Protein Family IF09901
Metagenome
Isolate
260
Members
148
Samples
184
Scaffolds
441.95
Avg Length
Representative Sequence
- ID
- 3300042652|Ga0466708_130429|Ga0466708_130429_18982_20409
- Length
- 475 aa
- Sequence
- LLRKTRLRAAAQPATPPGRAESTFAHANEKAQAMSSMTPQEIVSELDRHIVGQQEAKRAVAIALRNRWRRQQVDEKLRPEITPKNILMIGPTGVGKTEIARRLAQLAGAPFIKVEATKFTEVGYVGKDVDSIIRDLADLAIKQTREQEMKKHRTRAEDLAEERVLDALIPQPRLADGASDGAARQSFRKKLREGQLGDKEIELELMQPAPTLEVMSPPGMEEMAEQLKNMIGSMGAGRRKQRRLKISEAMKLLIDEEAAKLLNEDDVRAQAIQNLEQNGIVFIDEIDKVATRGGEGXXXSSAEISRQGVQRDLLPLVEGTTVSTKYGMVRTDHVLFIASGAFHLAKPSDLIPELQGRLPIRVELASLSIEDFKAILTQTHASLVRQYQALLATEGVNLEFTDDGVARIAEIACAVNEKTENIGARRLATVMERLLDEVSFDAAHLQDKNVRIDAAYVDQRLGALSQDEDLSRYIL
Sample Types
Isolate
29.2%
Metagenome
70.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
20.8%
Termitidae
16.7%
Drosophilidae
13.9%
Formicidae
9.7%
Kalotermitidae
9.0%
Culicidae
6.2%
Elmidae
5.6%
Apidae
2.8%
Rhinotermitidae
2.1%
Psyllidae
1.4%
Pteromalidae
1.4%
Pulicidae
1.4%
Termopsidae
1.4%
Armadillidiidae
1.4%
Passalidae
0.7%
Cixiidae
0.7%
Aphididae
0.7%
Cimicidae
0.7%
Silvanidae
0.7%
Delphacidae
0.7%
Hodotermitidae
0.7%
Carposinidae
0.7%
Alydidae
0.7%
Taxonomy
Archaea
0
Bacteria
216
Eukaryota
0
Viruses
0
Unclassified
44
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 2 | 2209111014 | Host-associated microbial communities from Diaphorina citri thoracic segments in Florida, USA - ACP | Metagenome | Psyllidae |
| 3 | 2721755752 | Wolbachia endosymbiont of Drosophila incompta wInc_Cu | Isolate | Drosophilidae |
| 4 | 2834326310 | Wolbachia endosymbiont of Drosophila ananassae wAna_India | Isolate | Drosophilidae |
| 5 | 2838140227 | Dyella sp. OAE510 | Isolate | Unclassified |
| 6 | 2840963544 | Wolbachia endosymbiont of Nomada leucophthalma wNleu | Isolate | Apidae |
| 7 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 8 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 9 | 642979308 | Wolbachia endosymbiont of Culex quinquefasciatus JHB | Isolate | Culicidae |
| 10 | 643692055 | Wolbachia sp. wRi | Isolate | Drosophilidae |
| 11 | 643886011 | Wolbachia sp. wUni (Muscidifurax uniraptor) | Isolate | Pteromalidae |
| 12 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 13 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 14 | 3300029809 | Ant gut bacterial community from Dolichoderus sp. 3-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC188 | Metagenome | Formicidae |
| 15 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 16 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 17 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 18 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 19 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 20 | 2820146621 | Unclassified Proteobacteria Emb289P3bin103 | Isolate | Unclassified |
| 21 | 2517572215 | Wolbachia endosymbiont of Drosophila suzukii wSuzi | Isolate | Drosophilidae |
| 22 | 2820669764 | Unclassified Firmicutes Co191P3bin30 | Isolate | Unclassified |
| 23 | 2848715743 | Wolbachia endosymbiont of Drosophila ananassae wAna_Indonesia | Isolate | Drosophilidae |
| 24 | 2884843004 | Wolbachia endosymbiont of Ctenocephalides felis wCfeT | Isolate | Pulicidae |
| 25 | 2854540230 | Acetobacter sp. DsW_063 | Isolate | Drosophilidae |
| 26 | 2896279687 | Wolbachia endosymbiont of Cardiocondyla obscurior wCobs-BR2009-alpha | Isolate | Formicidae |
| 27 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 28 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 29 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 30 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 31 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 32 | 639279308 | Ehrlichia ruminantium Welgevonden, ARC-OVI | Isolate | Unclassified |
| 33 | 3002394112 | Gluconobacter sp. Gdi | Isolate | Drosophilidae |
| 34 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 35 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 36 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 37 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 38 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 39 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 40 | 2820189034 | Unclassified Planctomycetes Emb289P4bin17 | Isolate | Unclassified |
| 41 | 2568526663 | Wolbachia pipientis wMelPop | Isolate | Drosophilidae |
| 42 | 2834038347 | Gluconobacter sp. DsW_058 | Isolate | Drosophilidae |
| 43 | 2840666718 | Wolbachia pipientis wAlbB | Isolate | Culicidae |
| 44 | 2843484624 | Wolbachia endosymbiont of Nomada ferruginata wNfe | Isolate | Apidae |
| 45 | 2845988041 | Wolbachia sp. wRi | Isolate | Drosophilidae |
| 46 | 2845999109 | Wolbachia endosymbiont of Nomada flava wNfla | Isolate | Apidae |
| 47 | 2846015620 | Wolbachia sp. wMel_KL | Isolate | Drosophilidae |
| 48 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 49 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 50 | 642555168 | Wolbachia endosymbiont of Culex quinquefasciatus Pel | Isolate | Culicidae |
| 51 | 3002821025 | Wolbachia endosymbiont of Pentalonia nigronervosa WolPenNig | Isolate | Aphididae |
