Protein Family IF09869
Metagenome
Isolate
151
Members
52
Samples
143
Scaffolds
319.05
Avg Length
Representative Sequence
- ID
- 3300042652|Ga0466708_079932|Ga0466708_079932_518_1633
- Length
- 371 aa
- Sequence
- LELALEKAAKVRFFLVNSRRLSQKLKFWESLWWQIMTSKKAVFLFPGQGAQYPGMALDLLETGNTKIRELFELASDITGRDMAALLRDGDEETLKQGGTAQPAITLANLAAAMLLAERGIRPLACAGHSLGEYAALETAGIISAADCFTLVKRRGAAMQRAADRLAGTGPGETGASGTAQAAGMAAVIGLAPDRVEALIAGWQAGAGKTGPEAAIWDLYAANFNSPRQTVVSGSAAALALAEERFKAAGARRVVALRVAGPFHSPLMAAAVEEFRPALEGVTFHDPRIPIYSNVTGARIMSGAEAKKLALEQITGPVRWTAVERALPETGPEFVLEAGPGRALQGLWKDSGSTLPCYPAGTVAEIDTLLEN
Sample Types
Isolate
5.3%
Metagenome
94.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.2%
Kalotermitidae
27.5%
Unclassified
15.7%
Rhinotermitidae
5.9%
Termopsidae
5.9%
Hodotermitidae
2.0%
Blaberidae
2.0%
Taxonomy
Archaea
0
Bacteria
149
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 4 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 5 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 6 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 7 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 8 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 9 | 2781125653 | Treponema sp. Emb289P1bin107 | Isolate | Unclassified |
| 10 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 11 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 12 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 18 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 19 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 20 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 21 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 24 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 25 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 26 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 27 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 28 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 29 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 30 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 31 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 32 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 33 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 34 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 35 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 36 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 37 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 38 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 39 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 40 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 41 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 42 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 43 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 44 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 45 