263 3300002450 Bacteria 22240
103 JGI24695J34938_10005087 3300002450 Bacteria 8350
104 Ga0072941_1004946 3300005201 Bacteria 12617
105 Ga0466691_161249 3300042593 Bacteria 15708
106 Ga0466735_107291 3300042624 Bacteria 10116
107 Ga0466703_044868 3300042636 Bacteria 6812
108 Ga0466708_148653 3300042652 Bacteria 7027
109 Ga0466720_056326 3300042607 Bacteria 5991
110 Ga0466712_010679 3300042614 Bacteria 17309
111 Ga0466711_017224 3300042615 Bacteria 15781
112 Ga0466711_232762 3300042615 Bacteria 31318
113 Ga0466718_006614 3300042617 Bacteria 30223
114 Ga0466718_034112 3300042617 Bacteria 10434
115 AustNasuHG_c1000195 3300000089 Bacteria 20033
116 JGI24698J34947_10005054 3300002449 Bacteria 7226
117 JGI24698J34947_10006212 3300002449 Bacteria 6564
118 JGI24695J34938_10001625 3300002450 Bacteria 18766
119 Ga0072941_1001683 3300005201 Bacteria 28325
120 Ga0466732_025530 3300042656 Bacteria 7962
121 Ga0456237_0000565 3300041968 Bacteria 5626
122 Ga0466692_109230 3300042591 Bacteria 22637
123 Ga0466693_011165 3300042592 Bacteria 16366
124 Ga0466694_125080 3300042594 Bacteria 16029
125 Ga0466704_398818 3300042643 Bacteria 13260
126 Ga0466708_228165 3300042652 Bacteria 31519
127 Ga0466708_257706 3300042652 Bacteria 10209
128 Ga0466719_340314 3300042606 Bacteria 4532
129 Ga0466719_346726 3300042606 Bacteria 4283
130 Ga0466711_165132 3300042615 Bacteria 7161
131 Ga0466715_267195 3300042616 Bacteria 6339
132 Ga0466723_163254 3300042618 Bacteria 7845
133 Ga0123354_10043915 3300010882 Bacteria 6863
134 AustNasuHG_c1006144 3300000089 Bacteria 4293
135 JGI24698J34947_10004094 3300002449 Bacteria 7908
136 JGI24695J34938_10000137 3300002450 Bacteria 66242
137 JGI24702J35022_10005051 3300002462 Bacteria 7774

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042614 Ga0466712_014717 Ga0466712_014717_95_3139 1014
2 3300042648 Ga0466709_394506 Ga0466709_394506_11996_15172 1026
3 3300042619 Ga0466726_046320 Ga0466726_046320_25_3150 1041
4 iso_pr_bacteria 2781125649 2781307159 1042
5 3300042616 Ga0466715_253208 Ga0466715_253208_668_3934 1061
6 3300042607 Ga0466720_146325 Ga0466720_146325_1966_5205 1079
7 3300002449 JGI24698J34947_10002317 JGI24698J34947_100023178 1096
8 3300005200 Ga0072940_1029207 Ga0072940_10292076 1100
9 3300002449 JGI24698J34947_10001060 JGI24698J34947_100010609 1107
10 3300042614 Ga0466712_010679 Ga0466712_010679_2511_5924 1114
11 3300042614 Ga0466712_115862 Ga0466712_115862_3035_6481 1118
12 3300042614 Ga0466712_162753 Ga0466712_162753_13797_17201 1120
13 3300042615 Ga0466711_017224 Ga0466711_017224_12164_15529 1121
14 3300042614 Ga0466712_211291 Ga0466712_211291_10172_13576 1123
15 3300002449 JGI24698J34947_10006212 JGI24698J34947_100062124 1124
16 3300042594 Ga0466694_286193 Ga0466694_286193_23_3397 1124
17 3300042636 Ga0466703_126419 Ga0466703_126419_14713_18255 1125
18 3300002449 JGI24698J34947_10002258 JGI24698J34947_100022584 1126