| 52 | 3002825763 | Candidatus Wolbachia massiliensis PL13 | Isolate | Cimicidae |
| 53 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 54 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 55 | 2993991113 | Shikimatogenerans silvanidophilus JKI-2014 | Isolate | Silvanidae |
| 56 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 57 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 58 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 59 | 2513237282 | Wolbachia endosymbiont wVitB of Nasonia vitripennis | Isolate | Pteromalidae |
| 60 | 2513237393 | Gluconobacter morbifer G707 | Isolate | Drosophilidae |
| 61 | 2540341171 | Wolbachia endosymbiont of Drosophila simulans wHa | Isolate | Drosophilidae |
| 62 | 2547132200 | Wolbachia sp (Diaphorina citri) | Isolate | Psyllidae |
| 63 | 2619619280 | Wolbachia pipientis wAu | Isolate | Drosophilidae |
| 64 | 2820157249 | Unclassified Proteobacteria Cu122P4bin11 | Isolate | Unclassified |
| 65 | 2820161938 | Unclassified Proteobacteria Cu122P3bin14 | Isolate | Unclassified |
| 66 | 2588253760 | Wolbachia endosymbiont wPip_Mol of Culex molestus | Isolate | Culicidae |
| 67 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 68 | 2896342394 | Wolbachia endosymbiont of Nilaparvata lugens wLug | Isolate | Delphacidae |
| 69 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 70 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 71 | 637000340 | Wolbachia endosymbiont TRS of Brugia malayi | Isolate | Unclassified |
| 72 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 73 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 74 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 75 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 76 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 77 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 78 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 79 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 80 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 81 | 2513237285 | Wolbachia pipientis wAlbB | Isolate | Culicidae |
| 82 | 2681813507 | Insolitispirillum peregrinum integrum DSM 11589 | Isolate | Unclassified |
| 83 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 84 | 2820193510 | Unclassified Planctomycetes Emb289P3bin83 | Isolate | Unclassified |
| 85 | 2636416119 | Wolbachia endosymbiont of Drosophila simulans | Isolate | Drosophilidae |
| 86 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 87 | 2884844624 | Wolbachia endosymbiont of Ctenocephalides felis wCfeJ | Isolate | Pulicidae |
| 88 | 639279309 | Ehrlichia ruminantium Welgevonden, CIRAD | Isolate | Unclassified |
| 89 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 90 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 91 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 92 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 93 | 3300028910 | Ant gut bacterial community from Dolichoderus sp. 1-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC161 | Metagenome | Formicidae |
| 94 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 95 | 2820164216 | Unclassified Proteobacteria Cu122P1bin22 | Isolate | Unclassified |
| 96 | 2841175817 | Komagataeibacter saccharivorans JH1 | Isolate | Unclassified |
| 97 | 2845997892 | Wolbachia sp. wMel_AMD | Isolate | Drosophilidae |
| 98 | 2846028689 | Wolbachia endosymbiont of Nomada panzeri wNpa | Isolate | Apidae |
| 99 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 100 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 101 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 102 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 103 | 638341232 | Wolbachia endosymbiont of Drosophila ananassae | Isolate | Drosophilidae |
| 104 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 105 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 106 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 107 | 3300009460 | Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov | Metagenome | |
| 108 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 109 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 110 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 111 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 112 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 113 | 2820059968 | Unclassified Proteobacteria Nt197P4bin23 | Isolate | Unclassified |
| 114 | 2744054723 | Ehrlichia ruminantium Palm River | Isolate | Unclassified |
| 115 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 116 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 117 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 118 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 119 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 120 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | |