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 46 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 47 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 48 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 49 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 50 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 51 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 52 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | AustNasuHG_c1008623 | 3300000089 | Bacteria | 3607 |
| 2 | JGI24698J34947_10002253 | 3300002449 | Bacteria | 10330 |
| 3 | Ga0466711_241704 | 3300042615 | Bacteria | 15416 |
| 4 | Ga0466715_046624 | 3300042616 | Bacteria | 17472 |
| 5 | Ga0466700_463544 | 3300042600 | Bacteria | 2441 |
| 6 | Ga0466717_201921 | 3300042604 | Bacteria | 1291 |
| 7 | Ga0466716_291386 | 3300042605 | Bacteria | 11587 |
| 8 | Ga0466722_183400 | 3300042609 | Bacteria | 9904 |
| 9 | Ga0466698_346248 | 3300042610 | Bacteria | 1232 |
| 10 | Ga0466702_402524 | 3300042635 | Bacteria | 6408 |
| 11 | Ga0466702_449443 | 3300042635 | Bacteria | 3920 |
| 12 | Ga0466703_081685 | 3300042636 | Bacteria | 4850 |
| 13 | Ga0466709_288573 | 3300042648 | Bacteria | 6357 |
| 14 | Ga0466708_437433 | 3300042652 | Bacteria | 2972 |
| 15 | Ga0466727_008737 | 3300042655 | Bacteria | 4003 |
| 16 | Ga0466690_014585 | 3300042590 | Bacteria | 4703 |
| 17 | Ga0466690_392680 | 3300042590 | Bacteria | 5826 |
| 18 | Ga0466691_013193 | 3300042593 | Bacteria | 17542 |
| 19 | Ga0123353_10064352 | 3300010167 | Bacteria | 5885 |
| 20 | JGI24702J35022_10050257 | 3300002462 | Bacteria | 2221 |
| 21 | Ga0466705_482637 | 3300042612 | Bacteria | 4215 |
| 22 | Ga0466715_126880 | 3300042616 | Bacteria | 24039 |
| 23 | Ga0466718_032448 | 3300042617 | Bacteria | 2364 |
| 24 | Ga0466723_148232 | 3300042618 | Bacteria | 7514 |
| 25 | Ga0466726_197693 | 3300042619 | Bacteria | 4614 |
| 26 | Ga0466726_388362 | 3300042619 | Bacteria | 4522 |
| 27 | Ga0466720_073738 | 3300042607 | Bacteria | 24060 |
| 28 | Ga0466720_075889 | 3300042607 | Bacteria | 5959 |
| 29 | Ga0466735_065470 | 3300042624 | Bacteria | 10374 |
| 30 | Ga0466735_117711 | 3300042624 | Bacteria | 2953 |
| 31 | Ga0466703_111331 | 3300042636 | Bacteria | 2569 |
| 32 | Ga0466709_379120 | 3300042648 | Bacteria | 3207 |
| 33 | Ga0466691_118504 | 3300042593 | Bacteria | 4367 |
| 34 | Ga0466691_216915 | 3300042593 | Bacteria | 3607 |
| 35 | Ga0466699_140662 | 3300042597 | Bacteria | 1590 |
| 36 | Ga0123355_10008062 | 3300009826 | Bacteria | 15888 |
| 37 | Ga0466705_056022 | 3300042612 | Bacteria | 2882 |
| 38 | JGI24695J34938_10016499 | 3300002450 | Bacteria | 3752 |
| 39 | JGI24702J35022_10005933 | 3300002462 | Bacteria | 7097 |
| 40 | Ga0466723_046115 | 3300042618 | Bacteria | 5327 |
| 41 | Ga0466726_039712 | 3300042619 | Bacteria | 2093 |
| 42 | Ga0466728_005870 | 3300042620 | Bacteria | 4780 |