19 3300002449 JGI24698J34947_10005054 JGI24698J34947_100050545 1129
20 3300042607 Ga0466720_056326 Ga0466720_056326_2420_5875 1129
21 3300042615 Ga0466711_107634 Ga0466711_107634_23779_27210 1131
22 3300002450 JGI24695J34938_10006420 JGI24695J34938_100064204 1132
23 3300042618 Ga0466723_090735 Ga0466723_090735_13878_17423 1134
24 3300002449 JGI24698J34947_10000275 JGI24698J34947_100002758 1135
25 iso_pr_bacteria 2781125655 2781317867 1136
26 3300009826 Ga0123355_10002514 Ga0123355_100025148 1137
27 3300042606 Ga0466719_114180 Ga0466719_114180_619_4077 1137
28 3300042590 Ga0466690_031446 Ga0466690_031446_312_3755 1138
29 3300042617 Ga0466718_024492 Ga0466718_024492_1831_5316 1138
30 3300042619 Ga0466726_158377 Ga0466726_158377_3827_7342 1139
31 3300009784 Ga0123357_10007863 Ga0123357_1000786310 1140
32 3300042643 Ga0466704_398818 Ga0466704_398818_7916_11467 1140
33 3300002462 JGI24702J35022_10005051 JGI24702J35022_100050514 1141
34 3300042615 Ga0466711_511149 Ga0466711_511149_1589_5083 1141
35 3300002450 JGI24695J34938_10001263 JGI24695J34938_1000126320 1142
36 3300042590 Ga0466690_110429 Ga0466690_110429_50003_53467 1142
37 3300042643 Ga0466704_246533 Ga0466704_246533_514_4071 1143
38 iso_pr_bacteria 2781125639 2781286016 1143
39 3300042590 Ga0466690_110383 Ga0466690_110383_5162_8773 1144
40 3300042605 Ga0466716_366123 Ga0466716_366123_1421_4984 1145
41 3300005201 Ga0072941_1004946 Ga0072941_10049469 1146
42 3300024493 Ga0264413_101923 Ga0264413_1019236 1146
43 3300042612 Ga0466705_150694 Ga0466705_150694_1967_5434 1146
44 3300042615 Ga0466711_165132 Ga0466711_165132_3659_7150 1146
45 3300042618 Ga0466723_025107 Ga0466723_025107_1584_5111 1147
46 3300042606 Ga0466719_111220 Ga0466719_111220_1361_4807 1148
47 iso_pr_bacteria 2781125692 2781432171 1148
48 3300024493 Ga0264413_100634 Ga0264413_1006345 1149
49 3300042605 Ga0466716_319149 Ga0466716_319149_4342_7992 1149
50 iso_pr_bacteria 2781125656 2781320910 1149
51 3300042618 Ga0466723_163254 Ga0466723_163254_1370_4861 1150
52 3300042624 Ga0466735_090030 Ga0466735_090030_1379_4831 1150
53 3300042656 Ga0466732_047537 Ga0466732_047537_3650_7123 1150
54 3300042606 Ga0466719_340314 Ga0466719_340314_80_3535 1151
55 3300042620 Ga0466728_217777 Ga0466728_217777_952_4500 1151
56 3300002450 JGI24695J34938_10000137 JGI24695J34938_1000013747 1153
57 3300010049 Ga0123356_10000619 Ga0123356_1000061931 1153
58 3300042607 Ga0466720_049778 Ga0466720_049778_297_3758 1153
59 3300042607 Ga0466720_222971 Ga0466720_222971_276_3737 1153
60 3300041968 Ga0456237_0000565 Ga0456237_0000565_1246_4710 1154
61 3300042618 Ga0466723_195288 Ga0466723_195288_21600_25064 1154
62 3300042593 Ga0466691_017652 Ga0466691_017652_2837_6304 1155
63 3300002450 JGI24695J34938_10006175 JGI24695J34938_100061752 1156
64 3300024493 Ga0264413_113985 Ga0264413_11398513 1156
65 3300042594 Ga0466694_097391 Ga0466694_097391_7988_11458 1156
