Protein Family IF09906

Metagenome Isolate
154 Members
54 Samples
133 Scaffolds
379.4 Avg Length

🧬 Representative Sequence

ID
3300042652|Ga0466708_138315|Ga0466708_138315_236_1549
Length
437 aa
Sequence
VLRAVLNRHAGVLFGIPGGGWSFVFSGDAAVTYIHVYLQQNLKKMNSMKQIATSCPSLGGMLCACLVWLASCTDSKFTVEGVVSGADGQVMYFESVGISSVQILDSVRLTADGKFAFRRSRPPYPEFYRFRLNSQWINFSIDSTETLTFAADGGTFATSYTVEGSENAKAIKEITLAQLDANQAIGRLRKERDTHLIPDTAFQSRLSEAAEAYKEVARRYIYSAPMSAVAYFALFQQIDGLLFFDLYNKEDSKAYGAVATSFDHYYPGSMRARHLHNLALQSIKVIRRQRAASEAGSAPVNITEISYLDIVLPNLKGEKVSLSSVAENKAVLINFTAYRSEWSPSLNMDLGDIYTKYSARGLAIYQVSLDADTHYWKNVSSNLPWVCVRDPESVYSQIAALYNVKQLPALFLLDRKGNLVKRIDDLKTLDEDVRKVL

📊 Sample Types

Isolate 13.6%
Metagenome 86.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 38.9%
Kalotermitidae 25.9%
Termitidae 13.0%
Termopsidae 7.4%
Unclassified 5.6%
Rhinotermitidae 5.6%
Passalidae 3.7%

🌳 Taxonomy

Archaea 1
Bacteria 147
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
2 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
3 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
4 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
7 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
8 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
9 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
10 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
11 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
12 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
13 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
14 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
15 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
16 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
17 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
18 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
19 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
20 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
21 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
22 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
23 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
24 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
25 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
26 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
27 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
28 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
29 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
30 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
31 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
32 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
33 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
34 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
35 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
36 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
37 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
38 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
39 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
40 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
41 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
42 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
43 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
44 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