| 43 | Ga0466728_130059 | 3300042620 | Bacteria | 2598 |
| 44 | Ga0466720_138354 | 3300042607 | Bacteria | 13815 |
| 45 | Ga0466720_169032 | 3300042607 | Bacteria | 23174 |
| 46 | Ga0466703_135325 | 3300042636 | Bacteria | 34761 |
| 47 | Ga0466704_010490 | 3300042643 | Bacteria | 4711 |
| 48 | Ga0466708_055313 | 3300042652 | Bacteria | 3288 |
| 49 | Ga0466708_464475 | 3300042652 | Bacteria | 69222 |
| 50 | Ga0466691_152327 | 3300042593 | Bacteria | 7960 |
| 51 | Ga0123356_10000286 | 3300010049 | Bacteria | 58205 |
| 52 | Ga0123353_10837707 | 3300010167 | Bacteria | 1263 |
| 53 | Ga0466705_227934 | 3300042612 | Bacteria | 2483 |
| 54 | Nasutiter_Contig17149 | 2030936001 | Bacteria | 3083 |
| 55 | AustNasuHG_c1000550 | 3300000089 | Bacteria | 13186 |
| 56 | Ga0072941_1020114 | 3300005201 | Bacteria | 2609 |
| 57 | Ga0466718_004835 | 3300042617 | Bacteria | 9839 |
| 58 | Ga0466718_095715 | 3300042617 | Bacteria | 1077 |
| 59 | Ga0466726_140265 | 3300042619 | Bacteria | 1748 |
| 60 | Ga0466716_293854 | 3300042605 | Bacteria | 8099 |
| 61 | Ga0466719_023727 | 3300042606 | Bacteria | 5082 |
| 62 | Ga0466731_216415 | 3300042622 | Bacteria | 5933 |
| 63 | Ga0466735_046337 | 3300042624 | Bacteria | 4596 |
| 64 | Ga0466735_134179 | 3300042624 | Bacteria | 2099 |
| 65 | Ga0466702_026745 | 3300042635 | Bacteria | 1172 |
| 66 | Ga0466708_007803 | 3300042652 | Bacteria | 12948 |
| 67 | Ga0466708_093223 | 3300042652 | Bacteria | 2680 |
| 68 | Ga0466708_166575 | 3300042652 | Unclassified | 3741 |
| 69 | Ga0123353_10554559 | 3300010167 | Bacteria | 1656 |
| 70 | Ga0072940_1028563 | 3300005200 | Bacteria | 3261 |
| 71 | Ga0466711_010052 | 3300042615 | Bacteria | 16632 |
| 72 | Ga0466718_002784 | 3300042617 | Bacteria | 7360 |
| 73 | Ga0466723_004785 | 3300042618 | Bacteria | 22095 |
| 74 | Ga0466723_106963 | 3300042618 | Bacteria | 1628 |
| 75 | Ga0466726_025477 | 3300042619 | Bacteria | 4213 |
| 76 | Ga0466729_026338 | 3300042621 | Bacteria | 3731 |
| 77 | Ga0466706_255313 | 3300042599 | Bacteria | 1732 |
| 78 | Ga0466716_124843 | 3300042605 | Bacteria | 14158 |
| 79 | Ga0466716_204549 | 3300042605 | Bacteria | 22034 |
| 80 | Ga0466719_010955 | 3300042606 | Bacteria | 2558 |
| 81 | Ga0466720_036520 | 3300042607 | Bacteria | 8420 |
| 82 | Ga0466729_204831 | 3300042621 | Bacteria | 1318 |
| 83 | Ga0466735_230166 | 3300042624 | Bacteria | 2573 |
| 84 | Ga0466702_170133 | 3300042635 | Bacteria | 2854 |
| 85 | Ga0466702_262294 | 3300042635 | Bacteria | 1984 |
| 86 | Ga0466709_032203 | 3300042648 | Bacteria | 3164 |
| 87 | Ga0466708_368772 | 3300042652 | Bacteria | 50694 |
| 88 | Ga0466727_342769 | 3300042655 | Bacteria | 1591 |
| 89 | Ga0466691_171233 | 3300042593 | Bacteria | 5088 |
| 90 | Ga0466699_183035 | 3300042597 | Bacteria | 8281 |
| 91 | Ga0466705_284683 | 3300042612 | Bacteria | 6547 |
| 92 | AustNasuHG_c1009098 | 3300000089 | Bacteria | 3499 |
