Protein Family IF09875

Metagenome Isolate
178 Members
74 Samples
157 Scaffolds
401.16 Avg Length

🧬 Representative Sequence

ID
3300042652|Ga0466708_090525|Ga0466708_090525_12771_14099
Length
442 aa
Sequence
MRIKRVTVIGASAALGERRAAFAGRAGRFKGKHLLRRIKTMQLKDINLTKEQAIEQTKKYMIETYERFPFVAVRAKDMYLYDENGTGYLDFYGGIAVNSAGSCNEKVVAAVREQVGDIMHTFNYPYTVPQTALAKLICETIGMDKIFFQNSGTESNEAMIKMARKYGVDNYGEKRYHIVTAKDGFHGRTYGALSATGQPDNACQKGFKPMLPGFTYADYNDLESFRAAVTEDTIAIMLEPIQGEGGVVPGTEAFFKGIRKLCDEKGLLLLIDEIQTGWFRTGPAMAYMRFGIKPDAVSMAKAMGGGMPIGAVCATAKMATAFNPGSHGTTYGGNPVCCAAALAQINDMIERKLGDNAAKVGAYFMEELRKLPHVKEVRGEGLLVGVVFDIPRALDIKHGCLDGKLLVTAIGANVVRMVPPLIATKEDCDKAVGIIKAAVEAL

📊 Sample Types

Isolate 11.8%
Metagenome 88.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 25.0%
Termitidae 25.0%
Kalotermitidae 19.4%
Formicidae 13.9%
Termopsidae 5.6%
Rhinotermitidae 4.2%
Scarabaeidae 1.4%
Muscidae 1.4%
Hodotermitidae 1.4%
Culicidae 1.4%
Elmidae 1.4%

🌳 Taxonomy

Archaea 1
Bacteria 167
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820123897 Unclassified Proteobacteria Emb289P4bin18 Isolate Unclassified
2 2820301196 Unclassified Firmicutes Th196P1bin8 Isolate Unclassified
3 2820455747 Unclassified Firmicutes Lab288P3bin160 Isolate Unclassified
4 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
5 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
6 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
7 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
8 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
9 2820845766 Unclassified Actinobacteria Lab288P3bin96 Isolate Unclassified
10 2820641689 Unclassified Firmicutes Cu122P5bin5 Isolate Unclassified
11 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
12 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
13 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
14 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
15 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
16 2820882373 Unclassified Actinobacteria Lab288P1bin45 Isolate Unclassified
17 2687453753 Burkholderiales bacterium B_Cag25 Isolate Unclassified
18 3006468911 Streptomyces sp. RB17 Isolate Termitidae
19 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
20 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
21 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
22 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
23 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
24 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
25 2820894511 Unclassified Actinobacteria Lab288P1bin103 Isolate Unclassified
26 2820734335 Unclassified Chloroflexi Lab288P3bin99 Isolate Unclassified
27 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
28 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
29 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
30 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
31 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
32 8067483258 Ochrobactrum soli MTP-C0764 Isolate Muscidae
33 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
34 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
35 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
36 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
37 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
38 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
39 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