45 2923982719 Parabacteroides sp. 52 Isolate Blattidae
46 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
47 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
48 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
49 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
50 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
51 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
52 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
53 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
54 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466711_011751 3300042615 Bacteria 11761
2 Ga0466711_242355 3300042615 Bacteria 12439
3 Ga0466715_379600 3300042616 Bacteria 22114
4 Ga0466723_067180 3300042618 Bacteria 17674
5 Ga0466723_295693 3300042618 Bacteria 5360
6 Ga0466726_247201 3300042619 Unclassified 1386
7 Ga0466690_119795 3300042590 Bacteria 7830
8 Ga0466696_478872 3300042596 Bacteria 4509
9 Ga0466703_305853 3300042636 Bacteria 13397
10 Ga0466704_086682 3300042643 Bacteria 2810
11 Ga0466704_362007 3300042643 Bacteria 16295
12 Ga0466704_407394 3300042643 Bacteria 14777
13 Ga0466709_376503 3300042648 Bacteria 12791
14 Ga0466708_138315 3300042652 Bacteria 9699
15 Ga0466713_035995 3300042602 Unclassified 2456
16 Ga0466713_077436 3300042602 Bacteria 22165
17 Ga0466716_481572 3300042605 Bacteria 9267
18 Ga0466719_083574 3300042606 Bacteria 8476
19 Ga0466722_009058 3300042609 Bacteria 56021
20 2227236350 2225789004 Bacteria 7289
21 IMNBL1DRAFT_c0020421 3300000062 Bacteria 2683
22 Ga0068302_10143416 3300005071 Archaea 5301
23 Ga0068305_10026750 3300005083 Bacteria 10368
24 Ga0068305_10107345 3300005083 Bacteria 4367
25 Ga0466705_053356 3300042612 Bacteria 6242
26 Ga0466705_376176 3300042612 Bacteria 16984
27 Ga0466715_402619 3300042616 Bacteria 10360
28 Ga0466728_411536 3300042620 Bacteria 1852
29 Ga0466729_184776 3300042621 Bacteria 8446
30 Ga0466691_038866 3300042593 Bacteria 19756
31 Ga0466704_083976 3300042643 Bacteria 7082
32 Ga0466704_316925 3300042643 Bacteria 8161
33 Ga0466719_292287 3300042606 Bacteria 2552
34 Ga0466719_431354 3300042606 Bacteria 5137
35 Ga0466722_012357 3300042609 Bacteria 11530
36 Ga0466722_062477 3300042609 Bacteria 11403
37 Ga0466722_231082 3300042609 Bacteria 5835
38 2227372472 2225789004 Bacteria 5996
39 IMNBL1DRAFT_c0002798 3300000062 Unclassified 11802
40 Ga0068305_10091142 3300005083 Bacteria 5256
41 Ga0466705_301453 3300042612 Unclassified 1712
42 Ga0466728_442771 3300042620 Unclassified 14886
43 Ga0466691_200679 3300042593 Bacteria 4888
44 Ga0466696_275316 3300042596 Bacteria 11489
45 Ga0466704_493757 3300042643 Bacteria 5631
46 Ga0466725_072352 3300042654 Bacteria 12854
47 Ga0466725_103641 3300042654 Bacteria 2249
48 Ga0466727_090785 3300042655 Bacteria 2330
49 Ga0466713_024465 3300042602 Bacteria 3815
50 Ga0466713_061789 3300042602 Bacteria 88378
51 Ga0466713_097614 3300042602 Bacteria 86999
52 Ga0466722_210054 3300042609 Bacteria 3969
53 Ga0466705_170506 3300042612 Bacteria 11627
54 Ga0466705_438498 3300042612 Bacteria 6573
55 Ga0466711_443540 3300042615 Bacteria 17011
56 Ga0466715_273908 3300042616 Bacteria 8602
57 Ga0466726_065128 3300042619 Bacteria 4985
58 Ga0466690_293895 3300042590 Bacteria 67504