| 121 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 122 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 123 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 124 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 125 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 126 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 127 | 3300009453 | Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov | Metagenome | |
| 128 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 129 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 130 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 131 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 132 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 133 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 134 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 135 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 136 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 137 | 8116947750 | Gluconacetobacter sacchari DSM 12717 | Isolate | Unclassified |
| 138 | 2540341172 | Wolbachia endosymbiont of Drosophila simulans wNo | Isolate | Drosophilidae |
| 139 | 2820077244 | Unclassified Proteobacteria Lab288P4bin72 | Isolate | Unclassified |
| 140 | 2820148564 | Unclassified Proteobacteria Emb289P1bin36 | Isolate | Unclassified |
| 141 | 2843491798 | Wolbachia endosymbiont of Drosophila ananassae wAna_Hawaii | Isolate | Drosophilidae |
| 142 | 2884841417 | Wolbachia endosymbiont of Carposina sasakii wCauA | Isolate | Carposinidae |
| 143 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 144 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 145 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 146 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 147 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 148 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | CVPL010W_10006681 | 3300002931 | Bacteria | 11694 |
| 2 | Ga0466701_039976 | 3300042598 | Bacteria | 327114 |
| 3 | Ga0466706_022719 | 3300042599 | Bacteria | 6904 |
| 4 | Ga0466716_477318 | 3300042605 | Bacteria | 4864 |
| 5 | Ga0466719_014346 | 3300042606 | Bacteria | 7505 |
| 6 | Ga0466719_230899 | 3300042606 | Bacteria | 11173 |
| 7 | Ga0123353_10046087 | 3300010167 | Bacteria | 6924 |
| 8 | Ga0466710_436565 | 3300042613 | Bacteria | 28561 |
| 9 | Ga0466710_446370 | 3300042613 | Bacteria | 2548 |
| 10 | Ga0466711_502593 | 3300042615 | Bacteria | 5249 |
| 11 | Ga0466723_087960 | 3300042618 | Unclassified | 4574 |
| 12 | Ga0466723_369063 | 3300042618 | Bacteria | 6199 |
| 13 | Ga0466729_109686 | 3300042621 | Bacteria | 28411 |
| 14 | Ga0160467_100119 | 3300012829 | Bacteria | 111101 |
| 15 | Ga0466656_024038 | 3300042550 | Unclassified | 14808 |
| 16 | Ga0466657_347384 | 3300042582 | Bacteria | 1869 |
| 17 | Ga0466691_188266 | 3300042593 | Bacteria | 17944 |
| 18 | Ga0466729_294384 | 3300042621 | Bacteria | 3535 |
| 19 | Ga0466731_139671 | 3300042622 | Bacteria | 6440 |
| 20 | Ga0466734_108500 | 3300042623 | Bacteria | 10383 |
| 21 | Ga0466735_062511 | 3300042624 | Bacteria | 6074 |
| 22 | Ga0466704_531803 | 3300042643 | Bacteria | 1837 |
| 23 | Ga0466708_051597 | 3300042652 | Unclassified | 6562 |
| 24 | Ga0466725_037401 | 3300042654 | Bacteria | 5725 |
| 25 | Ga0466725_452720 | 3300042654 | Bacteria | 10466 |
| 26 | Ga0466705_168310 | 3300042612 | Unclassified | 2399 |
| 27 | 2218084987 | 2209111014 | Bacteria | 68114 |
| 28 | JGI24702J35022_10000186 | 3300002462 | Bacteria | 33189 |
| 29 | CVPL010W_10003165 | 3300002931 | Unclassified | 21331 |
| 30 | Ga0102737_1001855 | 3300007142 | Bacteria | 5578 |
| 31 | Ga0103264_1000012 | 3300007188 | Bacteria | 124297 |
| 32 | Ga0103264_1000085 | 3300007188 | Bacteria | 60514 |
| 33 | Ga0103264_1000729 | 3300007188 | Bacteria | 15497 |
| 34 | Ga0466707_034033 | 3300042601 | Bacteria | 21912 |
| 35 | Ga0466719_427289 | 3300042606 | Bacteria | 52636 |
| 36 | Ga0466721_387951 | 3300042608 | Unclassified | 4261 |
| 37 | Ga0123357_10113670 | 3300009784 | Bacteria | 3440 |
| 38 | Ga0123355_10141806 | 3300009826 | Bacteria | 3675 |
| 39 | Ga0123353_10090450 | 3300010167 | Bacteria | 4929 |
| 40 | Ga0123354_10140541 | 3300010882 | Unclassified | 2990 |
| 41 | Ga0466728_114459 | 3300042620 | Bacteria | 18765 |
| 42 | Ga0466657_147289 | 3300042582 | Bacteria | 48033 |
| 43 | Ga0466690_122088 | 3300042590 | Bacteria | 4493 |
| 44 | Ga0466692_189017 | 3300042591 | Bacteria | 12325 |
| 45 | Ga0466691_101857 | 3300042593 | Unclassified | 1921 |
| 46 | Ga0466731_357514 | 3300042622 | Unclassified | 15512 |
| 47 | Ga0466734_009803 | 3300042623 | Bacteria | 5748 |
| 48 | Ga0466703_003338 | 3300042636 | Bacteria | 175525 |
| 49 | Ga0466709_372332 | 3300042648 | Unclassified | 15272 |
| 50 | Ga0466727_157864 | 3300042655 | Bacteria | 23797 |
| 51 | Ga0466727_250846 | 3300042655 | Bacteria | 9319 |
| 52 | Ga0102737_1000327 | 3300007142 | Unclassified | 16230 |
| 53 | Ga0103264_1000241 | 3300007188 | Bacteria | 33454 |
| 54 | Ga0466733_185417 | 3300042659 | Bacteria | 37806 |
| 55 | Ga0466701_080810 | 3300042598 | Unclassified | 2315 |
| 56 | Ga0466706_108103 | 3300042599 | Bacteria | 5411 |
| 57 | Ga0466719_001615 | 3300042606 | Unclassified | 5669 |
| 58 | Ga0466723_024489 | 3300042618 | Bacteria | 29623 |
