Protein Family IF09869

Metagenome Isolate
151 Members
52 Samples
143 Scaffolds
319.05 Avg Length

🧬 Representative Sequence

ID
3300042652|Ga0466708_079932|Ga0466708_079932_518_1633
Length
371 aa
Sequence
LELALEKAAKVRFFLVNSRRLSQKLKFWESLWWQIMTSKKAVFLFPGQGAQYPGMALDLLETGNTKIRELFELASDITGRDMAALLRDGDEETLKQGGTAQPAITLANLAAAMLLAERGIRPLACAGHSLGEYAALETAGIISAADCFTLVKRRGAAMQRAADRLAGTGPGETGASGTAQAAGMAAVIGLAPDRVEALIAGWQAGAGKTGPEAAIWDLYAANFNSPRQTVVSGSAAALALAEERFKAAGARRVVALRVAGPFHSPLMAAAVEEFRPALEGVTFHDPRIPIYSNVTGARIMSGAEAKKLALEQITGPVRWTAVERALPETGPEFVLEAGPGRALQGLWKDSGSTLPCYPAGTVAEIDTLLEN

πŸ“Š Sample Types

Isolate 5.3%
Metagenome 94.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 41.2%
Kalotermitidae 27.5%
Unclassified 15.7%
Rhinotermitidae 5.9%
Termopsidae 5.9%
Hodotermitidae 2.0%
Blaberidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 149
Eukaryota 0
Viruses 0
Unclassified 2

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
2 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
3 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
4 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
5 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
6 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
7 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
8 2030936001 Nasutitermes corniger hindgut microbial communities from Florida, USA Metagenome Termitidae
9 2781125653 Treponema sp. Emb289P1bin107 Isolate Unclassified
10 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
11 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
12 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
13 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
14 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
15 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
16 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
17 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
18 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
19 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
20 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
21 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
22 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
23 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
24 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
25 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
26 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
27 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
28 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
29 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
30 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
31 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
32 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
33 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
34 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
35 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
36 2772190975 Treponema sp. RmG30 Isolate Blaberidae
37 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
38 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
39 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
40 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
41 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
42 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
