Protein Family IF09919

Metagenome Isolate
123 Members
60 Samples
103 Scaffolds
396.42 Avg Length

🧬 Representative Sequence

ID
3300042652|Ga0466708_171880|Ga0466708_171880_655_1848
Length
390 aa
Sequence
MNSLSDRLNSLSPSETLAMSQKSNELKARGIDVINLSVGEPDFNTPDHIKEAAKKAIDDNYSRYSPVPGYPALREAIAKKLKRENDLDFSAAQILCSNGAKQSVCNVLMVLVNPGDEVIIPAPYWVSYPEMVKLAEAGIEQDFKITPAQLEAAITPKTKALILCSPSNPTGSVYTKEELAGLAAVLAKYPQVIIIADEIYEHINYIGKHHSIAQFPEVRDRVVIVNGVSKAYAMTGWRIGFIAGPQWIVSACNKLQGQYTSGPCSVSQKAAEAAYTGVQEPVAEMRNAFERRRDLIVKLAKEIPGFEVNVPQGAFYLFPKCNAYYGKSAGNRKINDAGDLAMYLLEEGHVACVGGTAFGAPDCIRMSYATSDENIIEAMRRIGEALAKLK

📊 Sample Types

Isolate 16.3%
Metagenome 83.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 26.7%
Kalotermitidae 20.0%
Unclassified 18.3%
Blattidae 13.3%
Rhinotermitidae 8.3%
Hydrophilidae 3.3%
Passalidae 3.3%
Termopsidae 3.3%
Hodotermitidae 1.7%
Tenebrionidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 123
Eukaryota 0
Viruses 0
Unclassified 0

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820751898 Unclassified Bacteroidetes Nc150P4bin22 Isolate Unclassified
2 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
3 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
4 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
8 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
9 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
10 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
11 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
12 3004672520 Bacteroides sp. 51 Isolate Blattidae
13 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
14 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
15 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
16 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
17 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
18 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
19 2922326829 Bacteroides sp. 224 Isolate Blattidae
20 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
21 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
22 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
23 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
24 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
25 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
26 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
27 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
28 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
29 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
30 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
31 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
32 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
33 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
34 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
35 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
36 2920168565 Paludibacter sp. 221 Isolate Blattidae
37 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
38 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
39 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
40 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
41 3004677695 Bacteroides sp. 214 Isolate Blattidae
42 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
43 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