| 59 | Ga0466728_250551 | 3300042620 | Bacteria | 5045 |
| 60 | Ga0160472_100708 | 3300012839 | Bacteria | 15698 |
| 61 | Ga0160447_100860 | 3300012849 | Bacteria | 12993 |
| 62 | Ga0466656_064900 | 3300042550 | Bacteria | 1541 |
| 63 | Ga0466657_056541 | 3300042582 | Bacteria | 144917 |
| 64 | Ga0466657_281335 | 3300042582 | Bacteria | 2787 |
| 65 | Ga0466690_048983 | 3300042590 | Bacteria | 2589 |
| 66 | Ga0466690_255335 | 3300042590 | Bacteria | 4678 |
| 67 | Ga0466731_036213 | 3300042622 | Bacteria | 13986 |
| 68 | Ga0466703_207993 | 3300042636 | Bacteria | 14216 |
| 69 | Ga0466709_123452 | 3300042648 | Bacteria | 22742 |
| 70 | Ga0466708_384532 | 3300042652 | Bacteria | 2733 |
| 71 | Ga0466725_131078 | 3300042654 | Bacteria | 16795 |
| 72 | CVPL010W_10000454 | 3300002931 | Bacteria | 42797 |
| 73 | CVPL005W_1000108 | 3300002934 | Unclassified | 34938 |
| 74 | CVPL005W_1000808 | 3300002934 | Unclassified | 10542 |
| 75 | CVPL005L_10001334 | 3300002938 | Bacteria | 28420 |
| 76 | Ga0072941_1073353 | 3300005201 | Bacteria | 4985 |
| 77 | Ga0104050_1000269 | 3300007153 | Bacteria | 16924 |
| 78 | Ga0103264_1000032 | 3300007188 | Bacteria | 148835 |
| 79 | Ga0103264_1000860 | 3300007188 | Bacteria | 17626 |
| 80 | Ga0123357_10000016 | 3300009784 | Bacteria | 146511 |
| 81 | Ga0466713_010117 | 3300042602 | Bacteria | 24141 |
| 82 | Ga0466716_315630 | 3300042605 | Bacteria | 30831 |
| 83 | Ga0466719_062489 | 3300042606 | Bacteria | 4305 |
| 84 | Ga0123356_10045276 | 3300010049 | Unclassified | 4094 |
| 85 | Ga0160459_100588 | 3300012831 | Unclassified | 13263 |
| 86 | Ga0160443_104206 | 3300012848 | Bacteria | 2225 |
| 87 | Ga0466693_006785 | 3300042592 | Bacteria | 1516 |
| 88 | Ga0466691_100773 | 3300042593 | Bacteria | 34233 |
| 89 | Ga0466703_051988 | 3300042636 | Bacteria | 2313 |
| 90 | Ga0466704_061300 | 3300042643 | Bacteria | 59338 |
| 91 | Ga0466704_107855 | 3300042643 | Unclassified | 20927 |
| 92 | Ga0466704_444442 | 3300042643 | Bacteria | 78967 |
| 93 | Ga0466704_516229 | 3300042643 | Bacteria | 12138 |
| 94 | Ga0466725_222889 | 3300042654 | Bacteria | 6890 |
| 95 | Ga0127656_102610 | 3300009453 | Bacteria | 11710 |
| 96 | Ga0466701_028824 | 3300042598 | Bacteria | 1770 |
| 97 | Ga0466716_011417 | 3300042605 | Bacteria | 34761 |
| 98 | Ga0123355_10073680 | 3300009826 | Unclassified | 5471 |
| 99 | Ga0123356_10080683 | 3300010049 | Bacteria | 3076 |
| 100 | Ga0466715_024258 | 3300042616 | Unclassified | 4570 |
| 101 | Ga0466715_340039 | 3300042616 | Bacteria | 7978 |
| 102 | Ga0466728_359148 | 3300042620 | Unclassified | 4379 |
| 103 | Ga0466690_142441 | 3300042590 | Bacteria | 2512 |
| 104 | Ga0466690_277140 | 3300042590 | Bacteria | 18089 |
| 105 | Ga0466730_043743 | 3300042625 | Bacteria | 9919 |
| 106 | Ga0466709_403462 | 3300042648 | Bacteria | 10082 |
| 107 | Ga0466724_05623 | 3300042649 | Unclassified | 1602 |
| 108 | Ga0466697_135841 | 3300042611 | Bacteria | 2997 |
| 109 | IMNBL1DRAFT_c0004545 | 3300000062 | Bacteria | 8292 |
| 110 | JGI24705J35276_12238703 | 3300002504 | Bacteria | 39951 |
| 111 | WW0001_100254 | 3300002732 | Bacteria | 17581 |
| 112 | Ga0102735_1000556 | 3300007080 | Unclassified | 7572 |
| 113 | Ga0102740_1000994 | 3300007140 | Unclassified | 7563 |
| 114 | Ga0102737_1001993 | 3300007142 | Bacteria | 5288 |
| 115 | Ga0103264_1000527 | 3300007188 | Bacteria | 24761 |
| 116 | Ga0104147_1006364 | 3300007224 | Bacteria | 35865 |
| 117 | Ga0466707_237744 | 3300042601 | Bacteria | 15150 |
| 118 | Ga0466716_107189 | 3300042605 | Bacteria | 11471 |
| 119 | Ga0466719_540828 | 3300042606 | Bacteria | 3666 |
| 120 | Ga0466722_132817 | 3300042609 | Bacteria | 7420 |
| 121 | Ga0123357_10102677 | 3300009784 | Unclassified | 3680 |
| 122 | Ga0123356_10061419 | 3300010049 | Bacteria | 3509 |
| 123 | Ga0123353_10045408 | 3300010167 | Unclassified | 6971 |
| 124 | Ga0123354_10007831 | 3300010882 | Bacteria | 16176 |
| 125 | Ga0160471_100072 | 3300012812 | Unclassified | 89657 |
| 126 | Ga0466710_001748 | 3300042613 | Bacteria | 32356 |
| 127 | Ga0466715_056881 | 3300042616 | Bacteria | 19859 |
| 128 | Ga0466715_378042 | 3300042616 | Bacteria | 32504 |
| 129 | Ga0309903_100036 | 3300029809 | Unclassified | 6920 |
| 130 | Ga0466657_070885 | 3300042582 | Bacteria | 103407 |
| 131 | Ga0466691_101654 | 3300042593 | Bacteria | 11482 |
| 132 | Ga0466731_157955 | 3300042622 | Bacteria | 8262 |
| 133 | Ga0466730_047282 | 3300042625 | Bacteria | 2597 |
| 134 | Ga0466703_194713 | 3300042636 | Bacteria | 6819 |
| 135 | Ga0466704_443834 | 3300042643 | Bacteria | 10877 |
| 136 | Ga0466708_135925 | 3300042652 | Bacteria | 37837 |
| 137 | Ga0466725_109824 | 3300042654 | Bacteria | 4341 |
| 138 | Ga0466727_142994 | 3300042655 | Bacteria | 1529 |
| 139 | CVPL005W_1000371 | 3300002934 | Unclassified | 18994 |
| 140 | CVPL005L_10001627 | 3300002938 | Bacteria | 39976 |
| 141 | Ga0068305_10214214 | 3300005083 | Bacteria | 4014 |
| 142 | Ga0102736_1004209 | 3300007052 | Unclassified | 1968 |
| 143 | Ga0102734_1005580 | 3300007129 | Bacteria | 2807 |
| 144 | Ga0102738_1000267 | 3300007141 | Bacteria | 10202 |