59 Ga0466703_257396 3300042636 Bacteria 15106
60 Ga0466704_275304 3300042643 Bacteria 2376
61 Ga0466709_358740 3300042648 Bacteria 10195
62 Ga0466708_120576 3300042652 Bacteria 34134
63 Ga0466727_047526 3300042655 Bacteria 13694
64 Ga0466707_086135 3300042601 Bacteria 11633
65 Ga0466716_153013 3300042605 Bacteria 5413
66 Ga0466719_353865 3300042606 Bacteria 4055
67 Ga0068302_10131825 3300005071 Bacteria 1317
68 Ga0068305_10155444 3300005083 Bacteria 1414
69 Ga0466733_122024 3300042659 Bacteria 33739
70 Ga0466711_433146 3300042615 Bacteria 1669
71 Ga0466715_276387 3300042616 Bacteria 1775
72 Ga0466715_600427 3300042616 Bacteria 2440
73 Ga0466692_126527 3300042591 Bacteria 33875
74 Ga0123357_10060264 3300009784 Bacteria 5091
75 Ga0123354_10214892 3300010882 Bacteria 2064
76 Ga0466704_053279 3300042643 Bacteria 19722
77 Ga0466704_070354 3300042643 Bacteria 3918
78 Ga0466727_327206 3300042655 Bacteria 9929
79 Ga0466719_299936 3300042606 Bacteria 4408
80 JGI24702J35022_10000119 3300002462 Bacteria 37881
81 JGI24702J35022_10069895 3300002462 Bacteria 1889
82 Ga0068302_10204565 3300005071 Bacteria 4487
83 Ga0466705_295334 3300042612 Bacteria 16542
84 Ga0466733_170460 3300042659 Bacteria 186955
85 Ga0466726_049116 3300042619 Bacteria 5096
86 Ga0466726_382645 3300042619 Bacteria 9872
87 Ga0466728_093101 3300042620 Bacteria 13078
88 Ga0466690_034613 3300042590 Bacteria 14840
89 Ga0466692_008872 3300042591 Bacteria 29437
90 Ga0466694_065712 3300042594 Bacteria 1971
91 Ga0466696_441208 3300042596 Bacteria 3655
92 Ga0466709_188845 3300042648 Bacteria 15042
93 Ga0466707_160588 3300042601 Bacteria 3045
94 Ga0466713_018768 3300042602 Bacteria 4128
95 Ga0466716_076910 3300042605 Bacteria 11677
96 Ga0466719_172082 3300042606 Bacteria 4925
97 Ga0466719_520961 3300042606 Bacteria 6106
98 JGI24702J35022_10001583 3300002462 Bacteria 14117
99 Ga0466705_011422 3300042612 Bacteria 4514
100 Ga0466711_204836 3300042615 Bacteria 21772
101 Ga0466715_137250 3300042616 Bacteria 2234
102 Ga0466715_227174 3300042616 Bacteria 15989
103 Ga0466715_368612 3300042616 Bacteria 6621
104 Ga0466696_170321 3300042596 Bacteria 10269
105 Ga0466696_288691 3300042596 Bacteria 66943
106 Ga0466703_289947 3300042636 Bacteria 14348
107 Ga0466704_080956 3300042643 Bacteria 7262
108 Ga0466709_006965 3300042648 Bacteria 10318
109 Ga0466727_225961 3300042655 Bacteria 24553
110 Ga0466713_110049 3300042602 Bacteria 19208
111 IMNBL1DRAFT_c0008174 3300000062 Bacteria 5369
112 JGI24702J35022_10007003 3300002462 Bacteria 6477
113 JGI24702J35022_10011694 3300002462 Bacteria 4892
114 Ga0068305_10417480 3300005083 Bacteria 5660
115 Ga0466705_033023 3300042612 Bacteria 10482
116 Ga0466705_141557 3300042612 Unclassified 1642
117 Ga0466711_057542 3300042615 Bacteria 70908
118 Ga0466715_079052 3300042616 Bacteria 26117
119 Ga0466715_464975 3300042616 Bacteria 101862
120 Ga0466723_035858 3300042618 Bacteria 52046
121 Ga0466691_037330 3300042593 Bacteria 15244
122 Ga0123353_10123586 3300010167 Bacteria 4160
123 Ga0466735_113576 3300042624 Bacteria 5539
124 Ga0466703_001425 3300042636 Bacteria 12119
125 Ga0466703_042698 3300042636 Bacteria 15132
126 Ga0466703_048088 3300042636 Bacteria 40180
127 Ga0466703_065818 3300042636 Bacteria 14556
128 Ga0466704_070153 3300042643 Bacteria 6572