| 93 | JGI24695J34938_10000721 | 3300002450 | Bacteria | 31222 |
| 94 | Ga0068305_10450707 | 3300005083 | Bacteria | 18601 |
| 95 | Ga0466712_196909 | 3300042614 | Bacteria | 1934 |
| 96 | Ga0466712_302522 | 3300042614 | Unclassified | 3922 |
| 97 | Ga0466711_039624 | 3300042615 | Bacteria | 6800 |
| 98 | Ga0466711_271612 | 3300042615 | Bacteria | 10976 |
| 99 | Ga0466723_130476 | 3300042618 | Bacteria | 6266 |
| 100 | Ga0466726_099796 | 3300042619 | Bacteria | 6385 |
| 101 | Ga0466726_271962 | 3300042619 | Bacteria | 1807 |
| 102 | Ga0466719_045072 | 3300042606 | Bacteria | 2774 |
| 103 | Ga0466735_038450 | 3300042624 | Bacteria | 5059 |
| 104 | Ga0466703_376983 | 3300042636 | Bacteria | 4632 |
| 105 | Ga0466708_079932 | 3300042652 | Bacteria | 1727 |
| 106 | Ga0466708_092108 | 3300042652 | Bacteria | 10527 |
| 107 | Ga0466708_334651 | 3300042652 | Bacteria | 78030 |
| 108 | Ga0466690_393065 | 3300042590 | Bacteria | 1318 |
| 109 | Ga0466691_001133 | 3300042593 | Bacteria | 1700 |
| 110 | Ga0123355_10028033 | 3300009826 | Bacteria | 9103 |
| 111 | Ga0123353_10928540 | 3300010167 | Bacteria | 1180 |
| 112 | Ga0466705_306326 | 3300042612 | Bacteria | 7918 |
| 113 | Ga0466715_201730 | 3300042616 | Bacteria | 2377 |
| 114 | Ga0466715_328490 | 3300042616 | Bacteria | 9537 |
| 115 | Ga0466723_367506 | 3300042618 | Bacteria | 4967 |
| 116 | Ga0466726_057751 | 3300042619 | Bacteria | 4299 |
| 117 | Ga0466728_027754 | 3300042620 | Bacteria | 2582 |
| 118 | Ga0466728_036677 | 3300042620 | Bacteria | 6825 |
| 119 | Ga0466706_075164 | 3300042599 | Bacteria | 2291 |
| 120 | Ga0466716_136273 | 3300042605 | Bacteria | 2538 |
| 121 | Ga0466719_438079 | 3300042606 | Bacteria | 2687 |
| 122 | Ga0466720_028055 | 3300042607 | Bacteria | 4662 |
| 123 | Ga0466698_215245 | 3300042610 | Bacteria | 4356 |
| 124 | Ga0466727_129071 | 3300042655 | Bacteria | 5069 |
| 125 | Ga0466692_079241 | 3300042591 | Bacteria | 3534 |
| 126 | Ga0466711_315353 | 3300042615 | Bacteria | 2873 |
| 127 | Ga0466715_298155 | 3300042616 | Bacteria | 3013 |
| 128 | Ga0466723_096958 | 3300042618 | Bacteria | 15636 |
| 129 | Ga0466726_304427 | 3300042619 | Bacteria | 2625 |
| 130 | Ga0466728_116318 | 3300042620 | Bacteria | 2282 |
| 131 | Ga0466719_010868 | 3300042606 | Bacteria | 19922 |
| 132 | Ga0466719_487846 | 3300042606 | Bacteria | 2137 |
| 133 | Ga0466731_069263 | 3300042622 | Bacteria | 1832 |
| 134 | Ga0466730_075877 | 3300042625 | Bacteria | 1102 |
| 135 | Ga0466709_164993 | 3300042648 | Bacteria | 4025 |
| 136 | Ga0466708_431515 | 3300042652 | Bacteria | 25678 |
| 137 | Ga0466727_211938 | 3300042655 | Bacteria | 1731 |
| 138 | Ga0466727_269908 | 3300042655 | Bacteria | 1290 |
| 139 | Ga0415639_256154 | 3300038395 | Bacteria | 2222 |
| 140 | Ga0466690_274192 | 3300042590 | Bacteria | 2890 |
| 141 | Ga0466691_060086 | 3300042593 | Bacteria | 24330 |