66 3300042610 Ga0466698_170825 Ga0466698_170825_11339_14809 1156
67 3300010882 Ga0123354_10043915 Ga0123354_100439153 1157
68 3300042593 Ga0466691_161249 Ga0466691_161249_11320_14793 1157
69 3300042606 Ga0466719_054906 Ga0466719_054906_223_3696 1157
70 3300042608 Ga0466721_202594 Ga0466721_202594_23786_27346 1157
71 3300042612 Ga0466705_029237 Ga0466705_029237_1157_4630 1157
72 3300042616 Ga0466715_450562 Ga0466715_450562_9258_12731 1157
73 3300042636 Ga0466703_044868 Ga0466703_044868_2718_6191 1157
74 3300042643 Ga0466704_111914 Ga0466704_111914_20676_24149 1157
75 iso_pr_bacteria 2781125634 2781275601 1157
76 3300002450 JGI24695J34938_10007923 JGI24695J34938_100079233 1158
77 3300042592 Ga0466693_011165 Ga0466693_011165_3903_7397 1158
78 3300042593 Ga0466691_216086 Ga0466691_216086_3928_7404 1158
79 3300042607 Ga0466720_146393 Ga0466720_146393_448_3972 1158
80 3300002450 JGI24695J34938_10005087 JGI24695J34938_100050871 1159
81 3300042594 Ga0466694_055111 Ga0466694_055111_1634_5113 1159
82 3300042591 Ga0466692_109230 Ga0466692_109230_16151_19744 1160
83 3300042617 Ga0466718_034112 Ga0466718_034112_2415_5897 1160
84 3300042591 Ga0466692_058889 Ga0466692_058889_19216_22701 1161
85 3300042614 Ga0466712_314711 Ga0466712_314711_268_3753 1161
86 3300042615 Ga0466711_196122 Ga0466711_196122_10211_13696 1161
87 3300042656 Ga0466732_025530 Ga0466732_025530_3978_7463 1161
88 iso_pr_bacteria 2781125651 2781310005 1161
89 3300000089 AustNasuHG_c1006144 AustNasuHG_10061441 1162
90 3300002449 JGI24698J34947_10004094 JGI24698J34947_100040945 1162
91 3300042605 Ga0466716_000750 Ga0466716_000750_4341_7856 1162
92 3300005201 Ga0072941_1001683 Ga0072941_100168321 1163
93 3300000089 AustNasuHG_c1000195 AustNasuHG_100019510 1164
94 3300042597 Ga0466699_133344 Ga0466699_133344_8144_11638 1164
95 3300042602 Ga0466713_075514 Ga0466713_075514_668_4162 1164
96 3300042605 Ga0466716_363303 Ga0466716_363303_574_4071 1165
97 3300042619 Ga0466726_005380 Ga0466726_005380_1584_5081 1165
98 3300042652 Ga0466708_257706 Ga0466708_257706_6586_10083 1165
99 3300042593 Ga0466691_010702 Ga0466691_010702_13766_17287 1166
100 3300042624 Ga0466735_107291 Ga0466735_107291_4119_7619 1166
101 3300042596 Ga0466696_352339 Ga0466696_352339_606_4109 1167
102 3300042605 Ga0466716_103555 Ga0466716_103555_8250_11795 1167
103 3300042591 Ga0466692_031254 Ga0466692_031254_4278_7784 1168
104 3300042592 Ga0466693_118917 Ga0466693_118917_12475_15981 1168
105 3300042594 Ga0466694_125080 Ga0466694_125080_1068_4574 1168
106 3300042606 Ga0466719_346726 Ga0466719_346726_406_3945 1168
107 3300042612 Ga0466705_397724 Ga0466705_397724_340_3903 1168
108 3300042619 Ga0466726_451350 Ga0466726_451350_166_3672 1168
109 iso_pr_bacteria 2781125637 2781282165 1168
110 iso_pr_bacteria 2781125695 2781438239 1168
111 3300002450 JGI24695J34938_10008463 JGI24695J34938_100084631 1169