129 Ga0466716_209854 3300042605 Bacteria 2150
130 2227463557 2225789004 Bacteria 5308
131 IMNBL1DRAFT_c0002120 3300000062 Bacteria 14126
132 IMNBL1DRAFT_c0013829 3300000062 Bacteria 3595
133 JGI24702J35022_10002836 3300002462 Bacteria 10499

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042590 Ga0466690_034613 Ga0466690_034613_5544_6620 344
2 3300042606 Ga0466719_083574 Ga0466719_083574_2115_3158 347
3 3300042659 Ga0466733_122024 Ga0466733_122024_24025_25137 347
4 3300042616 Ga0466715_402619 Ga0466715_402619_4522_5682 351
5 3300042609 Ga0466722_231082 Ga0466722_231082_1285_2352 355
6 3300002462 JGI24702J35022_10001583 JGI24702J35022_1000158313 356
7 3300042643 Ga0466704_275304 Ga0466704_275304_953_2023 356
8 3300042602 Ga0466713_035995 Ga0466713_035995_768_1895 358
9 3300042606 Ga0466719_292287 Ga0466719_292287_1092_2171 359
10 3300042612 Ga0466705_053356 Ga0466705_053356_1420_2529 359
11 3300042636 Ga0466703_001425 Ga0466703_001425_8086_9237 360
12 3300042643 Ga0466704_493757 Ga0466704_493757_4185_5342 360
13 3300042612 Ga0466705_438498 Ga0466705_438498_2764_3921 361
14 3300002462 JGI24702J35022_10002836 JGI24702J35022_100028363 364
15 3300010167 Ga0123353_10123586 Ga0123353_101235864 366
16 3300042601 Ga0466707_086135 Ga0466707_086135_39_1187 366
17 2225789004 2227372472 2227818895 367
18 3300042616 Ga0466715_379600 Ga0466715_379600_6426_7529 367
19 3300042596 Ga0466696_275316 Ga0466696_275316_4960_6066 368
20 3300042605 Ga0466716_153013 Ga0466716_153013_650_1756 368
21 3300042615 Ga0466711_443540 Ga0466711_443540_10825_11931 368
22 3300042643 Ga0466704_316925 Ga0466704_316925_5843_6949 368
23 3300042655 Ga0466727_225961 Ga0466727_225961_15241_16347 368
24 3300042659 Ga0466733_170460 Ga0466733_170460_71253_72359 368
25 3300042593 Ga0466691_200679 Ga0466691_200679_2488_3597 369
26 3300042594 Ga0466694_065712 Ga0466694_065712_452_1561 369
27 3300042596 Ga0466696_170321 Ga0466696_170321_844_1953 369
28 3300042596 Ga0466696_441208 Ga0466696_441208_1256_2365 369
29 3300042596 Ga0466696_478872 Ga0466696_478872_2111_3220 369
30 3300042602 Ga0466713_061789 Ga0466713_061789_27741_28850 369
31 3300042602 Ga0466713_110049 Ga0466713_110049_12388_13497 369
32 3300042619 Ga0466726_382645 Ga0466726_382645_367_1530 369
33 3300042620 Ga0466728_093101 Ga0466728_093101_6106_7215 369
34 3300042643 Ga0466704_407394 Ga0466704_407394_4233_5342 369
35 3300042648 Ga0466709_358740 Ga0466709_358740_3363_4472 369
36 3300042654 Ga0466725_072352 Ga0466725_072352_8192_9301 369
37 3300005071 Ga0068302_10131825 Ga0068302_101318251 370
38 3300005083 Ga0068305_10091142 Ga0068305_100911424 370
39 3300042619 Ga0466726_247201 Ga0466726_247201_244_1356 370
40 3300042620 Ga0466728_411536 Ga0466728_411536_167_1279 370
41 3300042616 Ga0466715_137250 Ga0466715_137250_36_1151 371
42 3300042618 Ga0466723_295693 Ga0466723_295693_4004_5119 371
43 3300042619 Ga0466726_065128 Ga0466726_065128_967_2082 371
44 3300042590 Ga0466690_119795 Ga0466690_119795_2855_3973 372
45 3300042654 Ga0466725_103641 Ga0466725_103641_145_1263 372
46 3300009784 Ga0123357_10060264 Ga0123357_100602645 373
47 3300002462 JGI24702J35022_10000119 JGI24702J35022_1000011920 375
48 3300010882 Ga0123354_10214892 Ga0123354_102148921 375
49 3300042602 Ga0466713_018768 Ga0466713_018768_885_2012 375