| 142 | Ga0466694_008266 | 3300042594 | Bacteria | 1820 |
| 143 | Ga0466696_436012 | 3300042596 | Bacteria | 28892 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 2030936001 | Nasutiter_Contig17149 | Nasutiterm_913320 | 274 |
| 2 | 3300042590 | Ga0466690_393065 | Ga0466690_393065_54_890 | 278 |
| 3 | 3300042635 | Ga0466702_026745 | Ga0466702_026745_16_876 | 286 |
| 4 | 3300042620 | Ga0466728_005870 | Ga0466728_005870_691_1572 | 293 |
| 5 | 3300042636 | Ga0466703_081685 | Ga0466703_081685_2864_3817 | 299 |
| 6 | 3300042593 | Ga0466691_152327 | Ga0466691_152327_2722_3684 | 301 |
| 7 | 3300000089 | AustNasuHG_c1000550 | AustNasuHG_100055010 | 302 |
| 8 | 3300042618 | Ga0466723_106963 | Ga0466723_106963_578_1555 | 302 |
| 9 | 3300042620 | Ga0466728_027754 | Ga0466728_027754_1306_2214 | 302 |
| 10 | 3300042624 | Ga0466735_038450 | Ga0466735_038450_2158_3138 | 303 |
| 11 | 3300042652 | Ga0466708_007803 | Ga0466708_007803_6426_7427 | 303 |
| 12 | 3300010167 | Ga0123353_10064352 | Ga0123353_100643527 | 304 |
| 13 | 3300042590 | Ga0466690_274192 | Ga0466690_274192_930_1886 | 304 |
| 14 | 3300042605 | Ga0466716_124843 | Ga0466716_124843_7829_8782 | 304 |
| 15 | 3300042605 | Ga0466716_291386 | Ga0466716_291386_7012_7983 | 304 |
| 16 | 3300042609 | Ga0466722_183400 | Ga0466722_183400_3376_4323 | 306 |
| 17 | 3300042652 | Ga0466708_093223 | Ga0466708_093223_346_1341 | 306 |
| 18 | 3300042619 | Ga0466726_197693 | Ga0466726_197693_2345_3268 | 307 |
| 19 | 3300042619 | Ga0466726_099796 | Ga0466726_099796_4415_5341 | 308 |
| 20 | 3300002450 | JGI24695J34938_10016499 | JGI24695J34938_100164992 | 309 |
| 21 | 3300042606 | Ga0466719_487846 | Ga0466719_487846_1136_2116 | 309 |
| 22 | 3300042624 | Ga0466735_230166 | Ga0466735_230166_42_971 | 309 |
| 23 | 3300042655 | Ga0466727_008737 | Ga0466727_008737_2816_3745 | 309 |
| 24 | 3300042655 | Ga0466727_342769 | Ga0466727_342769_268_1197 | 309 |
| 25 | 3300042593 | Ga0466691_171233 | Ga0466691_171233_1975_2907 | 310 |
| 26 | 3300002450 | JGI24695J34938_10000721 | JGI24695J34938_1000072117 | 311 |
| 27 | 3300042616 | Ga0466715_328490 | Ga0466715_328490_8459_9499 | 311 |
| 28 | 3300042590 | Ga0466690_392680 | Ga0466690_392680_2845_3816 | 312 |
| 29 | 3300042610 | Ga0466698_215245 | Ga0466698_215245_1002_1940 | 312 |
| 30 | 3300042610 | Ga0466698_346248 | Ga0466698_346248_141_1079 | 312 |
| 31 | 3300042652 | Ga0466708_166575 | Ga0466708_166575_1700_2638 | 312 |
| 32 | 3300042643 | Ga0466704_010490 | Ga0466704_010490_2418_3359 | 313 |
| 33 | 3300042655 | Ga0466727_269908 | Ga0466727_269908_311_1252 | 313 |
| 34 | 3300042605 | Ga0466716_136273 | Ga0466716_136273_756_1787 | 314 |
| 35 | 3300042607 | Ga0466720_138354 | Ga0466720_138354_9181_10143 | 314 |
| 36 | 3300042617 | Ga0466718_032448 | Ga0466718_032448_709_1674 | 314 |