| 145 | Ga0127649_123845 | 3300009460 | Unclassified | 13918 |
| 146 | Ga0466701_026230 | 3300042598 | Bacteria | 150849 |
| 147 | Ga0466698_036085 | 3300042610 | Unclassified | 7342 |
| 148 | Ga0123356_10053730 | 3300010049 | Unclassified | 3750 |
| 149 | Ga0123354_10000389 | 3300010882 | Unclassified | 42155 |
| 150 | Ga0466715_001823 | 3300042616 | Unclassified | 19038 |
| 151 | Ga0466723_087978 | 3300042618 | Bacteria | 4383 |
| 152 | Ga0466695_092957 | 3300042595 | Bacteria | 11629 |
| 153 | Ga0466701_011467 | 3300042598 | Bacteria | 66061 |
| 154 | Ga0466730_030910 | 3300042625 | Bacteria | 6607 |
| 155 | Ga0466730_064277 | 3300042625 | Bacteria | 203805 |
| 156 | Ga0466704_295382 | 3300042643 | Unclassified | 3031 |
| 157 | Ga0466724_60078 | 3300042649 | Unclassified | 5223 |
| 158 | Ga0466725_069174 | 3300042654 | Bacteria | 4695 |
| 159 | Ga0466705_006413 | 3300042612 | Bacteria | 39277 |
| 160 | JGI24695J34938_10003381 | 3300002450 | Unclassified | 11207 |
| 161 | Ga0102740_1002104 | 3300007140 | Unclassified | 7998 |
| 162 | Ga0466701_095031 | 3300042598 | Bacteria | 9123 |
| 163 | Ga0466707_038566 | 3300042601 | Bacteria | 13336 |
| 164 | Ga0466713_130829 | 3300042602 | Bacteria | 17811 |
| 165 | Ga0466717_058505 | 3300042604 | Bacteria | 5583 |
| 166 | Ga0466719_190476 | 3300042606 | Bacteria | 6921 |
| 167 | Ga0466719_260531 | 3300042606 | Unclassified | 5498 |
| 168 | Ga0123355_10083353 | 3300009826 | Bacteria | 5096 |
| 169 | Ga0123354_10000618 | 3300010882 | Bacteria | 37182 |
| 170 | Ga0123354_10023985 | 3300010882 | Bacteria | 9624 |
| 171 | Ga0466710_235629 | 3300042613 | Bacteria | 11828 |
| 172 | Ga0466710_328451 | 3300042613 | Bacteria | 35241 |
| 173 | Ga0309902_000026 | 3300028910 | Unclassified | 12851 |
| 174 | Ga0466657_037723 | 3300042582 | Bacteria | 15201 |
| 175 | Ga0466690_075561 | 3300042590 | Bacteria | 15327 |
| 176 | Ga0466691_126700 | 3300042593 | Bacteria | 4773 |
| 177 | Ga0466691_174247 | 3300042593 | Bacteria | 67252 |
| 178 | Ga0466695_162929 | 3300042595 | Unclassified | 5785 |
| 179 | Ga0466704_385797 | 3300042643 | Bacteria | 8229 |
| 180 | Ga0466709_378423 | 3300042648 | Bacteria | 8228 |
| 181 | Ga0466708_130429 | 3300042652 | Bacteria | 31456 |
| 182 | Ga0466708_173429 | 3300042652 | Bacteria | 11050 |
| 183 | Ga0466708_185351 | 3300042652 | Unclassified | 7214 |
| 184 | Ga0466725_040162 | 3300042654 | Unclassified | 17661 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042608 | Ga0466721_387951 | Ga0466721_387951_376_1452 | 358 |
| 2 | 3300042591 | Ga0466692_189017 | Ga0466692_189017_989_2332 | 380 |
| 3 | 3300042654 | Ga0466725_040162 | Ga0466725_040162_11261_12580 | 384 |
| 4 | 3300042606 | Ga0466719_001615 | Ga0466719_001615_368_1765 | 385 |
| 5 | 3300042612 | Ga0466705_006413 | Ga0466705_006413_21596_22927 | 385 |
| 6 | 3300042643 | Ga0466704_061300 | Ga0466704_061300_41968_43299 | 385 |
| 7 | 3300042648 | Ga0466709_378423 | Ga0466709_378423_155_1480 | 388 |
| 8 | 3300042590 | Ga0466690_075561 | Ga0466690_075561_7954_9276 | 390 |
| 9 | 3300042621 | Ga0466729_294384 | Ga0466729_294384_314_1636 | 392 |
| 10 | 3300042601 | Ga0466707_034033 | Ga0466707_034033_11663_12997 | 393 |
| 11 | 3300042654 | Ga0466725_037401 | Ga0466725_037401_2348_3682 | 393 |
| 12 | 3300042598 | Ga0466701_080810 | Ga0466701_080810_802_2133 | 394 |
| 13 | 3300042616 | Ga0466715_056881 | Ga0466715_056881_17752_19074 | 395 |
| 14 | 3300042636 | Ga0466703_194713 | Ga0466703_194713_1746_3077 | 395 |
| 15 | 3300010167 | Ga0123353_10046087 | Ga0123353_100460872 | 396 |
| 16 | 3300042595 | Ga0466695_162929 | Ga0466695_162929_1285_2667 | 396 |
| 17 | 3300042601 | Ga0466707_038566 | Ga0466707_038566_440_1780 | 396 |
| 18 | 3300042601 | Ga0466707_237744 | Ga0466707_237744_539_1879 | 396 |
| 19 | 3300042582 | Ga0466657_056541 | Ga0466657_056541_136224_137567 | 397 |
| 20 | 3300042582 | Ga0466657_070885 | Ga0466657_070885_34182_35519 | 397 |
| 21 | 3300042582 | Ga0466657_147289 | Ga0466657_147289_41236_42579 | 397 |
| 22 | 3300042606 | Ga0466719_230899 | Ga0466719_230899_4720_6051 | 397 |
| 23 | 3300042613 | Ga0466710_436565 | Ga0466710_436565_26216_27553 | 397 |
| 24 | 3300010049 | Ga0123356_10045276 | Ga0123356_100452763 | 398 |
| 25 | 3300042654 | Ga0466725_222889 | Ga0466725_222889_2848_4191 | 398 |
| 26 | 3300042649 | Ga0466724_05623 | Ga0466724_05623_191_1534 | 399 |
| 27 | 3300042655 | Ga0466727_157864 | Ga0466727_157864_19312_20646 | 399 |
| 28 | 3300009784 | Ga0123357_10000016 | Ga0123357_1000001628 | 400 |
| 29 | 3300042582 | Ga0466657_037723 | Ga0466657_037723_1310_2653 | 400 |
| 30 | 3300002462 | JGI24702J35022_10000186 | JGI24702J35022_1000018642 | 401 |
| 31 | 3300010049 | Ga0123356_10061419 | Ga0123356_100614192 | 401 |
| 32 | 3300010882 | Ga0123354_10007831 | Ga0123354_100078319 | 401 |
| 33 | 3300042598 | Ga0466701_095031 | Ga0466701_095031_6209_7528 | 401 |
| 34 | 3300042613 | Ga0466710_328451 | Ga0466710_328451_13707_15050 | 401 |
| 35 | 3300042623 | Ga0466734_108500 | Ga0466734_108500_3780_5123 | 401 |