44 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
45 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
46 3004667792 Bacteroides sp. 519 Isolate Blattidae
47 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
48 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
49 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
50 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
51 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
52 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
53 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
54 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
55 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
56 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
57 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
58 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
59 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
60 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123353_10113029 3300010167 Bacteria 4371
2 Ga0466726_176182 3300042619 Bacteria 2947
3 Ga0466735_066045 3300042624 Bacteria 1775
4 Ga0466735_156000 3300042624 Bacteria 2761
5 Ga0466725_396834 3300042654 Bacteria 2073
6 Ga0466725_424986 3300042654 Bacteria 3748
7 Ga0466706_086045 3300042599 Bacteria 28150
8 Ga0466706_268045 3300042599 Bacteria 8043
9 Ga0466707_069271 3300042601 Bacteria 37232
10 Ga0466707_210869 3300042601 Bacteria 2449
11 Ga0466719_467103 3300042606 Bacteria 10074
12 Ga0466692_120939 3300042591 Bacteria 20322
13 Ga0466695_066627 3300042595 Bacteria 1595
14 Ga0466696_479865 3300042596 Bacteria 4604
15 2227655178 2225789004 Bacteria 10666
16 Ga0466704_028232 3300042643 Bacteria 3062
17 Ga0466706_068903 3300042599 Bacteria 60225
18 Ga0466706_259994 3300042599 Bacteria 1308
19 Ga0466714_082006 3300042603 Bacteria 191145
20 Ga0466657_177088 3300042582 Bacteria 2856
21 Ga0466690_038157 3300042590 Bacteria 30366
22 Ga0466692_191632 3300042591 Bacteria 2552
23 Ga0466697_096879 3300042611 Bacteria 330838
24 Ga0466733_042783 3300042659 Bacteria 7466
25 Ga0123355_10015316 3300009826 Bacteria 12039
26 Ga0466715_420883 3300042616 Bacteria 23018
27 Ga0466735_102187 3300042624 Bacteria 2048
28 Ga0466704_167238 3300042643 Bacteria 15612
29 Ga0466706_035962 3300042599 Bacteria 13962
30 Ga0466706_243926 3300042599 Bacteria 39041
31 Ga0466700_028423 3300042600 Bacteria 18281
32 Ga0466693_125264 3300042592 Bacteria 3777
33 Ga0466711_273604 3300042615 Bacteria 21348
34 Ga0466735_178146 3300042624 Bacteria 2940
35 Ga0466703_049823 3300042636 Bacteria 8014
36 Ga0466704_209289 3300042643 Bacteria 3744
37 Ga0466706_237920 3300042599 Bacteria 15432
38 Ga0466706_245891 3300042599 Bacteria 10088
39 Ga0466713_136156 3300042602 Bacteria 13600
40 Ga0466722_111810 3300042609 Bacteria 7464
41 Ga0466696_018059 3300042596 Bacteria 14989
42 Ga0466696_236749 3300042596 Bacteria 2205
43 JGI24699J35502_11133978 3300002509 Bacteria 22406
44 Ga0123356_10059582 3300010049 Bacteria 3561
45 Ga0466711_490268 3300042615 Bacteria 8051
46 Ga0466729_086319 3300042621 Bacteria 5057
47 Ga0466735_098810 3300042624 Bacteria 20686
48 Ga0466735_105895 3300042624 Bacteria 4329
49 Ga0466706_073326 3300042599 Bacteria 34234
50 Ga0466707_066930 3300042601 Bacteria 25743
51 Ga0466713_149423 3300042602 Bacteria 8754
52 Ga0466714_096666 3300042603 Bacteria 172614