43 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
44 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
45 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
46 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
47 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
48 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
49 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
50 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
51 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
52 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 AustNasuHG_c1008623 3300000089 Bacteria 3607
2 JGI24698J34947_10002253 3300002449 Bacteria 10330
3 Ga0466711_241704 3300042615 Bacteria 15416
4 Ga0466715_046624 3300042616 Bacteria 17472
5 Ga0466700_463544 3300042600 Bacteria 2441
6 Ga0466717_201921 3300042604 Bacteria 1291
7 Ga0466716_291386 3300042605 Bacteria 11587
8 Ga0466722_183400 3300042609 Bacteria 9904
9 Ga0466698_346248 3300042610 Bacteria 1232
10 Ga0466702_402524 3300042635 Bacteria 6408
11 Ga0466702_449443 3300042635 Bacteria 3920
12 Ga0466703_081685 3300042636 Bacteria 4850
13 Ga0466709_288573 3300042648 Bacteria 6357
14 Ga0466708_437433 3300042652 Bacteria 2972
15 Ga0466727_008737 3300042655 Bacteria 4003
16 Ga0466690_014585 3300042590 Bacteria 4703
17 Ga0466690_392680 3300042590 Bacteria 5826
18 Ga0466691_013193 3300042593 Bacteria 17542
19 Ga0123353_10064352 3300010167 Bacteria 5885
20 JGI24702J35022_10050257 3300002462 Bacteria 2221
21 Ga0466705_482637 3300042612 Bacteria 4215
22 Ga0466715_126880 3300042616 Bacteria 24039
23 Ga0466718_032448 3300042617 Bacteria 2364
24 Ga0466723_148232 3300042618 Bacteria 7514
25 Ga0466726_197693 3300042619 Bacteria 4614
26 Ga0466726_388362 3300042619 Bacteria 4522
27 Ga0466720_073738 3300042607 Bacteria 24060
28 Ga0466720_075889 3300042607 Bacteria 5959
29 Ga0466735_065470 3300042624 Bacteria 10374
30 Ga0466735_117711 3300042624 Bacteria 2953
31 Ga0466703_111331 3300042636 Bacteria 2569
32 Ga0466709_379120 3300042648 Bacteria 3207
33 Ga0466691_118504 3300042593 Bacteria 4367
34 Ga0466691_216915 3300042593 Bacteria 3607
35 Ga0466699_140662 3300042597 Bacteria 1590
36 Ga0123355_10008062 3300009826 Bacteria 15888
37 Ga0466705_056022 3300042612 Bacteria 2882
38 JGI24695J34938_10016499 3300002450 Bacteria 3752
39 JGI24702J35022_10005933 3300002462 Bacteria 7097
40 Ga0466723_046115 3300042618 Bacteria 5327
41 Ga0466726_039712 3300042619 Bacteria 2093
42 Ga0466728_005870 3300042620 Bacteria 4780
43 Ga0466728_130059 3300042620 Bacteria 2598
44 Ga0466720_138354 3300042607 Bacteria 13815
45 Ga0466720_169032 3300042607 Bacteria 23174
46 Ga0466703_135325 3300042636 Bacteria 34761
47 Ga0466704_010490 3300042643 Bacteria 4711
48 Ga0466708_055313 3300042652 Bacteria 3288
49 Ga0466708_464475 3300042652 Bacteria 69222
50 Ga0466691_152327 3300042593 Bacteria 7960
51 Ga0123356_10000286 3300010049 Bacteria 58205
52 Ga0123353_10837707 3300010167 Bacteria 1263
53 Ga0466705_227934 3300042612 Bacteria 2483
54 Nasutiter_Contig17149 2030936001 Bacteria 3083
55 AustNasuHG_c1000550 3300000089 Bacteria 13186
56 Ga0072941_1020114 3300005201 Bacteria 2609
57 Ga0466718_004835 3300042617 Bacteria 9839
58 Ga0466718_095715 3300042617 Bacteria 1077
59 Ga0466726_140265 3300042619 Bacteria 1748
60 Ga0466716_293854 3300042605 Bacteria 8099