| 36 | 3300010882 | Ga0123354_10000389 | Ga0123354_1000038927 | 402 |
| 37 | 3300042623 | Ga0466734_009803 | Ga0466734_009803_327_1661 | 402 |
| 38 | 3300042590 | Ga0466690_277140 | Ga0466690_277140_5469_6815 | 403 |
| 39 | 3300042606 | Ga0466719_190476 | Ga0466719_190476_2327_3709 | 403 |
| 40 | 3300042652 | Ga0466708_135925 | Ga0466708_135925_15238_16569 | 403 |
| 41 | 3300042602 | Ga0466713_010117 | Ga0466713_010117_6798_8147 | 404 |
| 42 | 3300042618 | Ga0466723_024489 | Ga0466723_024489_14871_16217 | 404 |
| 43 | 3300010167 | Ga0123353_10090450 | Ga0123353_100904502 | 406 |
| 44 | 3300042659 | Ga0466733_185417 | Ga0466733_185417_35661_37001 | 407 |
| 45 | 3300042602 | Ga0466713_130829 | Ga0466713_130829_8362_9669 | 408 |
| 46 | 3300042648 | Ga0466709_123452 | Ga0466709_123452_3609_4955 | 408 |
| 47 | 3300012831 | Ga0160459_100588 | Ga0160459_1005882 | 409 |
| 48 | 3300012849 | Ga0160447_100860 | Ga0160447_10086013 | 409 |
| 49 | 3300042625 | Ga0466730_043743 | Ga0466730_043743_8330_9679 | 409 |
| 50 | 3300009784 | Ga0123357_10102677 | Ga0123357_101026775 | 410 |
| 51 | 3300042609 | Ga0466722_132817 | Ga0466722_132817_509_1858 | 410 |
| 52 | 3300042593 | Ga0466691_100773 | Ga0466691_100773_13887_15128 | 413 |
| 53 | 3300042616 | Ga0466715_001823 | Ga0466715_001823_15210_16541 | 413 |
| 54 | 3300042598 | Ga0466701_026230 | Ga0466701_026230_51473_52816 | 414 |
| 55 | 3300042616 | Ga0466715_378042 | Ga0466715_378042_23815_25125 | 415 |
| 56 | 3300042593 | Ga0466691_101654 | Ga0466691_101654_425_1726 | 418 |
| 57 | 3300002450 | JGI24695J34938_10003381 | JGI24695J34938_100033816 | 419 |
| 58 | 3300042590 | Ga0466690_142441 | Ga0466690_142441_631_2052 | 419 |
| 59 | 3300042654 | Ga0466725_452720 | Ga0466725_452720_4112_5437 | 421 |
| 60 | 3300010882 | Ga0123354_10140541 | Ga0123354_101405411 | 423 |
| 61 | 3300012839 | Ga0160472_100708 | Ga0160472_10070810 | 423 |
| 62 | 3300042613 | Ga0466710_001748 | Ga0466710_001748_10034_11371 | 423 |
| 63 | 3300042592 | Ga0466693_006785 | Ga0466693_006785_137_1462 | 424 |
| 64 | 3300002504 | JGI24705J35276_12238703 | JGI24705J35276_1223870333 | 426 |
| 65 | 3300042606 | Ga0466719_260531 | Ga0466719_260531_172_1497 | 427 |
| 66 | 3300042604 | Ga0466717_058505 | Ga0466717_058505_1085_2419 | 428 |
| 67 | 3300012829 | Ga0160467_100119 | Ga0160467_10011975 | 429 |
| 68 | 3300042598 | Ga0466701_039976 | Ga0466701_039976_309103_310410 | 429 |
| 69 | 3300042613 | Ga0466710_235629 | Ga0466710_235629_4816_6150 | 429 |
| 70 | 3300042625 | Ga0466730_064277 | Ga0466730_064277_161434_162741 | 429 |
| 71 | 3300042649 | Ga0466724_60078 | Ga0466724_60078_3151_4470 | 429 |
| 72 | 3300042654 | Ga0466725_069174 | Ga0466725_069174_1478_2800 | 429 |
| 73 | 3300042582 | Ga0466657_281335 | Ga0466657_281335_126_1460 | 430 |
| 74 | 3300042606 | Ga0466719_062489 | Ga0466719_062489_398_1732 | 430 |
| 75 | 3300042625 | Ga0466730_030910 | Ga0466730_030910_4573_5910 | 430 |
| 76 | 3300042643 | Ga0466704_295382 | Ga0466704_295382_505_1800 | 431 |
| 77 | 3300042613 | Ga0466710_446370 | Ga0466710_446370_774_2111 | 432 |
| 78 | 3300010882 | Ga0123354_10023985 | Ga0123354_100239856 | 433 |
| 79 | 3300042643 | Ga0466704_444442 | Ga0466704_444442_30043_31344 | 433 |
| 80 | 3300042643 | Ga0466704_516229 | Ga0466704_516229_377_1678 | 433 |
| 81 | iso_pr_bacteria | 2864968865 | 2864971963 | 433 |
| 82 | 3300042590 | Ga0466690_122088 | Ga0466690_122088_1391_2695 | 434 |
| 83 | 3300042590 | Ga0466690_255335 | Ga0466690_255335_1920_3224 | 434 |
| 84 | 3300042593 | Ga0466691_101857 | Ga0466691_101857_313_1617 | 434 |
| 85 | 3300042593 | Ga0466691_126700 | Ga0466691_126700_544_1848 | 434 |
| 86 | 3300042593 | Ga0466691_174247 | Ga0466691_174247_34153_35457 | 434 |
| 87 | 3300042605 | Ga0466716_107189 | Ga0466716_107189_3395_4699 | 434 |
| 88 | 3300042605 | Ga0466716_315630 | Ga0466716_315630_4388_5692 | 434 |
| 89 | 3300042605 | Ga0466716_477318 | Ga0466716_477318_320_1624 | 434 |
| 90 | 3300042606 | Ga0466719_427289 | Ga0466719_427289_20926_22230 | 434 |
| 91 | 3300042612 | Ga0466705_168310 | Ga0466705_168310_35_1339 | 434 |
| 92 | 3300042620 | Ga0466728_114459 | Ga0466728_114459_228_1532 | 434 |
| 93 | 3300042636 | Ga0466703_003338 | Ga0466703_003338_171119_172423 | 434 |
| 94 | 3300042636 | Ga0466703_207993 | Ga0466703_207993_100_1404 | 434 |
| 95 | 3300042643 | Ga0466704_443834 | Ga0466704_443834_369_1673 | 434 |
| 96 | 3300042643 | Ga0466704_531803 | Ga0466704_531803_175_1479 | 434 |
| 97 | 3300042648 | Ga0466709_403462 | Ga0466709_403462_1826_3130 | 434 |
| 98 | 3300042652 | Ga0466708_173429 | Ga0466708_173429_4215_5519 | 434 |
| 99 | 3300042652 | Ga0466708_384532 | Ga0466708_384532_190_1494 | 434 |
| 100 | 3300042655 | Ga0466727_142994 | Ga0466727_142994_116_1420 | 434 |
| 101 | 3300005083 | Ga0068305_10214214 | Ga0068305_102142143 | 435 |
| 102 | 3300012812 | Ga0160471_100072 | Ga0160471_10007285 | 435 |
| 103 | 3300042593 | Ga0466691_188266 | Ga0466691_188266_16396_17703 | 435 |
| 104 | 3300042599 | Ga0466706_022719 | Ga0466706_022719_408_1715 | 435 |
| 105 | 3300042605 | Ga0466716_011417 | Ga0466716_011417_9569_10876 | 435 |