53 JGI24705J35276_12225572 3300002504 Bacteria 2738
54 Ga0123357_10000360 3300009784 Bacteria 42873
55 Ga0123356_10110855 3300010049 Bacteria 2650
56 Ga0466711_101832 3300042615 Bacteria 12794
57 Ga0466711_162785 3300042615 Bacteria 15826
58 Ga0466715_509861 3300042616 Bacteria 18242
59 Ga0466703_029336 3300042636 Bacteria 13623
60 Ga0466708_171880 3300042652 Bacteria 2285
61 Ga0466701_017476 3300042598 Bacteria 2511
62 Ga0466701_038865 3300042598 Bacteria 42316
63 Ga0466714_115350 3300042603 Bacteria 92077
64 Ga0466657_290285 3300042582 Bacteria 14131
65 Ga0466696_022728 3300042596 Bacteria 7699
66 Ga0466696_070824 3300042596 Bacteria 21857
67 Ga0068305_10005326 3300005083 Bacteria 70832
68 Ga0466733_002151 3300042659 Bacteria 71476
69 Ga0466733_159395 3300042659 Bacteria 2298
70 Ga0466715_249768 3300042616 Bacteria 14395
71 Ga0466726_463448 3300042619 Bacteria 2055
72 Ga0466735_125320 3300042624 Bacteria 1414
73 Ga0466735_169775 3300042624 Bacteria 4414
74 Ga0466735_217423 3300042624 Bacteria 5626
75 Ga0466704_407897 3300042643 Bacteria 17764
76 Ga0466709_008379 3300042648 Bacteria 52460
77 Ga0466709_116651 3300042648 Bacteria 4392
78 Ga0466709_164902 3300042648 Bacteria 31389
79 Ga0466706_089075 3300042599 Bacteria 35431
80 Ga0466713_059345 3300042602 Bacteria 29151
81 Ga0466713_102313 3300042602 Bacteria 97036
82 Ga0466692_159539 3300042591 Bacteria 1671
83 Ga0466691_048721 3300042593 Bacteria 9539
84 Ga0466696_029981 3300042596 Bacteria 13815
85 Ga0466696_218218 3300042596 Bacteria 5507
86 IMNBL1DRAFT_c0005201 3300000062 Bacteria 7527
87 Ga0562377_0004 3300056842 Bacteria 3525959
88 Ga0123353_10000503 3300010167 Bacteria 48547
89 Ga0466728_116793 3300042620 Bacteria 97907
90 Ga0466735_098068 3300042624 Bacteria 1399
91 Ga0466703_089004 3300042636 Bacteria 22238
92 Ga0466704_449131 3300042643 Bacteria 11786
93 Ga0466713_088905 3300042602 Bacteria 24788
94 Ga0466714_126051 3300042603 Bacteria 4509
95 Ga0466716_003199 3300042605 Bacteria 14921
96 Ga0466716_160318 3300042605 Bacteria 5514
97 Ga0466719_017518 3300042606 Bacteria 9848
98 Ga0466722_003445 3300042609 Bacteria 10548
99 Ga0466692_090996 3300042591 Bacteria 32249
100 Ga0466696_058548 3300042596 Bacteria 3516
101 IMNBL1DRAFT_c0006317 3300000062 Bacteria 6502
102 IMNBL1DRAFT_c0022423 3300000062 Bacteria 2499
103 JGI24696J40584_12957942 3300002834 Bacteria 3782

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042591 Ga0466692_120939 Ga0466692_120939_4865_6004 379
2 3300042596 Ga0466696_236749 Ga0466696_236749_961_2100 379
3 3300042599 Ga0466706_245891 Ga0466706_245891_5412_6551 379
4 3300042609 Ga0466722_003445 Ga0466722_003445_1396_2535 379
5 3300042615 Ga0466711_162785 Ga0466711_162785_13544_14683 379
6 3300042621 Ga0466729_086319 Ga0466729_086319_2266_3405 379
7 3300042624 Ga0466735_098068 Ga0466735_098068_111_1250 379
8 3300042624 Ga0466735_125320 Ga0466735_125320_260_1399 379
9 3300042643 Ga0466704_449131 Ga0466704_449131_1569_2708 379
10 3300042599 Ga0466706_073326 Ga0466706_073326_28983_30125 380
11 3300042624 Ga0466735_217423 Ga0466735_217423_3771_4913 380
12 3300009826 Ga0123355_10015316 Ga0123355_100153162 387
13 3300010049 Ga0123356_10110855 Ga0123356_101108552 387
14 3300042652 Ga0466708_171880 Ga0466708_171880_655_1848 390