61 Ga0466719_023727 3300042606 Bacteria 5082
62 Ga0466731_216415 3300042622 Bacteria 5933
63 Ga0466735_046337 3300042624 Bacteria 4596
64 Ga0466735_134179 3300042624 Bacteria 2099
65 Ga0466702_026745 3300042635 Bacteria 1172
66 Ga0466708_007803 3300042652 Bacteria 12948
67 Ga0466708_093223 3300042652 Bacteria 2680
68 Ga0466708_166575 3300042652 Unclassified 3741
69 Ga0123353_10554559 3300010167 Bacteria 1656
70 Ga0072940_1028563 3300005200 Bacteria 3261
71 Ga0466711_010052 3300042615 Bacteria 16632
72 Ga0466718_002784 3300042617 Bacteria 7360
73 Ga0466723_004785 3300042618 Bacteria 22095
74 Ga0466723_106963 3300042618 Bacteria 1628
75 Ga0466726_025477 3300042619 Bacteria 4213
76 Ga0466729_026338 3300042621 Bacteria 3731
77 Ga0466706_255313 3300042599 Bacteria 1732
78 Ga0466716_124843 3300042605 Bacteria 14158
79 Ga0466716_204549 3300042605 Bacteria 22034
80 Ga0466719_010955 3300042606 Bacteria 2558
81 Ga0466720_036520 3300042607 Bacteria 8420
82 Ga0466729_204831 3300042621 Bacteria 1318
83 Ga0466735_230166 3300042624 Bacteria 2573
84 Ga0466702_170133 3300042635 Bacteria 2854
85 Ga0466702_262294 3300042635 Bacteria 1984
86 Ga0466709_032203 3300042648 Bacteria 3164
87 Ga0466708_368772 3300042652 Bacteria 50694
88 Ga0466727_342769 3300042655 Bacteria 1591
89 Ga0466691_171233 3300042593 Bacteria 5088
90 Ga0466699_183035 3300042597 Bacteria 8281
91 Ga0466705_284683 3300042612 Bacteria 6547
92 AustNasuHG_c1009098 3300000089 Bacteria 3499
93 JGI24695J34938_10000721 3300002450 Bacteria 31222
94 Ga0068305_10450707 3300005083 Bacteria 18601
95 Ga0466712_196909 3300042614 Bacteria 1934
96 Ga0466712_302522 3300042614 Unclassified 3922
97 Ga0466711_039624 3300042615 Bacteria 6800
98 Ga0466711_271612 3300042615 Bacteria 10976
99 Ga0466723_130476 3300042618 Bacteria 6266
100 Ga0466726_099796 3300042619 Bacteria 6385
101 Ga0466726_271962 3300042619 Bacteria 1807
102 Ga0466719_045072 3300042606 Bacteria 2774
103 Ga0466735_038450 3300042624 Bacteria 5059
104 Ga0466703_376983 3300042636 Bacteria 4632
105 Ga0466708_079932 3300042652 Bacteria 1727
106 Ga0466708_092108 3300042652 Bacteria 10527
107 Ga0466708_334651 3300042652 Bacteria 78030
108 Ga0466690_393065 3300042590 Bacteria 1318
109 Ga0466691_001133 3300042593 Bacteria 1700
110 Ga0123355_10028033 3300009826 Bacteria 9103
111 Ga0123353_10928540 3300010167 Bacteria 1180
112 Ga0466705_306326 3300042612 Bacteria 7918
113 Ga0466715_201730 3300042616 Bacteria 2377
114 Ga0466715_328490 3300042616 Bacteria 9537
115 Ga0466723_367506 3300042618 Bacteria 4967
116 Ga0466726_057751 3300042619 Bacteria 4299
117 Ga0466728_027754 3300042620 Bacteria 2582
118 Ga0466728_036677 3300042620 Bacteria 6825
119 Ga0466706_075164 3300042599 Bacteria 2291
120 Ga0466716_136273 3300042605 Bacteria 2538
121 Ga0466719_438079 3300042606 Bacteria 2687
122 Ga0466720_028055 3300042607 Bacteria 4662
123 Ga0466698_215245 3300042610 Bacteria 4356
124 Ga0466727_129071 3300042655 Bacteria 5069
125 Ga0466692_079241 3300042591 Bacteria 3534
126 Ga0466711_315353 3300042615 Bacteria 2873
127 Ga0466715_298155 3300042616 Bacteria 3013
128 Ga0466723_096958 3300042618 Bacteria 15636
129 Ga0466726_304427 3300042619 Bacteria 2625
130 Ga0466728_116318 3300042620 Bacteria 2282
131 Ga0466719_010868 3300042606 Bacteria 19922
132 Ga0466719_487846 3300042606 Bacteria 2137