40 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
41 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
42 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
43 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
44 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
45 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
46 2687453742 Burkholderiales bacterium B_Cag20 Isolate Unclassified
47 2820314258 Unclassified Firmicutes Nt197P4bin16 Isolate Unclassified
48 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
49 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
50 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
51 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
52 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
53 2820857933 Unclassified Actinobacteria Lab288P3bin173 Isolate Unclassified
54 2864968865 Paucibacter oligotrophus S00239 Isolate Elmidae
55 2603880170 Burkholderiales A2 Isolate Unclassified
56 2820110010 Unclassified Proteobacteria Emb289P4bin35 Isolate Unclassified
57 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
58 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
59 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
60 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
61 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
62 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
63 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
64 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
65 2590828841 Oscillospiraceae bacterium Ne3 Isolate Termitidae
66 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
67 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
68 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
69 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
70 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
71 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
72 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
73 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
74 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_129486 3300042612 Bacteria 5044
2 Ga0123353_10242533 3300010167 Bacteria 2799
3 Ga0123354_10000832 3300010882 Bacteria 33984
4 Ga0466723_030178 3300042618 Bacteria 6891
5 Ga0466723_150485 3300042618 Bacteria 2087
6 Ga0466728_472943 3300042620 Bacteria 4426
7 Ga0466729_022472 3300042621 Bacteria 2210
8 Ga0103261_1002147 3300007083 Bacteria 3108
9 Ga0466729_264224 3300042621 Bacteria 2138
10 Ga0466704_167863 3300042643 Bacteria 55376
11 Ga0466708_242530 3300042652 Bacteria 7265
12 Ga0466725_079169 3300042654 Bacteria 4993
13 Ga0466727_246604 3300042655 Bacteria 2390
14 Ga0466706_167789 3300042599 Archaea 3245
15 Ga0466707_254471 3300042601 Bacteria 5207
16 Ga0466719_225984 3300042606 Bacteria 3882
17 Ga0466719_344242 3300042606 Bacteria 5358
18 Ga0466722_092343 3300042609 Bacteria 4334
19 Ga0466692_002214 3300042591 Bacteria 6193
20 Ga0466691_210520 3300042593 Bacteria 5751
21 Ga0466705_344612 3300042612 Bacteria 82908
22 Ga0123353_10134213 3300010167 Bacteria 3971
23 Ga0466715_073229 3300042616 Bacteria 22905
24 Ga0466715_096147 3300042616 Unclassified 7324
25 Ga0466715_266814 3300042616 Bacteria 14017
26 Ga0466726_315629 3300042619 Unclassified 1518
27 Ga0466729_066423 3300042621 Bacteria 6101
28 JGI24705J35276_12238345 3300002504 Bacteria 19650