| 37 | 3300042615 | Ga0466711_241704 | Ga0466711_241704_12284_13303 | 315 |
| 38 | 3300042652 | Ga0466708_437433 | Ga0466708_437433_657_1634 | 315 |
| 39 | 3300042593 | Ga0466691_060086 | Ga0466691_060086_18361_19311 | 316 |
| 40 | 3300042594 | Ga0466694_008266 | Ga0466694_008266_634_1584 | 316 |
| 41 | 3300042596 | Ga0466696_436012 | Ga0466696_436012_24896_25846 | 316 |
| 42 | 3300042606 | Ga0466719_010955 | Ga0466719_010955_1245_2195 | 316 |
| 43 | 3300042618 | Ga0466723_004785 | Ga0466723_004785_20896_21846 | 316 |
| 44 | 3300042620 | Ga0466728_116318 | Ga0466728_116318_1083_2033 | 316 |
| 45 | 3300042620 | Ga0466728_130059 | Ga0466728_130059_24_974 | 316 |
| 46 | iso_pr_bacteria | 2781125636 | 2781280635 | 316 |
| 47 | 3300042591 | Ga0466692_079241 | Ga0466692_079241_800_1753 | 317 |
| 48 | 3300042593 | Ga0466691_216915 | Ga0466691_216915_991_2022 | 317 |
| 49 | 3300042605 | Ga0466716_204549 | Ga0466716_204549_14173_15126 | 317 |
| 50 | 3300042606 | Ga0466719_023727 | Ga0466719_023727_1809_2762 | 317 |
| 51 | 3300042612 | Ga0466705_227934 | Ga0466705_227934_1352_2305 | 317 |
| 52 | 3300042615 | Ga0466711_271612 | Ga0466711_271612_8543_9496 | 317 |
| 53 | 3300042616 | Ga0466715_046624 | Ga0466715_046624_7198_8151 | 317 |
| 54 | 3300042618 | Ga0466723_367506 | Ga0466723_367506_1979_2932 | 317 |
| 55 | 3300042620 | Ga0466728_036677 | Ga0466728_036677_3090_4043 | 317 |
| 56 | 3300042622 | Ga0466731_069263 | Ga0466731_069263_278_1231 | 317 |
| 57 | 3300042622 | Ga0466731_216415 | Ga0466731_216415_4074_5027 | 317 |
| 58 | 3300042635 | Ga0466702_262294 | Ga0466702_262294_820_1773 | 317 |
| 59 | 3300042648 | Ga0466709_288573 | Ga0466709_288573_4343_5296 | 317 |
| 60 | 3300042652 | Ga0466708_464475 | Ga0466708_464475_42572_43525 | 317 |
| 61 | 3300042604 | Ga0466717_201921 | Ga0466717_201921_319_1275 | 318 |
| 62 | 3300042625 | Ga0466730_075877 | Ga0466730_075877_15_971 | 318 |
| 63 | 3300042652 | Ga0466708_334651 | Ga0466708_334651_13492_14448 | 318 |
| 64 | 3300042652 | Ga0466708_368772 | Ga0466708_368772_36336_37292 | 318 |
| 65 | 3300000089 | AustNasuHG_c1008623 | AustNasuHG_10086233 | 319 |
| 66 | 3300042597 | Ga0466699_183035 | Ga0466699_183035_1614_2573 | 319 |
| 67 | 3300042599 | Ga0466706_255313 | Ga0466706_255313_654_1613 | 319 |
| 68 | 3300042605 | Ga0466716_293854 | Ga0466716_293854_5779_6738 | 319 |
| 69 | 3300042612 | Ga0466705_056022 | Ga0466705_056022_1341_2300 | 319 |
| 70 | 3300042619 | Ga0466726_388362 | Ga0466726_388362_3111_4070 | 319 |
| 71 | 3300042635 | Ga0466702_449443 | Ga0466702_449443_2061_3020 | 319 |
| 72 | 3300042648 | Ga0466709_379120 | Ga0466709_379120_566_1525 | 319 |
| 73 | 3300042597 | Ga0466699_140662 | Ga0466699_140662_515_1477 | 320 |
| 74 | 3300042606 | Ga0466719_045072 | Ga0466719_045072_299_1261 | 320 |
| 75 | 3300042615 | Ga0466711_039624 | Ga0466711_039624_1572_2534 | 320 |