133 Ga0466731_069263 3300042622 Bacteria 1832
134 Ga0466730_075877 3300042625 Bacteria 1102
135 Ga0466709_164993 3300042648 Bacteria 4025
136 Ga0466708_431515 3300042652 Bacteria 25678
137 Ga0466727_211938 3300042655 Bacteria 1731
138 Ga0466727_269908 3300042655 Bacteria 1290
139 Ga0415639_256154 3300038395 Bacteria 2222
140 Ga0466690_274192 3300042590 Bacteria 2890
141 Ga0466691_060086 3300042593 Bacteria 24330
142 Ga0466694_008266 3300042594 Bacteria 1820
143 Ga0466696_436012 3300042596 Bacteria 28892

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 2030936001 Nasutiter_Contig17149 Nasutiterm_913320 274
2 3300042590 Ga0466690_393065 Ga0466690_393065_54_890 278
3 3300042635 Ga0466702_026745 Ga0466702_026745_16_876 286
4 3300042620 Ga0466728_005870 Ga0466728_005870_691_1572 293
5 3300042636 Ga0466703_081685 Ga0466703_081685_2864_3817 299
6 3300042593 Ga0466691_152327 Ga0466691_152327_2722_3684 301
7 3300000089 AustNasuHG_c1000550 AustNasuHG_100055010 302
8 3300042618 Ga0466723_106963 Ga0466723_106963_578_1555 302
9 3300042620 Ga0466728_027754 Ga0466728_027754_1306_2214 302
10 3300042624 Ga0466735_038450 Ga0466735_038450_2158_3138 303
11 3300042652 Ga0466708_007803 Ga0466708_007803_6426_7427 303
12 3300010167 Ga0123353_10064352 Ga0123353_100643527 304
13 3300042590 Ga0466690_274192 Ga0466690_274192_930_1886 304
14 3300042605 Ga0466716_124843 Ga0466716_124843_7829_8782 304
15 3300042605 Ga0466716_291386 Ga0466716_291386_7012_7983 304
16 3300042609 Ga0466722_183400 Ga0466722_183400_3376_4323 306
17 3300042652 Ga0466708_093223 Ga0466708_093223_346_1341 306
18 3300042619 Ga0466726_197693 Ga0466726_197693_2345_3268 307
19 3300042619 Ga0466726_099796 Ga0466726_099796_4415_5341 308
20 3300002450 JGI24695J34938_10016499 JGI24695J34938_100164992 309
21 3300042606 Ga0466719_487846 Ga0466719_487846_1136_2116 309
22 3300042624 Ga0466735_230166 Ga0466735_230166_42_971 309
23 3300042655 Ga0466727_008737 Ga0466727_008737_2816_3745 309
24 3300042655 Ga0466727_342769 Ga0466727_342769_268_1197 309
25 3300042593 Ga0466691_171233 Ga0466691_171233_1975_2907 310
26 3300002450 JGI24695J34938_10000721 JGI24695J34938_1000072117 311
27 3300042616 Ga0466715_328490 Ga0466715_328490_8459_9499 311
28 3300042590 Ga0466690_392680 Ga0466690_392680_2845_3816 312
29 3300042610 Ga0466698_215245 Ga0466698_215245_1002_1940 312
30 3300042610 Ga0466698_346248 Ga0466698_346248_141_1079 312
31 3300042652 Ga0466708_166575 Ga0466708_166575_1700_2638 312
32 3300042643 Ga0466704_010490 Ga0466704_010490_2418_3359 313
33 3300042655 Ga0466727_269908 Ga0466727_269908_311_1252 313
34 3300042605 Ga0466716_136273 Ga0466716_136273_756_1787 314
35 3300042607 Ga0466720_138354 Ga0466720_138354_9181_10143 314
36 3300042617 Ga0466718_032448 Ga0466718_032448_709_1674 314
37 3300042615 Ga0466711_241704 Ga0466711_241704_12284_13303 315
38 3300042652 Ga0466708_437433 Ga0466708_437433_657_1634 315
39 3300042593 Ga0466691_060086 Ga0466691_060086_18361_19311 316
40 3300042594 Ga0466694_008266 Ga0466694_008266_634_1584 316
41 3300042596 Ga0466696_436012 Ga0466696_436012_24896_25846 316
42 3300042606 Ga0466719_010955 Ga0466719_010955_1245_2195 316
43 3300042618 Ga0466723_004785 Ga0466723_004785_20896_21846 316
44 3300042620 Ga0466728_116318 Ga0466728_116318_1083_2033 316
45 3300042620 Ga0466728_130059 Ga0466728_130059_24_974 316