29 Ga0072941_1374021 3300005201 Bacteria 2309
30 Ga0123357_10001076 3300009784 Bacteria 28163
31 Ga0466729_308852 3300042621 Bacteria 5822
32 Ga0466703_373440 3300042636 Bacteria 6400
33 Ga0466704_435581 3300042643 Bacteria 9813
34 Ga0466709_209185 3300042648 Bacteria 72283
35 Ga0466709_258742 3300042648 Bacteria 3040
36 Ga0466708_090525 3300042652 Bacteria 14731
37 Ga0466705_373779 3300042612 Bacteria 1709
38 Ga0123356_10005096 3300010049 Bacteria 13467
39 Ga0123353_10105073 3300010167 Bacteria 4551
40 Ga0123353_10127469 3300010167 Bacteria 4088
41 Ga0466711_335609 3300042615 Bacteria 10646
42 Ga0466715_120283 3300042616 Bacteria 4504
43 Ga0466715_158060 3300042616 Bacteria 1842
44 Ga0466723_057125 3300042618 Bacteria 5279
45 Ga0466723_152265 3300042618 Bacteria 5884
46 Ga0466728_304480 3300042620 Bacteria 4672
47 Ga0466728_306377 3300042620 Bacteria 1443
48 CVPL005W_1000029 3300002934 Bacteria 70649
49 CVPL005W_1000824 3300002934 Bacteria 20531
50 Ga0102740_1003991 3300007140 Unclassified 3013
51 Ga0102737_1004365 3300007142 Unclassified 3015
52 Ga0103264_1000465 3300007188 Bacteria 40480
53 Ga0466708_139450 3300042652 Bacteria 4496
54 Ga0466727_153201 3300042655 Bacteria 4428
55 Ga0466727_231003 3300042655 Bacteria 1908
56 Ga0466716_342499 3300042605 Bacteria 1692
57 Ga0466719_538973 3300042606 Bacteria 100873
58 Ga0160430_105238 3300012852 Bacteria 3019
59 Ga0466657_091662 3300042582 Bacteria 7826
60 Ga0466690_360925 3300042590 Bacteria 1624
61 Ga0466692_160902 3300042591 Unclassified 5993
62 Ga0466691_128223 3300042593 Bacteria 6835
63 Ga0123353_10095872 3300010167 Bacteria 4780
64 Ga0123353_10496086 3300010167 Bacteria 1781
65 Ga0466705_524172 3300042612 Bacteria 6456
66 Ga0466715_296475 3300042616 Bacteria 42129
67 Ga0466715_341937 3300042616 Bacteria 24574
68 Ga0466723_128496 3300042618 Bacteria 14510
69 Ga0466728_354197 3300042620 Bacteria 1977
70 CVPL005L_10002500 3300002938 Bacteria 21027
71 Ga0102740_1003468 3300007140 Bacteria 3369
72 Ga0103264_1000240 3300007188 Bacteria 40495
73 Ga0103264_1000612 3300007188 Bacteria 27686
74 Ga0103264_1010530 3300007188 Bacteria 4512
75 Ga0466716_094689 3300042605 Bacteria 15336
76 Ga0466716_335959 3300042605 Bacteria 1728
77 Ga0415639_022375 3300038395 Bacteria 13816
78 Ga0466691_046039 3300042593 Bacteria 5432
79 Ga0466705_226315 3300042612 Bacteria 1892
80 Ga0123355_10037416 3300009826 Unclassified 7890
81 Ga0123353_10134029 3300010167 Bacteria 3974
82 Ga0123354_10219626 3300010882 Unclassified 2024
83 Ga0466705_454779 3300042612 Bacteria 1432
84 CVPL010W_10010117 3300002931 Unclassified 14837
85 Ga0072941_1011710 3300005201 Bacteria 50935
86 Ga0102736_1001581 3300007052 Bacteria 3929
87 Ga0466735_027982 3300042624 Bacteria 2022
88 Ga0466735_221954 3300042624 Bacteria 4015
89 Ga0466704_013281 3300042643 Bacteria 2337
90 Ga0466727_297965 3300042655 Bacteria 1627
91 Ga0466707_106479 3300042601 Bacteria 2830
92 Ga0466713_020902 3300042602 Bacteria 76999
93 Ga0466713_088843 3300042602 Bacteria 126256
94 Ga0466713_091825 3300042602 Bacteria 9117
95 Ga0466716_141354 3300042605 Unclassified 1505
96 Ga0466719_424789 3300042606 Bacteria 5222
97 Ga0466696_070807 3300042596 Unclassified 6285
98 Ga0466696_460240 3300042596 Bacteria 2530
99 Ga0466705_264349 3300042612 Bacteria 2887
100 Ga0123353_10001702 3300010167 Bacteria 27018
101 Ga0466711_347690 3300042615 Bacteria 6976