| 106 | 3300042616 | Ga0466715_340039 | Ga0466715_340039_2675_3982 | 435 |
| 107 | 3300042643 | Ga0466704_385797 | Ga0466704_385797_3083_4390 | 435 |
| 108 | 3300042625 | Ga0466730_047282 | Ga0466730_047282_421_1761 | 436 |
| 109 | 3300042654 | Ga0466725_109824 | Ga0466725_109824_2570_3904 | 436 |
| 110 | 3300042655 | Ga0466727_250846 | Ga0466727_250846_5417_6796 | 436 |
| 111 | iso_pr_bacteria | 2556921622 | 2558099553 | 436 |
| 112 | iso_pr_bacteria | 2681813507 | 2684381013 | 436 |
| 113 | iso_pr_bacteria | 2820146621 | 2820147615 | 436 |
| 114 | iso_pr_bacteria | 2820148564 | 2820149868 | 436 |
| 115 | 3300009826 | Ga0123355_10141806 | Ga0123355_101418064 | 437 |
| 116 | 3300010049 | Ga0123356_10053730 | Ga0123356_100537303 | 437 |
| 117 | 3300042590 | Ga0466690_048983 | Ga0466690_048983_464_1777 | 437 |
| 118 | 3300042615 | Ga0466711_502593 | Ga0466711_502593_2531_3844 | 437 |
| 119 | iso_pr_bacteria | 2841175817 | 2841177025 | 437 |
| 120 | 3300042598 | Ga0466701_028824 | Ga0466701_028824_346_1662 | 438 |
| 121 | 3300042618 | Ga0466723_369063 | Ga0466723_369063_192_1508 | 438 |
| 122 | iso_pr_bacteria | 2513237393 | 2514727161 | 438 |
| 123 | iso_pr_bacteria | 2834038347 | 2834038652 | 438 |
| 124 | iso_pr_bacteria | 2854540230 | 2854542993 | 438 |
| 125 | iso_pr_bacteria | 3002394112 | 3002396022 | 438 |
| 126 | 3300002931 | CVPL010W_10006681 | CVPL010W_100066816 | 439 |
| 127 | 3300002934 | CVPL005W_1000371 | CVPL005W_10003718 | 439 |
| 128 | 3300010167 | Ga0123353_10045408 | Ga0123353_100454081 | 439 |
| 129 | 3300012848 | Ga0160443_104206 | Ga0160443_1042062 | 439 |
| 130 | 3300042550 | Ga0466656_064900 | Ga0466656_064900_10_1329 | 439 |
| 131 | iso_pr_bacteria | 8116947750 | 8116949239 | 439 |
| 132 | 3300007153 | Ga0104050_1000269 | Ga0104050_10002696 | 440 |
| 133 | 3300009784 | Ga0123357_10113670 | Ga0123357_101136703 | 440 |
| 134 | 3300009826 | Ga0123355_10073680 | Ga0123355_100736806 | 441 |
| 135 | 3300009826 | Ga0123355_10083353 | Ga0123355_100833532 | 441 |
| 136 | 3300042654 | Ga0466725_131078 | Ga0466725_131078_7329_8654 | 441 |
| 137 | iso_pr_bacteria | 2820077244 | 2820078827 | 441 |
| 138 | iso_pr_bacteria | 2820157249 | 2820159324 | 441 |
| 139 | iso_pr_bacteria | 2820161938 | 2820163348 | 441 |
| 140 | iso_pr_bacteria | 2820164216 | 2820165155 | 441 |
| 141 | iso_pr_bacteria | 2820669764 | 2820670324 | 441 |
| 142 | 3300010882 | Ga0123354_10000618 | Ga0123354_100006185 | 442 |
| 143 | 3300042595 | Ga0466695_092957 | Ga0466695_092957_7380_8708 | 442 |
| 144 | iso_pr_bacteria | 2603880165 | 2606015503 | 442 |
| 145 | iso_pr_bacteria | 2864764899 | 2864768008 | 442 |
| 146 | iso_pr_bacteria | 2864777284 | 2864780567 | 442 |
| 147 | iso_pr_bacteria | 2864791955 | 2864795774 | 442 |
| 148 | iso_pr_bacteria | 2864796242 | 2864799780 | 442 |
| 149 | iso_pr_bacteria | 2889908211 | 2889908652 | 442 |
| 150 | 3300042598 | Ga0466701_011467 | Ga0466701_011467_53196_54527 | 443 |
| 151 | 3300042606 | Ga0466719_540828 | Ga0466719_540828_530_1861 | 443 |
| 152 | 3300042611 | Ga0466697_135841 | Ga0466697_135841_736_2067 | 443 |
| 153 | 3300042622 | Ga0466731_036213 | Ga0466731_036213_4622_5953 | 443 |
| 154 | 3300042622 | Ga0466731_139671 | Ga0466731_139671_1040_2371 | 443 |
| 155 | 3300042622 | Ga0466731_157955 | Ga0466731_157955_4704_6035 | 443 |
| 156 | iso_pr_bacteria | 2603880170 | 2606027019 | 443 |
| 157 | iso_pr_bacteria | 2687453742 | 2689988962 | 443 |
| 158 | iso_pr_bacteria | 2687453753 | 2690037091 | 443 |
| 159 | iso_pr_bacteria | 8024031916 | 8024032058 | 443 |
| 160 | 3300002931 | CVPL010W_10000454 | CVPL010W_1000045417 | 444 |
| 161 | 3300002931 | CVPL010W_10003165 | CVPL010W_1000316514 | 444 |
| 162 | 3300002934 | CVPL005W_1000108 | CVPL005W_100010832 | 444 |
| 163 | 3300002934 | CVPL005W_1000808 | CVPL005W_10008085 | 444 |
| 164 | 3300002938 | CVPL005L_10001334 | CVPL005L_1000133410 | 444 |
| 165 | 3300002938 | CVPL005L_10001627 | CVPL005L_1000162716 | 444 |
| 166 | 3300007052 | Ga0102736_1004209 | Ga0102736_10042092 | 444 |
| 167 | 3300007129 | Ga0102734_1005580 | Ga0102734_10055803 | 444 |
| 168 | 3300007140 | Ga0102740_1000994 | Ga0102740_10009943 | 444 |
| 169 | 3300007140 | Ga0102740_1002104 | Ga0102740_10021048 | 444 |
| 170 | 3300007142 | Ga0102737_1000327 | Ga0102737_10003275 | 444 |
| 171 | 3300007142 | Ga0102737_1001855 | Ga0102737_10018552 | 444 |
| 172 | 3300007142 | Ga0102737_1001993 | Ga0102737_10019936 | 444 |
| 173 | 3300007188 | Ga0103264_1000012 | Ga0103264_100001291 | 444 |
| 174 | 3300007188 | Ga0103264_1000085 | Ga0103264_100008541 | 444 |
| 175 | 3300007188 | Ga0103264_1000241 | Ga0103264_100024118 | 444 |
| 176 | 3300007188 | Ga0103264_1000527 | Ga0103264_100052719 | 444 |
| 177 | 3300007188 | Ga0103264_1000729 | Ga0103264_10007296 | 444 |
| 178 | 3300007188 | Ga0103264_1000860 | Ga0103264_100086013 | 444 |
| 179 | 3300042599 | Ga0466706_108103 | Ga0466706_108103_1681_3015 | 444 |
| 180 | iso_pr_bacteria | 2617270844 | 2617732874 | 444 |
| 181 | iso_pr_bacteria | 2820059968 | 2820062587 | 444 |