| 76 | 3300042618 | Ga0466723_096958 | Ga0466723_096958_1237_2199 | 320 |
| 77 | 3300042618 | Ga0466723_130476 | Ga0466723_130476_2478_3440 | 320 |
| 78 | 3300042635 | Ga0466702_170133 | Ga0466702_170133_108_1070 | 320 |
| 79 | 3300042648 | Ga0466709_032203 | Ga0466709_032203_1480_2442 | 320 |
| 80 | 3300042607 | Ga0466720_036520 | Ga0466720_036520_5713_6678 | 321 |
| 81 | 3300042607 | Ga0466720_073738 | Ga0466720_073738_17075_18040 | 321 |
| 82 | 3300042607 | Ga0466720_075889 | Ga0466720_075889_1713_2678 | 321 |
| 83 | 3300042617 | Ga0466718_002784 | Ga0466718_002784_1117_2082 | 321 |
| 84 | 3300042624 | Ga0466735_117711 | Ga0466735_117711_1422_2387 | 321 |
| 85 | iso_pr_bacteria | 2772190975 | 2773724046 | 321 |
| 86 | 3300000089 | AustNasuHG_c1009098 | AustNasuHG_10090983 | 322 |
| 87 | 3300042593 | Ga0466691_118504 | Ga0466691_118504_2461_3501 | 322 |
| 88 | 3300042607 | Ga0466720_028055 | Ga0466720_028055_3518_4486 | 322 |
| 89 | 3300042607 | Ga0466720_169032 | Ga0466720_169032_22030_22998 | 322 |
| 90 | 3300042615 | Ga0466711_010052 | Ga0466711_010052_2911_3879 | 322 |
| 91 | 3300042617 | Ga0466718_004835 | Ga0466718_004835_5501_6469 | 322 |
| 92 | 3300042617 | Ga0466718_095715 | Ga0466718_095715_47_1015 | 322 |
| 93 | 3300042621 | Ga0466729_026338 | Ga0466729_026338_1684_2652 | 322 |
| 94 | iso_pr_bacteria | 2781125658 | 2781324592 | 322 |
| 95 | iso_pr_bacteria | 2819992462 | 2819993032 | 322 |
| 96 | 3300005201 | Ga0072941_1020114 | Ga0072941_10201142 | 323 |
| 97 | 3300010049 | Ga0123356_10000286 | Ga0123356_1000028627 | 323 |
| 98 | 3300038395 | Ga0415639_256154 | Ga0415639_256154_999_1970 | 323 |
| 99 | 3300042614 | Ga0466712_196909 | Ga0466712_196909_437_1408 | 323 |
| 100 | 3300042614 | Ga0466712_302522 | Ga0466712_302522_2202_3173 | 323 |
| 101 | 3300042652 | Ga0466708_055313 | Ga0466708_055313_802_1773 | 323 |
| 102 | 3300042655 | Ga0466727_211938 | Ga0466727_211938_486_1457 | 323 |
| 103 | 3300042612 | Ga0466705_284683 | Ga0466705_284683_3831_4805 | 324 |
| 104 | 3300042619 | Ga0466726_140265 | Ga0466726_140265_166_1140 | 324 |
| 105 | 3300042619 | Ga0466726_271962 | Ga0466726_271962_560_1534 | 324 |
| 106 | 3300042624 | Ga0466735_065470 | Ga0466735_065470_5663_6637 | 324 |
| 107 | 3300042635 | Ga0466702_402524 | Ga0466702_402524_2018_2992 | 324 |
| 108 | 3300042648 | Ga0466709_164993 | Ga0466709_164993_1917_2891 | 324 |
| 109 | iso_pr_bacteria | 2781125697 | 2781442798 | 324 |
| 110 | 3300002462 | JGI24702J35022_10005933 | JGI24702J35022_100059334 | 325 |
| 111 | 3300005200 | Ga0072940_1028563 | Ga0072940_10285633 | 325 |
| 112 | 3300042593 | Ga0466691_001133 | Ga0466691_001133_456_1433 | 325 |
| 113 | 3300042616 | Ga0466715_126880 | Ga0466715_126880_13034_14011 | 325 |
| 114 | 3300042619 | Ga0466726_025477 | Ga0466726_025477_2345_3322 | 325 |
| 115 | 3300042619 | Ga0466726_057751 | Ga0466726_057751_629_1606 | 325 |