102 Ga0466715_079722 3300042616 Bacteria 2599
103 Ga0466729_185906 3300042621 Bacteria 3889
104 JGI24700J35501_10930274 3300002508 Bacteria 12669
105 CVPL010W_10010643 3300002931 Bacteria 7920
106 Ga0466730_049165 3300042625 Bacteria 7716
107 Ga0466704_315836 3300042643 Bacteria 11717
108 Ga0466709_411452 3300042648 Bacteria 14735
109 Ga0466708_120771 3300042652 Bacteria 7700
110 Ga0466708_241849 3300042652 Bacteria 5845
111 Ga0466706_077960 3300042599 Bacteria 8306
112 Ga0466713_150218 3300042602 Bacteria 3650
113 Ga0466716_486233 3300042605 Bacteria 2516
114 Ga0255572_1000001 3300026175 Bacteria 634207
115 Ga0466690_315265 3300042590 Bacteria 4388
116 Ga0466696_046905 3300042596 Bacteria 11231
117 Ga0466705_344068 3300042612 Bacteria 13020
118 Ga0123353_10017755 3300010167 Bacteria 10482
119 Ga0123354_10028656 3300010882 Bacteria 8767
120 Ga0466711_496229 3300042615 Bacteria 3400
121 Ga0466723_082987 3300042618 Bacteria 1584
122 Ga0466728_027210 3300042620 Bacteria 1970
123 Ga0466728_054064 3300042620 Bacteria 2764
124 CVPL010W_10000157 3300002931 Bacteria 56611
125 CVPL010W_10004374 3300002931 Bacteria 28696
126 Ga0068302_10051675 3300005071 Bacteria 18885
127 Ga0102737_1000278 3300007142 Bacteria 17271
128 Ga0123357_10000032 3300009784 Bacteria 114773
129 Ga0466734_014120 3300042623 Bacteria 4006
130 Ga0466703_183114 3300042636 Bacteria 4456
131 Ga0466709_140191 3300042648 Bacteria 15868
132 Ga0466708_121367 3300042652 Bacteria 4341
133 Ga0466708_210115 3300042652 Bacteria 1561
134 Ga0466713_095526 3300042602 Bacteria 106941
135 Ga0466713_136947 3300042602 Bacteria 16637
136 Ga0160430_100265 3300012852 Bacteria 36706
137 Ga0316159_10068 3300030930 Bacteria 50341
138 Ga0466705_090447 3300042612 Bacteria 3548
139 Ga0466733_186866 3300042659 Bacteria 153934
140 Ga0123356_10002876 3300010049 Bacteria 18222
141 Ga0123353_10000178 3300010167 Bacteria 81051
142 Ga0123353_10008143 3300010167 Bacteria 14275
143 Ga0466715_488386 3300042616 Bacteria 32904
144 Ga0466728_243227 3300042620 Bacteria 1796
145 Ga0466704_292631 3300042643 Bacteria 18930
146 Ga0466709_045001 3300042648 Bacteria 7946
147 Ga0466724_12272 3300042649 Bacteria 374522
148 Ga0466701_056177 3300042598 Bacteria 3103
149 Ga0466706_251655 3300042599 Bacteria 12510
150 Ga0466707_268089 3300042601 Bacteria 1541
151 Ga0466713_059769 3300042602 Bacteria 172763
152 Ga0466719_024891 3300042606 Bacteria 3564
153 Ga0466721_391673 3300042608 Bacteria 105186
154 Ga0160458_100010 3300012832 Bacteria 404757
155 Ga0466657_004587 3300042582 Bacteria 2769
156 Ga0466692_066493 3300042591 Bacteria 67113
157 Ga0466691_004585 3300042593 Bacteria 6156

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042599 Ga0466706_167789 Ga0466706_167789_473_1546 357
2 3300007188 Ga0103264_1000240 Ga0103264_100024038 361
3 3300002931 CVPL010W_10000157 CVPL010W_1000015737 362
4 3300007083 Ga0103261_1002147 Ga0103261_10021473 362
5 3300007140 Ga0102740_1003991 Ga0102740_10039913 362
6 3300042612 Ga0466705_454779 Ga0466705_454779_286_1383 365
7 3300010167 Ga0123353_10008143 Ga0123353_100081437 368
8 3300002931 CVPL010W_10010117 CVPL010W_100101177 370
9 3300042605 Ga0466716_141354 Ga0466716_141354_366_1478 370
10 iso_pr_bacteria 2820301196 2820301493 384
11 3300002508 JGI24700J35501_10930274 JGI24700J35501_109302749 385
12 3300042659 Ga0466733_186866 Ga0466733_186866_130434_131591 385