15 3300042591 Ga0466692_090996 Ga0466692_090996_24267_25445 392
16 3300042624 Ga0466735_156000 Ga0466735_156000_621_1805 394
17 2225789004 2227655178 2228252914 395
18 3300002834 JGI24696J40584_12957942 JGI24696J40584_129579421 396
19 3300042582 Ga0466657_177088 Ga0466657_177088_443_1636 397
20 3300042582 Ga0466657_290285 Ga0466657_290285_10566_11759 397
21 3300042590 Ga0466690_038157 Ga0466690_038157_15699_16892 397
22 3300042591 Ga0466692_159539 Ga0466692_159539_193_1386 397
23 3300042592 Ga0466693_125264 Ga0466693_125264_1879_3072 397
24 3300042593 Ga0466691_048721 Ga0466691_048721_4022_5215 397
25 3300042595 Ga0466695_066627 Ga0466695_066627_203_1396 397
26 3300042596 Ga0466696_018059 Ga0466696_018059_4332_5525 397
27 3300042596 Ga0466696_022728 Ga0466696_022728_3891_5084 397
28 3300042596 Ga0466696_029981 Ga0466696_029981_10738_11931 397
29 3300042596 Ga0466696_058548 Ga0466696_058548_1783_2976 397
30 3300042598 Ga0466701_038865 Ga0466701_038865_15204_16397 397
31 3300042599 Ga0466706_068903 Ga0466706_068903_21205_22398 397
32 3300042599 Ga0466706_086045 Ga0466706_086045_14809_16002 397
33 3300042599 Ga0466706_237920 Ga0466706_237920_5128_6321 397
34 3300042599 Ga0466706_243926 Ga0466706_243926_35367_36560 397
35 3300042600 Ga0466700_028423 Ga0466700_028423_1976_3169 397
36 3300042601 Ga0466707_066930 Ga0466707_066930_18556_19749 397
37 3300042601 Ga0466707_210869 Ga0466707_210869_172_1365 397
38 3300042602 Ga0466713_102313 Ga0466713_102313_55093_56286 397
39 3300042602 Ga0466713_136156 Ga0466713_136156_246_1439 397
40 3300042602 Ga0466713_149423 Ga0466713_149423_6137_7330 397
41 3300042603 Ga0466714_096666 Ga0466714_096666_43875_45068 397
42 3300042605 Ga0466716_160318 Ga0466716_160318_1074_2267 397
43 3300042606 Ga0466719_017518 Ga0466719_017518_6468_7661 397
44 3300042609 Ga0466722_111810 Ga0466722_111810_2144_3337 397
45 3300042611 Ga0466697_096879 Ga0466697_096879_106843_108036 397
46 3300042615 Ga0466711_101832 Ga0466711_101832_7261_8454 397
47 3300042615 Ga0466711_490268 Ga0466711_490268_2147_3340 397
48 3300042616 Ga0466715_249768 Ga0466715_249768_17_1210 397
49 3300042616 Ga0466715_420883 Ga0466715_420883_10694_11887 397
50 3300042616 Ga0466715_509861 Ga0466715_509861_13118_14311 397
51 3300042619 Ga0466726_176182 Ga0466726_176182_810_2003 397
52 3300042619 Ga0466726_463448 Ga0466726_463448_284_1477 397
53 3300042620 Ga0466728_116793 Ga0466728_116793_14933_16126 397
54 3300042624 Ga0466735_066045 Ga0466735_066045_261_1454 397
55 3300042624 Ga0466735_102187 Ga0466735_102187_87_1280 397
56 3300042624 Ga0466735_105895 Ga0466735_105895_2743_3936 397
57 3300042624 Ga0466735_169775 Ga0466735_169775_2450_3643 397
58 3300042624 Ga0466735_178146 Ga0466735_178146_524_1717 397
59 3300042636 Ga0466703_029336 Ga0466703_029336_11922_13115 397
60 3300042636 Ga0466703_049823 Ga0466703_049823_266_1459 397
61 3300042636 Ga0466703_089004 Ga0466703_089004_20655_21848 397
62 3300042643 Ga0466704_167238 Ga0466704_167238_5598_6791 397
63 3300042643 Ga0466704_407897 Ga0466704_407897_2075_3268 397
64 3300042648 Ga0466709_008379 Ga0466709_008379_42525_43718 397
65 3300042648 Ga0466709_116651 Ga0466709_116651_865_2058 397
66 3300042648 Ga0466709_164902 Ga0466709_164902_18925_20118 397
67 3300042654 Ga0466725_396834 Ga0466725_396834_594_1787 397