112 3300005201 Ga0072941_1004016 Ga0072941_10040162 1169
113 3300042655 Ga0466727_192939 Ga0466727_192939_1776_5285 1169
114 3300002450 JGI24695J34938_10000612 JGI24695J34938_1000061210 1170
115 3300042648 Ga0466709_134433 Ga0466709_134433_7457_10999 1171
116 3300002450 JGI24695J34938_10000485 JGI24695J34938_1000048525 1172
117 3300042596 Ga0466696_023207 Ga0466696_023207_4240_7758 1172
118 3300042618 Ga0466723_068107 Ga0466723_068107_2200_5790 1172
119 3300042619 Ga0466726_222121 Ga0466726_222121_142_3660 1172
120 3300042636 Ga0466703_016621 Ga0466703_016621_3719_7333 1172
121 3300042593 Ga0466691_001806 Ga0466691_001806_9377_12928 1174
122 3300042619 Ga0466726_170186 Ga0466726_170186_5654_9178 1174
123 3300002449 JGI24698J34947_10004126 JGI24698J34947_100041264 1176
124 3300042607 Ga0466720_088923 Ga0466720_088923_1036_4566 1176
125 3300042616 Ga0466715_267195 Ga0466715_267195_360_3890 1176
126 3300042619 Ga0466726_437084 Ga0466726_437084_6864_10394 1176
127 3300042636 Ga0466703_097389 Ga0466703_097389_1714_5283 1176
128 3300042652 Ga0466708_064747 Ga0466708_064747_3414_6944 1176
129 3300042652 Ga0466708_148653 Ga0466708_148653_3396_6980 1176
130 3300042590 Ga0466690_414749 Ga0466690_414749_568_4101 1177
131 3300042618 Ga0466723_131749 Ga0466723_131749_18493_22026 1177
132 3300042617 Ga0466718_038687 Ga0466718_038687_24029_27565 1178
133 3300042593 Ga0466691_133046 Ga0466691_133046_2063_5656 1179
134 3300042618 Ga0466723_273170 Ga0466723_273170_273_3815 1180
135 3300010049 Ga0123356_10001263 Ga0123356_100012637 1181
136 3300042617 Ga0466718_006614 Ga0466718_006614_7432_10977 1181
137 iso_pr_bacteria 2781125638 2781284622 1181
138 3300002450 JGI24695J34938_10001625 JGI24695J34938_100016252 1182
139 3300042617 Ga0466718_006290 Ga0466718_006290_370_3942 1182
140 3300002450 JGI24695J34938_10012039 JGI24695J34938_100120391 1184
141 3300002450 JGI24695J34938_10002485 JGI24695J34938_100024853 1188
142 3300002450 JGI24695J34938_10016056 JGI24695J34938_100160562 1188
143 3300042615 Ga0466711_232762 Ga0466711_232762_11919_15503 1194
144 iso_pr_bacteria 2781125631 2781269055 1194
145 3300042592 Ga0466693_074523 Ga0466693_074523_1963_5622 1199
146 iso_pr_bacteria 2781125661 2781332830 1210
147 3300010049 Ga0123356_10000435 Ga0123356_100004354 1211
148 3300042652 Ga0466708_275417 Ga0466708_275417_33_3710 1217
149 3300042652 Ga0466708_228165 Ga0466708_228165_19468_23154 1228

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00176 SNF2-rel_dom SNF2-related domain 770 1044 0.94
PF12419 DUF3670 SNF2 Helicase protein 604 723 0.92
PF00271 Helicase_C Helicase conserved C-terminal domain 1067 1172 0.87
PF04851 ResIII Type III restriction enzyme, res subunit 765 918 0.85
PF00270 DEAD DEAD/DEAH box helicase 781 921 0.77

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.66 0.68 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.