13 3300010882 Ga0123354_10000832 Ga0123354_1000083226 386
14 3300042599 Ga0466706_077960 Ga0466706_077960_6735_7895 386
15 3300009826 Ga0123355_10037416 Ga0123355_100374162 388
16 iso_pr_bacteria 2820123897 2820125661 388
17 3300009784 Ga0123357_10000032 Ga0123357_1000003222 389
18 3300042596 Ga0466696_070807 Ga0466696_070807_2351_3520 389
19 3300042624 Ga0466735_027982 Ga0466735_027982_15_1223 390
20 3300042602 Ga0466713_136947 Ga0466713_136947_15152_16351 392
21 3300042605 Ga0466716_094689 Ga0466716_094689_7431_8609 392
22 3300038395 Ga0415639_022375 Ga0415639_022375_1818_2999 393
23 3300026175 Ga0255572_1000001 Ga0255572_100000143 394
24 iso_pr_bacteria 2820483401 2820485571 394
25 3300042654 Ga0466725_079169 Ga0466725_079169_3364_4551 395
26 3300005201 Ga0072941_1011710 Ga0072941_10117103 396
27 3300042591 Ga0466692_160902 Ga0466692_160902_4538_5728 396
28 iso_pr_bacteria 2603880170 2606028372 396
29 iso_pr_bacteria 2820641689 2820643772 396
30 iso_pr_bacteria 2820734335 2820734342 396
31 3300002931 CVPL010W_10004374 CVPL010W_1000437421 397
32 3300002934 CVPL005W_1000029 CVPL005W_100002920 397
33 3300002938 CVPL005L_10002500 CVPL005L_1000250010 397
34 3300007142 Ga0102737_1004365 Ga0102737_10043653 397
35 3300007188 Ga0103264_1000612 Ga0103264_100061227 397
36 3300010167 Ga0123353_10000178 Ga0123353_100001788 397
37 3300010167 Ga0123353_10127469 Ga0123353_101274692 397
38 3300012852 Ga0160430_100265 Ga0160430_10026519 397
39 3300030930 Ga0316159_10068 Ga0316159_1006850 397
40 3300042598 Ga0466701_056177 Ga0466701_056177_769_1962 397
41 3300042602 Ga0466713_091825 Ga0466713_091825_187_1401 397
42 3300042616 Ga0466715_341937 Ga0466715_341937_8230_9441 397
43 3300042649 Ga0466724_12272 Ga0466724_12272_97262_98455 397
44 3300002934 CVPL005W_1000824 CVPL005W_10008249 398
45 3300007052 Ga0102736_1001581 Ga0102736_10015813 398
46 3300010167 Ga0123353_10105073 Ga0123353_101050732 398
47 3300010167 Ga0123353_10496086 Ga0123353_104960862 398
48 iso_pr_bacteria 2989309576 2989309688 398
49 3300010882 Ga0123354_10028656 Ga0123354_100286563 399
50 3300042606 Ga0466719_538973 Ga0466719_538973_75629_76828 399
51 iso_pr_bacteria 2687453742 2689988285 399
52 iso_pr_bacteria 2687453753 2690037397 399
53 iso_pr_bacteria 2820857933 2820860269 399
54 iso_pr_bacteria 2820882373 2820882579 399
55 3300007140 Ga0102740_1003468 Ga0102740_10034682 400
56 3300007188 Ga0103264_1000465 Ga0103264_100046521 400
57 3300007188 Ga0103264_1010530 Ga0103264_10105303 400
58 3300042612 Ga0466705_129486 Ga0466705_129486_117_1319 400
59 3300042652 Ga0466708_241849 Ga0466708_241849_559_1761 400
60 iso_pr_bacteria 2820110010 2820110312 400
61 3300005201 Ga0072941_1374021 Ga0072941_13740212 401
62 3300009784 Ga0123357_10001076 Ga0123357_100010767 401
63 3300042591 Ga0466692_002214 Ga0466692_002214_4381_5586 401
64 iso_pr_bacteria 3006468911 3006473875 401
65 3300042590 Ga0466690_360925 Ga0466690_360925_359_1567 402
66 3300042596 Ga0466696_046905 Ga0466696_046905_2348_3556 402
67 3300042596 Ga0466696_460240 Ga0466696_460240_703_1911 402
68 3300042601 Ga0466707_106479 Ga0466707_106479_296_1504 402
69 3300042602 Ga0466713_150218 Ga0466713_150218_342_1550 402
70 3300042605 Ga0466716_335959 Ga0466716_335959_286_1494 402
71 3300042612 Ga0466705_264349 Ga0466705_264349_1146_2354 402
72 3300042612 Ga0466705_344612 Ga0466705_344612_33208_34416 402