68 3300042659 Ga0466733_002151 Ga0466733_002151_56869_58062 397
69 3300042659 Ga0466733_042783 Ga0466733_042783_4591_5784 397
70 3300056842 Ga0562377_0004 Ga0562377_0004_1396811_1398004 397
71 iso_pr_bacteria 2609459943 2610743500 397
72 iso_pr_bacteria 2695420314 2695472141 397
73 iso_pr_bacteria 2695420317 2695484144 397
74 iso_pr_bacteria 2695420931 2698111200 397
75 iso_pr_bacteria 2820751898 2820752893 397
76 iso_pr_bacteria 2820776227 2820776525 397
77 iso_pr_bacteria 2830041218 2830044889 397
78 iso_pr_bacteria 2873600114 2873603490 397
79 iso_pr_bacteria 2873610414 2873613881 397
80 iso_pr_bacteria 2920168565 2920168938 397
81 iso_pr_bacteria 2922326829 2922328727 397
82 iso_pr_bacteria 2940216256 2940216789 397
83 iso_pr_bacteria 3004667792 3004668683 397
84 iso_pr_bacteria 3004672520 3004675424 397
85 iso_pr_bacteria 3004677695 3004679691 397
86 iso_pr_bacteria 8100157865 8100161765 397
87 3300000062 IMNBL1DRAFT_c0005201 IMNBL1DRAFT_00052012 398
88 3300000062 IMNBL1DRAFT_c0006317 IMNBL1DRAFT_00063173 398
89 3300000062 IMNBL1DRAFT_c0022423 IMNBL1DRAFT_00224232 398
90 3300002504 JGI24705J35276_12225572 JGI24705J35276_122255721 398
91 3300005083 Ga0068305_10005326 Ga0068305_1000532610 398
92 3300009784 Ga0123357_10000360 Ga0123357_1000036017 398
93 3300010167 Ga0123353_10113029 Ga0123353_101130293 398
94 3300042591 Ga0466692_191632 Ga0466692_191632_1051_2247 398
95 3300042596 Ga0466696_070824 Ga0466696_070824_9152_10348 398
96 3300042596 Ga0466696_218218 Ga0466696_218218_3586_4782 398
97 3300042596 Ga0466696_479865 Ga0466696_479865_49_1245 398
98 3300042598 Ga0466701_017476 Ga0466701_017476_159_1355 398
99 3300042599 Ga0466706_035962 Ga0466706_035962_852_2048 398
100 3300042599 Ga0466706_089075 Ga0466706_089075_31840_33036 398
101 3300042599 Ga0466706_268045 Ga0466706_268045_3007_4203 398
102 3300042603 Ga0466714_082006 Ga0466714_082006_90277_91473 398
103 3300042603 Ga0466714_126051 Ga0466714_126051_1433_2629 398
104 3300042605 Ga0466716_003199 Ga0466716_003199_2262_3458 398
105 3300042606 Ga0466719_467103 Ga0466719_467103_332_1528 398
106 3300042643 Ga0466704_209289 Ga0466704_209289_2416_3612 398
107 3300042659 Ga0466733_159395 Ga0466733_159395_200_1396 398
108 iso_pr_bacteria 2820757377 2820758243 398
109 iso_pr_bacteria 2910949487 2910952280 398
110 iso_pr_bacteria 2940193328 2940194419 398
111 3300002509 JGI24699J35502_11133978 JGI24699J35502_1113397810 399
112 3300010049 Ga0123356_10059582 Ga0123356_100595822 399
113 3300010167 Ga0123353_10000503 Ga0123353_1000050316 399
114 3300042599 Ga0466706_259994 Ga0466706_259994_84_1283 399
115 3300042643 Ga0466704_028232 Ga0466704_028232_867_2066 399
116 iso_pr_bacteria 2820762746 2820764101 399
117 3300042615 Ga0466711_273604 Ga0466711_273604_11739_12941 400
118 3300042654 Ga0466725_424986 Ga0466725_424986_2385_3587 400
119 3300042603 Ga0466714_115350 Ga0466714_115350_27818_29023 401
120 3300042624 Ga0466735_098810 Ga0466735_098810_7997_9208 403
121 3300042602 Ga0466713_088905 Ga0466713_088905_12398_13651 417
122 3300042601 Ga0466707_069271 Ga0466707_069271_15554_16849 431
123 3300042602 Ga0466713_059345 Ga0466713_059345_12838_14202 454

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00155 Aminotran_1_2 Aminotransferase class I and II 32 382 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.