| 182 | 3300000062 | IMNBL1DRAFT_c0004545 | IMNBL1DRAFT_00045454 | 445 |
| 183 | 3300005201 | Ga0072941_1073353 | Ga0072941_10733533 | 445 |
| 184 | iso_pr_bacteria | 2820084079 | 2820084675 | 445 |
| 185 | 3300010049 | Ga0123356_10080683 | Ga0123356_100806832 | 446 |
| 186 | iso_pr_bacteria | 2838140227 | 2838141055 | 446 |
| 187 | iso_pr_bacteria | 2963630348 | 2963633397 | 446 |
| 188 | 3300042621 | Ga0466729_109686 | Ga0466729_109686_1268_2611 | 447 |
| 189 | iso_pr_bacteria | 2864859030 | 2864860263 | 447 |
| 190 | iso_pr_bacteria | 2864914039 | 2864914702 | 447 |
| 191 | iso_pr_bacteria | 2864988360 | 2864989023 | 447 |
| 192 | 3300007141 | Ga0102738_1000267 | Ga0102738_10002673 | 448 |
| 193 | iso_pr_bacteria | 2848339753 | 2848339889 | 448 |
| 194 | 3300007188 | Ga0103264_1000032 | Ga0103264_1000032121 | 452 |
| 195 | iso_pr_bacteria | 2820189034 | 2820191018 | 452 |
| 196 | iso_pr_bacteria | 2820193510 | 2820195977 | 453 |
| 197 | 3300042582 | Ga0466657_347384 | Ga0466657_347384_284_1651 | 455 |
| 198 | 3300042652 | Ga0466708_051597 | Ga0466708_051597_4980_6383 | 462 |
| 199 | 3300042618 | Ga0466723_087978 | Ga0466723_087978_2299_3702 | 467 |
| 200 | iso_pr_bacteria | 3002821025 | 3002821103 | 467 |
| 201 | 3300042618 | Ga0466723_087960 | Ga0466723_087960_470_1894 | 469 |
| 202 | 3300042620 | Ga0466728_250551 | Ga0466728_250551_204_1628 | 469 |
| 203 | 3300042652 | Ga0466708_185351 | Ga0466708_185351_2421_3845 | 469 |
| 204 | 3300042643 | Ga0466704_107855 | Ga0466704_107855_17380_18822 | 472 |
| 205 | 3300042636 | Ga0466703_051988 | Ga0466703_051988_454_1890 | 473 |
| 206 | 3300042652 | Ga0466708_130429 | Ga0466708_130429_18982_20409 | 475 |
| 207 | 3300009453 | Ga0127656_102610 | Ga0127656_10261012 | 477 |
| 208 | 2209111014 | 2218084987 | 2217990952 | 483 |
| 209 | 3300042620 | Ga0466728_359148 | Ga0466728_359148_399_1889 | 483 |
| 210 | iso_pr_bacteria | 2513237282 | 2514345332 | 483 |
| 211 | iso_pr_bacteria | 2513237285 | 2514349875 | 483 |
| 212 | iso_pr_bacteria | 2540341172 | 2540828687 | 483 |
| 213 | iso_pr_bacteria | 2547132200 | 2547772260 | 483 |
| 214 | iso_pr_bacteria | 2588253760 | 2588633014 | 483 |
| 215 | iso_pr_bacteria | 2840666718 | 2840666870 | 483 |
| 216 | iso_pr_bacteria | 2896342394 | 2896343863 | 483 |
| 217 | iso_pr_bacteria | 2993991113 | 2993992717 | 483 |
| 218 | iso_pr_bacteria | 642555168 | 642696318 | 483 |
| 219 | iso_pr_bacteria | 642979308 | 643188354 | 483 |
| 220 | 3300002732 | WW0001_100254 | WW0001_1002548 | 484 |
| 221 | 3300009460 | Ga0127649_123845 | Ga0127649_1238455 | 484 |
| 222 | 3300029809 | Ga0309903_100036 | Ga0309903_1000367 | 485 |
| 223 | 3300042606 | Ga0466719_014346 | Ga0466719_014346_1239_2729 | 487 |
| 224 | iso_pr_bacteria | 2744054723 | 2745419730 | 488 |
| 225 | iso_pr_bacteria | 639279308 | 639304832 | 488 |
| 226 | iso_pr_bacteria | 639279309 | 639314338 | 488 |
| 227 | iso_pr_bacteria | 2884843004 | 2884843485 | 489 |
| 228 | 3300028910 | Ga0309902_000026 | Ga0309902_000026_890_2380 | 496 |
| 229 | 3300042550 | Ga0466656_024038 | Ga0466656_024038_5317_6807 | 496 |
| 230 | 3300042610 | Ga0466698_036085 | Ga0466698_036085_2306_3796 | 496 |
| 231 | 3300042616 | Ga0466715_024258 | Ga0466715_024258_1486_2976 | 496 |
| 232 | 3300042622 | Ga0466731_357514 | Ga0466731_357514_13470_14960 | 496 |
| 233 | 3300042624 | Ga0466735_062511 | Ga0466735_062511_590_2080 | 496 |
| 234 | 3300042648 | Ga0466709_372332 | Ga0466709_372332_6352_7842 | 496 |
| 235 | iso_pr_bacteria | 2517572215 | 2518166261 | 496 |
| 236 | iso_pr_bacteria | 2540341171 | 2540828145 | 496 |
| 237 | iso_pr_bacteria | 2568526663 | 2570725724 | 496 |
| 238 | iso_pr_bacteria | 2619619280 | 2621227957 | 496 |
| 239 | iso_pr_bacteria | 2636416119 | 2639388331 | 496 |
| 240 | iso_pr_bacteria | 2721755752 | 2723833629 | 496 |
| 241 | iso_pr_bacteria | 2834326310 | 2834326973 | 496 |
| 242 | iso_pr_bacteria | 2840963544 | 2840963573 | 496 |
| 243 | iso_pr_bacteria | 2843484624 | 2843485370 | 496 |
| 244 | iso_pr_bacteria | 2843491798 | 2843492221 | 496 |
| 245 | iso_pr_bacteria | 2845988041 | 2845988624 | 496 |
| 246 | iso_pr_bacteria | 2845997892 | 2845998451 | 496 |
| 247 | iso_pr_bacteria | 2845999109 | 2845999526 | 496 |
| 248 | iso_pr_bacteria | 2846015620 | 2846016187 | 496 |
| 249 | iso_pr_bacteria | 2846028689 | 2846029783 | 496 |
| 250 | iso_pr_bacteria | 2848715743 | 2848715845 | 496 |
| 251 | iso_pr_bacteria | 2884841417 | 2884841603 | 496 |
| 252 | iso_pr_bacteria | 2884844624 | 2884845864 | 496 |
| 253 | iso_pr_bacteria | 2896279687 | 2896279806 | 496 |
| 254 | iso_pr_bacteria | 3002825763 | 3002826746 | 496 |
| 255 | iso_pr_bacteria | 637000340 | 637630392 | 496 |
| 256 | iso_pr_bacteria | 638341232 | 638477463 | 496 |
| 257 | iso_pr_bacteria | 643692055 | 643740506 | 496 |
| 258 | iso_pr_bacteria | 643886011 | 644257870 | 496 |
| 259 | 3300007080 | Ga0102735_1000556 | Ga0102735_10005562 | 497 |
| 260 | 3300007224 | Ga0104147_1006364 | Ga0104147_100636431 | 497 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.83 | 0.88 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.