73 3300042612 Ga0466705_373779 Ga0466705_373779_387_1595 402
74 3300042615 Ga0466711_496229 Ga0466711_496229_108_1316 402
75 3300042616 Ga0466715_266814 Ga0466715_266814_409_1635 402
76 3300042618 Ga0466723_057125 Ga0466723_057125_237_1445 402
77 3300042618 Ga0466723_082987 Ga0466723_082987_240_1448 402
78 3300042618 Ga0466723_128496 Ga0466723_128496_3680_4888 402
79 3300042620 Ga0466728_304480 Ga0466728_304480_400_1608 402
80 3300042621 Ga0466729_022472 Ga0466729_022472_176_1384 402
81 3300042621 Ga0466729_066423 Ga0466729_066423_4410_5618 402
82 3300042636 Ga0466703_373440 Ga0466703_373440_5104_6312 402
83 3300042643 Ga0466704_167863 Ga0466704_167863_31488_32696 402
84 3300042648 Ga0466709_258742 Ga0466709_258742_241_1449 402
85 3300042652 Ga0466708_210115 Ga0466708_210115_336_1544 402
86 3300042652 Ga0466708_242530 Ga0466708_242530_5700_6908 402
87 3300042655 Ga0466727_153201 Ga0466727_153201_1137_2345 402
88 iso_pr_bacteria 2864968865 2864972413 402
89 3300005071 Ga0068302_10051675 Ga0068302_1005167514 403
90 3300010167 Ga0123353_10095872 Ga0123353_100958722 403
91 3300010167 Ga0123353_10242533 Ga0123353_102425332 403
92 3300010882 Ga0123354_10219626 Ga0123354_102196262 403
93 3300042593 Ga0466691_004585 Ga0466691_004585_3466_4677 403
94 3300042593 Ga0466691_128223 Ga0466691_128223_2932_4143 403
95 3300042602 Ga0466713_020902 Ga0466713_020902_59122_60333 403
96 3300042602 Ga0466713_059769 Ga0466713_059769_30149_31360 403
97 3300042602 Ga0466713_088843 Ga0466713_088843_59270_60481 403
98 3300042605 Ga0466716_342499 Ga0466716_342499_13_1224 403
99 3300042606 Ga0466719_225984 Ga0466719_225984_25_1236 403
100 3300042609 Ga0466722_092343 Ga0466722_092343_2841_4052 403
101 3300042612 Ga0466705_344068 Ga0466705_344068_10497_11708 403
102 3300042612 Ga0466705_524172 Ga0466705_524172_503_1714 403
103 3300042615 Ga0466711_347690 Ga0466711_347690_1854_3065 403
104 3300042616 Ga0466715_073229 Ga0466715_073229_6105_7316 403
105 3300042616 Ga0466715_096147 Ga0466715_096147_6073_7284 403
106 3300042616 Ga0466715_120283 Ga0466715_120283_466_1677 403
107 3300042620 Ga0466728_054064 Ga0466728_054064_1274_2485 403
108 3300042620 Ga0466728_306377 Ga0466728_306377_149_1360 403
109 3300042621 Ga0466729_308852 Ga0466729_308852_4576_5787 403
110 3300042643 Ga0466704_315836 Ga0466704_315836_8627_9838 403
111 3300042648 Ga0466709_045001 Ga0466709_045001_4298_5509 403
112 3300042655 Ga0466727_231003 Ga0466727_231003_484_1695 403
113 iso_pr_bacteria 8067483258 8067485029 403
114 3300042590 Ga0466690_315265 Ga0466690_315265_2968_4182 404
115 3300042593 Ga0466691_046039 Ga0466691_046039_3999_5213 404
116 3300042593 Ga0466691_210520 Ga0466691_210520_2666_3880 404
117 3300042599 Ga0466706_251655 Ga0466706_251655_6061_7275 404
118 3300042601 Ga0466707_254471 Ga0466707_254471_3065_4279 404
119 3300042602 Ga0466713_095526 Ga0466713_095526_1711_2925 404
120 3300042605 Ga0466716_486233 Ga0466716_486233_1059_2273 404
121 3300042606 Ga0466719_024891 Ga0466719_024891_608_1822 404
122 3300042606 Ga0466719_344242 Ga0466719_344242_4018_5232 404
123 3300042612 Ga0466705_090447 Ga0466705_090447_471_1685 404
124 3300042612 Ga0466705_226315 Ga0466705_226315_153_1367 404
125 3300042615 Ga0466711_335609 Ga0466711_335609_5514_6728 404
126 3300042618 Ga0466723_030178 Ga0466723_030178_1462_2676 404
127 3300042618 Ga0466723_152265 Ga0466723_152265_4385_5599 404