50 3300042615 Ga0466711_057542 Ga0466711_057542_32390_33517 375
51 3300042618 Ga0466723_035858 Ga0466723_035858_29023_30150 375
52 3300042596 Ga0466696_288691 Ga0466696_288691_54879_56009 376
53 3300042602 Ga0466713_024465 Ga0466713_024465_446_1576 376
54 3300042612 Ga0466705_295334 Ga0466705_295334_2647_3777 376
55 3300042590 Ga0466690_293895 Ga0466690_293895_45901_47034 377
56 3300042593 Ga0466691_038866 Ga0466691_038866_5981_7141 377
57 3300042612 Ga0466705_141557 Ga0466705_141557_139_1272 377
58 3300042612 Ga0466705_301453 Ga0466705_301453_212_1345 377
59 3300042643 Ga0466704_080956 Ga0466704_080956_344_1477 377
60 3300042616 Ga0466715_276387 Ga0466715_276387_356_1492 378
61 3300042616 Ga0466715_464975 Ga0466715_464975_73881_75017 378
62 3300042620 Ga0466728_442771 Ga0466728_442771_5903_7039 378
63 3300042636 Ga0466703_305853 Ga0466703_305853_2857_3993 378
64 3300042643 Ga0466704_086682 Ga0466704_086682_362_1498 378
65 3300042655 Ga0466727_047526 Ga0466727_047526_2245_3384 379
66 3300042591 Ga0466692_126527 Ga0466692_126527_28250_29395 381
67 3300042606 Ga0466719_172082 Ga0466719_172082_2079_3224 381
68 3300042615 Ga0466711_242355 Ga0466711_242355_5435_6583 382
69 3300042605 Ga0466716_076910 Ga0466716_076910_6185_7336 383
70 3300042606 Ga0466719_299936 Ga0466719_299936_1019_2170 383
71 3300042609 Ga0466722_062477 Ga0466722_062477_215_1366 383
72 3300042616 Ga0466715_368612 Ga0466715_368612_785_1936 383
73 3300042619 Ga0466726_049116 Ga0466726_049116_1740_2891 383
74 3300042636 Ga0466703_289947 Ga0466703_289947_6503_7654 383
75 3300042643 Ga0466704_083976 Ga0466704_083976_5462_6613 383
76 3300042648 Ga0466709_376503 Ga0466709_376503_2622_3773 383
77 3300005071 Ga0068302_10204565 Ga0068302_102045653 384
78 3300042593 Ga0466691_037330 Ga0466691_037330_8104_9258 384
79 3300042612 Ga0466705_011422 Ga0466705_011422_1126_2280 384
80 3300042615 Ga0466711_011751 Ga0466711_011751_6632_7786 384
81 3300042616 Ga0466715_079052 Ga0466715_079052_23280_24434 384
82 3300042616 Ga0466715_227174 Ga0466715_227174_7655_8809 384
83 3300042621 Ga0466729_184776 Ga0466729_184776_6800_7954 384
84 3300042636 Ga0466703_048088 Ga0466703_048088_16435_17589 384
85 3300042636 Ga0466703_257396 Ga0466703_257396_12529_13683 384
86 3300042655 Ga0466727_090785 Ga0466727_090785_544_1698 384
87 iso_pr_bacteria 2940202316 2940202909 384
88 iso_pr_bacteria 2940205530 2940208244 384
89 iso_pr_bacteria 2940212447 2940215158 384
90 iso_pr_bacteria 2940298504 2940301212 384
91 iso_pr_bacteria 2940302308 2940304944 384
92 iso_pr_bacteria 2940306115 2940309151 384
93 iso_pr_bacteria 2940309933 2940312988 384
94 iso_pr_bacteria 2940313741 2940316765 384
95 iso_pr_bacteria 2940317558 2940320579 384
96 iso_pr_bacteria 2940321370 2940324336 384
97 iso_pr_bacteria 2940325180 2940327884 384
98 iso_pr_bacteria 2940328985 2940331691 384
99 iso_pr_bacteria 2940332795 2940335854 384
100 3300042591 Ga0466692_008872 Ga0466692_008872_1405_2562 385
101 3300042602 Ga0466713_077436 Ga0466713_077436_20569_21726 385
102 3300042602 Ga0466713_097614 Ga0466713_097614_24495_25652 385
103 3300042606 Ga0466719_520961 Ga0466719_520961_3124_4281 385
104 3300042609 Ga0466722_210054 Ga0466722_210054_1939_3096 385