| 116 | 3300042636 | Ga0466703_135325 | Ga0466703_135325_27470_28447 | 325 |
| 117 | iso_pr_bacteria | 2781125653 | 2781313251 | 325 |
| 118 | iso_pr_bacteria | 2781125655 | 2781318595 | 325 |
| 119 | 3300009826 | Ga0123355_10008062 | Ga0123355_100080622 | 326 |
| 120 | 3300009826 | Ga0123355_10028033 | Ga0123355_100280334 | 326 |
| 121 | 3300042599 | Ga0466706_075164 | Ga0466706_075164_1251_2231 | 326 |
| 122 | 3300042616 | Ga0466715_298155 | Ga0466715_298155_1668_2648 | 326 |
| 123 | 3300042619 | Ga0466726_039712 | Ga0466726_039712_413_1393 | 326 |
| 124 | 3300002449 | JGI24698J34947_10002253 | JGI24698J34947_100022535 | 327 |
| 125 | 3300010167 | Ga0123353_10837707 | Ga0123353_108377071 | 327 |
| 126 | 3300042593 | Ga0466691_013193 | Ga0466691_013193_4741_5724 | 327 |
| 127 | 3300042619 | Ga0466726_304427 | Ga0466726_304427_1614_2597 | 327 |
| 128 | 3300042652 | Ga0466708_092108 | Ga0466708_092108_6721_7704 | 327 |
| 129 | 3300042590 | Ga0466690_014585 | Ga0466690_014585_1366_2352 | 328 |
| 130 | 3300042612 | Ga0466705_306326 | Ga0466705_306326_1412_2398 | 328 |
| 131 | 3300042612 | Ga0466705_482637 | Ga0466705_482637_1830_2816 | 328 |
| 132 | 3300042618 | Ga0466723_148232 | Ga0466723_148232_1261_2247 | 328 |
| 133 | 3300042636 | Ga0466703_111331 | Ga0466703_111331_1080_2066 | 328 |
| 134 | iso_pr_bacteria | 2781125632 | 2781271753 | 328 |
| 135 | 3300042652 | Ga0466708_431515 | Ga0466708_431515_4598_5587 | 329 |
| 136 | 3300042600 | Ga0466700_463544 | Ga0466700_463544_497_1489 | 330 |
| 137 | 3300042615 | Ga0466711_315353 | Ga0466711_315353_1345_2337 | 330 |
| 138 | 3300010167 | Ga0123353_10554559 | Ga0123353_105545592 | 331 |
| 139 | 3300010167 | Ga0123353_10928540 | Ga0123353_109285402 | 331 |
| 140 | 3300042606 | Ga0466719_010868 | Ga0466719_010868_14302_15300 | 332 |
| 141 | 3300042606 | Ga0466719_438079 | Ga0466719_438079_1517_2563 | 332 |
| 142 | 3300042621 | Ga0466729_204831 | Ga0466729_204831_67_1104 | 332 |
| 143 | 3300042655 | Ga0466727_129071 | Ga0466727_129071_1031_2029 | 332 |
| 144 | 3300002462 | JGI24702J35022_10050257 | JGI24702J35022_100502572 | 334 |
| 145 | 3300042616 | Ga0466715_201730 | Ga0466715_201730_716_1720 | 334 |
| 146 | 3300005083 | Ga0068305_10450707 | Ga0068305_104507075 | 336 |
| 147 | 3300042618 | Ga0466723_046115 | Ga0466723_046115_4204_5214 | 336 |
| 148 | 3300042636 | Ga0466703_376983 | Ga0466703_376983_1357_2367 | 336 |
| 149 | 3300042624 | Ga0466735_046337 | Ga0466735_046337_1574_2593 | 339 |
| 150 | 3300042624 | Ga0466735_134179 | Ga0466735_134179_577_1650 | 339 |
| 151 | 3300042652 | Ga0466708_079932 | Ga0466708_079932_518_1633 | 371 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00698 | Acyl_transf_1 | Acyl transferase domain | 42 | 162 | 0.92 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.87 | 0.91 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.