46 iso_pr_bacteria 2781125636 2781280635 316
47 3300042591 Ga0466692_079241 Ga0466692_079241_800_1753 317
48 3300042593 Ga0466691_216915 Ga0466691_216915_991_2022 317
49 3300042605 Ga0466716_204549 Ga0466716_204549_14173_15126 317
50 3300042606 Ga0466719_023727 Ga0466719_023727_1809_2762 317
51 3300042612 Ga0466705_227934 Ga0466705_227934_1352_2305 317
52 3300042615 Ga0466711_271612 Ga0466711_271612_8543_9496 317
53 3300042616 Ga0466715_046624 Ga0466715_046624_7198_8151 317
54 3300042618 Ga0466723_367506 Ga0466723_367506_1979_2932 317
55 3300042620 Ga0466728_036677 Ga0466728_036677_3090_4043 317
56 3300042622 Ga0466731_069263 Ga0466731_069263_278_1231 317
57 3300042622 Ga0466731_216415 Ga0466731_216415_4074_5027 317
58 3300042635 Ga0466702_262294 Ga0466702_262294_820_1773 317
59 3300042648 Ga0466709_288573 Ga0466709_288573_4343_5296 317
60 3300042652 Ga0466708_464475 Ga0466708_464475_42572_43525 317
61 3300042604 Ga0466717_201921 Ga0466717_201921_319_1275 318
62 3300042625 Ga0466730_075877 Ga0466730_075877_15_971 318
63 3300042652 Ga0466708_334651 Ga0466708_334651_13492_14448 318
64 3300042652 Ga0466708_368772 Ga0466708_368772_36336_37292 318
65 3300000089 AustNasuHG_c1008623 AustNasuHG_10086233 319
66 3300042597 Ga0466699_183035 Ga0466699_183035_1614_2573 319
67 3300042599 Ga0466706_255313 Ga0466706_255313_654_1613 319
68 3300042605 Ga0466716_293854 Ga0466716_293854_5779_6738 319
69 3300042612 Ga0466705_056022 Ga0466705_056022_1341_2300 319
70 3300042619 Ga0466726_388362 Ga0466726_388362_3111_4070 319
71 3300042635 Ga0466702_449443 Ga0466702_449443_2061_3020 319
72 3300042648 Ga0466709_379120 Ga0466709_379120_566_1525 319
73 3300042597 Ga0466699_140662 Ga0466699_140662_515_1477 320
74 3300042606 Ga0466719_045072 Ga0466719_045072_299_1261 320
75 3300042615 Ga0466711_039624 Ga0466711_039624_1572_2534 320
76 3300042618 Ga0466723_096958 Ga0466723_096958_1237_2199 320
77 3300042618 Ga0466723_130476 Ga0466723_130476_2478_3440 320
78 3300042635 Ga0466702_170133 Ga0466702_170133_108_1070 320
79 3300042648 Ga0466709_032203 Ga0466709_032203_1480_2442 320
80 3300042607 Ga0466720_036520 Ga0466720_036520_5713_6678 321
81 3300042607 Ga0466720_073738 Ga0466720_073738_17075_18040 321
82 3300042607 Ga0466720_075889 Ga0466720_075889_1713_2678 321
83 3300042617 Ga0466718_002784 Ga0466718_002784_1117_2082 321
84 3300042624 Ga0466735_117711 Ga0466735_117711_1422_2387 321
85 iso_pr_bacteria 2772190975 2773724046 321
86 3300000089 AustNasuHG_c1009098 AustNasuHG_10090983 322
87 3300042593 Ga0466691_118504 Ga0466691_118504_2461_3501 322
88 3300042607 Ga0466720_028055 Ga0466720_028055_3518_4486 322
89 3300042607 Ga0466720_169032 Ga0466720_169032_22030_22998 322
90 3300042615 Ga0466711_010052 Ga0466711_010052_2911_3879 322
91 3300042617 Ga0466718_004835 Ga0466718_004835_5501_6469 322
92 3300042617 Ga0466718_095715 Ga0466718_095715_47_1015 322
93 3300042621 Ga0466729_026338 Ga0466729_026338_1684_2652 322
94 iso_pr_bacteria 2781125658 2781324592 322
95 iso_pr_bacteria 2819992462 2819993032 322
96 3300005201 Ga0072941_1020114 Ga0072941_10201142 323
97 3300010049 Ga0123356_10000286 Ga0123356_1000028627 323
98 3300038395 Ga0415639_256154 Ga0415639_256154_999_1970 323
99 3300042614 Ga0466712_196909 Ga0466712_196909_437_1408 323
100 3300042614 Ga0466712_302522 Ga0466712_302522_2202_3173 323