105 3300042624 Ga0466735_113576 Ga0466735_113576_429_1586 385
106 3300042643 Ga0466704_070153 Ga0466704_070153_243_1400 385
107 3300042643 Ga0466704_070354 Ga0466704_070354_244_1401 385
108 3300042655 Ga0466727_327206 Ga0466727_327206_3734_4891 385
109 iso_pr_bacteria 2923982719 2923984512 385
110 iso_pr_bacteria 2940195863 2940198588 385
111 iso_pr_bacteria 2940371297 2940372364 385
112 2225789004 2227463557 2227899390 386
113 3300000062 IMNBL1DRAFT_c0002120 IMNBL1DRAFT_000212013 386
114 3300005083 Ga0068305_10107345 Ga0068305_101073454 386
115 3300005083 Ga0068305_10155444 Ga0068305_101554441 386
116 3300005083 Ga0068305_10417480 Ga0068305_104174802 386
117 3300042601 Ga0466707_160588 Ga0466707_160588_1130_2290 386
118 3300042605 Ga0466716_481572 Ga0466716_481572_5591_6751 386
119 3300042609 Ga0466722_009058 Ga0466722_009058_19510_20670 386
120 3300042615 Ga0466711_204836 Ga0466711_204836_4250_5410 386
121 3300042616 Ga0466715_600427 Ga0466715_600427_566_1726 386
122 3300042618 Ga0466723_067180 Ga0466723_067180_2621_3781 386
123 3300042636 Ga0466703_042698 Ga0466703_042698_13059_14219 386
124 3300042643 Ga0466704_053279 Ga0466704_053279_16024_17184 386
125 3300042652 Ga0466708_120576 Ga0466708_120576_17832_18992 386
126 3300000062 IMNBL1DRAFT_c0002798 IMNBL1DRAFT_000279810 387
127 3300002462 JGI24702J35022_10007003 JGI24702J35022_100070031 387
128 3300002462 JGI24702J35022_10011694 JGI24702J35022_100116944 387
129 3300002462 JGI24702J35022_10069895 JGI24702J35022_100698952 387
130 3300005071 Ga0068302_10143416 Ga0068302_101434162 387
131 3300005083 Ga0068305_10026750 Ga0068305_100267505 387
132 3300042609 Ga0466722_012357 Ga0466722_012357_2948_4111 387
133 3300042612 Ga0466705_376176 Ga0466705_376176_4417_5580 387
134 3300042616 Ga0466715_273908 Ga0466715_273908_3254_4417 387
135 3300042643 Ga0466704_362007 Ga0466704_362007_4424_5587 387
136 3300042648 Ga0466709_006965 Ga0466709_006965_5608_6771 387
137 iso_pr_bacteria 2940199050 2940201137 387
138 iso_pr_bacteria 2940209341 2940209541 387
139 iso_pr_bacteria 2940346213 2940348049 387
140 2225789004 2227236350 2227674185 388
141 3300000062 IMNBL1DRAFT_c0013829 IMNBL1DRAFT_00138291 388
142 3300042606 Ga0466719_353865 Ga0466719_353865_655_1821 388
143 3300042612 Ga0466705_033023 Ga0466705_033023_6686_7852 388
144 3300042605 Ga0466716_209854 Ga0466716_209854_691_1860 389
145 3300042615 Ga0466711_433146 Ga0466711_433146_227_1396 389
146 iso_pr_bacteria 2940216256 2940217327 390
147 iso_pr_bacteria 2910926975 2910929138 391
148 3300042648 Ga0466709_188845 Ga0466709_188845_5983_7161 392
149 3300042606 Ga0466719_431354 Ga0466719_431354_3686_4873 395
150 3300042636 Ga0466703_065818 Ga0466703_065818_2189_3424 411
151 3300000062 IMNBL1DRAFT_c0020421 IMNBL1DRAFT_00204214 414
152 3300000062 IMNBL1DRAFT_c0008174 IMNBL1DRAFT_00081743 417
153 3300042612 Ga0466705_170506 Ga0466705_170506_5370_6638 422
154 3300042652 Ga0466708_138315 Ga0466708_138315_236_1549 437

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13905 Thioredoxin_8 Thioredoxin-like 328 418 0.97
PF14289 DUF4369 Domain of unknown function (DUF4369) 77 169 0.94
PF00578 AhpC-TSA AhpC/TSA family 309 421 0.84

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.62 0.7 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.