128 3300042619 Ga0466726_315629 Ga0466726_315629_20_1234 404
129 3300042620 Ga0466728_472943 Ga0466728_472943_115_1329 404
130 3300042621 Ga0466729_185906 Ga0466729_185906_1846_3060 404
131 3300042621 Ga0466729_264224 Ga0466729_264224_444_1658 404
132 3300042624 Ga0466735_221954 Ga0466735_221954_2439_3653 404
133 3300042643 Ga0466704_013281 Ga0466704_013281_822_2036 404
134 3300042643 Ga0466704_292631 Ga0466704_292631_10524_11738 404
135 3300042648 Ga0466709_140191 Ga0466709_140191_10506_11720 404
136 3300042648 Ga0466709_209185 Ga0466709_209185_35398_36612 404
137 3300042652 Ga0466708_139450 Ga0466708_139450_528_1742 404
138 3300042655 Ga0466727_297965 Ga0466727_297965_296_1510 404
139 iso_pr_bacteria 8002299145 8002302513 404
140 3300007142 Ga0102737_1000278 Ga0102737_10002782 405
141 3300010167 Ga0123353_10134029 Ga0123353_101340292 405
142 3300042616 Ga0466715_079722 Ga0466715_079722_560_1777 405
143 3300042616 Ga0466715_158060 Ga0466715_158060_62_1279 405
144 3300042616 Ga0466715_296475 Ga0466715_296475_35745_36962 405
145 3300042616 Ga0466715_488386 Ga0466715_488386_19936_21153 405
146 3300042648 Ga0466709_411452 Ga0466709_411452_7046_8263 405
147 iso_pr_bacteria 2590828841 2593260150 405
148 3300010167 Ga0123353_10134213 Ga0123353_101342132 406
149 3300042608 Ga0466721_391673 Ga0466721_391673_9783_11003 406
150 3300042620 Ga0466728_027210 Ga0466728_027210_120_1340 406
151 3300042620 Ga0466728_243227 Ga0466728_243227_139_1359 406
152 iso_pr_bacteria 2820314258 2820316602 406
153 3300002504 JGI24705J35276_12238345 JGI24705J35276_1223834511 407
154 3300042582 Ga0466657_004587 Ga0466657_004587_803_2026 407
155 3300042582 Ga0466657_091662 Ga0466657_091662_2464_3687 407
156 3300042620 Ga0466728_354197 Ga0466728_354197_350_1573 407
157 3300042655 Ga0466727_246604 Ga0466727_246604_740_1963 407
158 3300042618 Ga0466723_150485 Ga0466723_150485_585_1811 408
159 3300042601 Ga0466707_268089 Ga0466707_268089_91_1320 409
160 iso_pr_bacteria 2820455747 2820455920 409
161 iso_pr_bacteria 2820845766 2820845934 411
162 iso_pr_bacteria 2820894511 2820895345 411
163 3300010167 Ga0123353_10001702 Ga0123353_100017025 412
164 3300042606 Ga0466719_424789 Ga0466719_424789_2561_3799 412
165 3300042643 Ga0466704_435581 Ga0466704_435581_3844_5082 412
166 3300042652 Ga0466708_121367 Ga0466708_121367_1041_2285 414
167 3300010167 Ga0123353_10017755 Ga0123353_100177555 417
168 3300042591 Ga0466692_066493 Ga0466692_066493_59573_60826 417
169 3300010049 Ga0123356_10005096 Ga0123356_1000509611 419
170 3300012832 Ga0160458_100010 Ga0160458_100010238 422
171 3300042652 Ga0466708_120771 Ga0466708_120771_1621_2889 422
172 3300042636 Ga0466703_183114 Ga0466703_183114_767_2038 423
173 3300012852 Ga0160430_105238 Ga0160430_1052382 425
174 3300042623 Ga0466734_014120 Ga0466734_014120_770_2065 431
175 3300010049 Ga0123356_10002876 Ga0123356_100028763 440
176 3300002931 CVPL010W_10010643 CVPL010W_100106436 441
177 3300042625 Ga0466730_049165 Ga0466730_049165_4315_5640 441
178 3300042652 Ga0466708_090525 Ga0466708_090525_12771_14099 442

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00202 Aminotran_3 Aminotransferase class-III 64 439 0.97
PF01212 Beta_elim_lyase Beta-eliminating lyase 132 351 0.75

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.94 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.