101 3300042652 Ga0466708_055313 Ga0466708_055313_802_1773 323
102 3300042655 Ga0466727_211938 Ga0466727_211938_486_1457 323
103 3300042612 Ga0466705_284683 Ga0466705_284683_3831_4805 324
104 3300042619 Ga0466726_140265 Ga0466726_140265_166_1140 324
105 3300042619 Ga0466726_271962 Ga0466726_271962_560_1534 324
106 3300042624 Ga0466735_065470 Ga0466735_065470_5663_6637 324
107 3300042635 Ga0466702_402524 Ga0466702_402524_2018_2992 324
108 3300042648 Ga0466709_164993 Ga0466709_164993_1917_2891 324
109 iso_pr_bacteria 2781125697 2781442798 324
110 3300002462 JGI24702J35022_10005933 JGI24702J35022_100059334 325
111 3300005200 Ga0072940_1028563 Ga0072940_10285633 325
112 3300042593 Ga0466691_001133 Ga0466691_001133_456_1433 325
113 3300042616 Ga0466715_126880 Ga0466715_126880_13034_14011 325
114 3300042619 Ga0466726_025477 Ga0466726_025477_2345_3322 325
115 3300042619 Ga0466726_057751 Ga0466726_057751_629_1606 325
116 3300042636 Ga0466703_135325 Ga0466703_135325_27470_28447 325
117 iso_pr_bacteria 2781125653 2781313251 325
118 iso_pr_bacteria 2781125655 2781318595 325
119 3300009826 Ga0123355_10008062 Ga0123355_100080622 326
120 3300009826 Ga0123355_10028033 Ga0123355_100280334 326
121 3300042599 Ga0466706_075164 Ga0466706_075164_1251_2231 326
122 3300042616 Ga0466715_298155 Ga0466715_298155_1668_2648 326
123 3300042619 Ga0466726_039712 Ga0466726_039712_413_1393 326
124 3300002449 JGI24698J34947_10002253 JGI24698J34947_100022535 327
125 3300010167 Ga0123353_10837707 Ga0123353_108377071 327
126 3300042593 Ga0466691_013193 Ga0466691_013193_4741_5724 327
127 3300042619 Ga0466726_304427 Ga0466726_304427_1614_2597 327
128 3300042652 Ga0466708_092108 Ga0466708_092108_6721_7704 327
129 3300042590 Ga0466690_014585 Ga0466690_014585_1366_2352 328
130 3300042612 Ga0466705_306326 Ga0466705_306326_1412_2398 328
131 3300042612 Ga0466705_482637 Ga0466705_482637_1830_2816 328
132 3300042618 Ga0466723_148232 Ga0466723_148232_1261_2247 328
133 3300042636 Ga0466703_111331 Ga0466703_111331_1080_2066 328
134 iso_pr_bacteria 2781125632 2781271753 328
135 3300042652 Ga0466708_431515 Ga0466708_431515_4598_5587 329
136 3300042600 Ga0466700_463544 Ga0466700_463544_497_1489 330
137 3300042615 Ga0466711_315353 Ga0466711_315353_1345_2337 330
138 3300010167 Ga0123353_10554559 Ga0123353_105545592 331
139 3300010167 Ga0123353_10928540 Ga0123353_109285402 331
140 3300042606 Ga0466719_010868 Ga0466719_010868_14302_15300 332
141 3300042606 Ga0466719_438079 Ga0466719_438079_1517_2563 332
142 3300042621 Ga0466729_204831 Ga0466729_204831_67_1104 332
143 3300042655 Ga0466727_129071 Ga0466727_129071_1031_2029 332
144 3300002462 JGI24702J35022_10050257 JGI24702J35022_100502572 334
145 3300042616 Ga0466715_201730 Ga0466715_201730_716_1720 334
146 3300005083 Ga0068305_10450707 Ga0068305_104507075 336
147 3300042618 Ga0466723_046115 Ga0466723_046115_4204_5214 336
148 3300042636 Ga0466703_376983 Ga0466703_376983_1357_2367 336
149 3300042624 Ga0466735_046337 Ga0466735_046337_1574_2593 339
150 3300042624 Ga0466735_134179 Ga0466735_134179_577_1650 339
151 3300042652 Ga0466708_079932 Ga0466708_079932_518_1633 371

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00698 Acyl_transf_1 Acyl transferase domain 42 162 0.92

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.87 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.