Protein Family IF09850

Metagenome Isolate
116 Members
40 Samples
105 Scaffolds
280.28 Avg Length

🧬 Representative Sequence

ID
3300042652|Ga0466708_052688|Ga0466708_052688_2424_3284
Length
277 aa
Sequence
MTVAEITWTVDPAIFSVGSREIRWYALAFIVKRMWIREEIPPAWLEPLLYYTVAGTVIGARLGHCLFYSPDYYLANPVEILKMWEGGLASHGGVLGIMVAIWFYSRNVSHQNMLWTFDKLVVPTGLVAALIRLGNLMNHEIYGHPTDLPWGFRFIENLHAWRQEGAEPLFSAPSHPTQIYEALCYLFTFALCMWLYFRKDAWKRQGFIFGLFLICIFTARFLIEFLKNDQEAFEAGMALNMGQWLSIPFILAGLFFVRRAFKRQPVTYSYRNAKDRK

📊 Sample Types

Isolate 9.5%
Metagenome 90.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 32.5%
Termitidae 20.0%
Blattidae 17.5%
Unclassified 10.0%
Rhinotermitidae 7.5%
Termopsidae 7.5%
Passalidae 5.0%

🌳 Taxonomy

Archaea 0
Bacteria 111
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
2 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
3 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
4 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
7 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
8 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
9 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
10 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
11 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
12 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
13 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
14 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
15 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
16 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
17 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
18 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
19 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
20 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
21 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
22 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
23 2923982719 Parabacteroides sp. 52 Isolate Blattidae
24 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
25 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
26 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
27 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
28 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
29 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
30 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
31 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
32 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
33 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
34 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
35 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
36 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
37 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
38 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
39 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
40 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_102679 3300042612 Bacteria 3075
2 Ga0466690_398515 3300042590 Bacteria 1765
3 Ga0466696_038246 3300042596 Bacteria 19371
4 Ga0466696_057822 3300042596 Bacteria 24547
5 Ga0466703_209026 3300042636 Bacteria 32874
6 Ga0466704_090993 3300042643 Bacteria 11106
7 Ga0466704_485734 3300042643 Bacteria 6162
8 Ga0466704_582225 3300042643 Bacteria 53049
9 Ga0466701_077922 3300042598 Bacteria 7465
10 Ga0466713_010624 3300042602 Bacteria 12241
11 Ga0466705_497131 3300042612 Bacteria 27603
12 Ga0466715_400041 3300042616 Bacteria 26123
13 Ga0466723_301081 3300042618 Bacteria 11213
14 Ga0466723_363366 3300042618 Bacteria 19501
15 Ga0466733_004812 3300042659 Bacteria 14623
16 Ga0466690_069743 3300042590 Bacteria 14040
17 Ga0466690_269418 3300042590 Bacteria 5069
18 Ga0466704_163866 3300042643 Bacteria 3327
19 Ga0466704_235028 3300042643 Bacteria 7683
20 Ga0466708_029387 3300042652 Bacteria 22724
21 Ga0466708_434006 3300042652 Bacteria 8063
22 JGI24702J35022_10000967 3300002462 Bacteria 17950
23 JGI24702J35022_10033941 3300002462 Bacteria 2729
24 Ga0068302_10238004 3300005071 Bacteria 1446
25 Ga0466713_013575 3300042602 Bacteria 6289
26 Ga0466716_000217 3300042605 Bacteria 7743
27 Ga0466719_086420 3300042606 Bacteria 1137
28 Ga0466719_287400 3300042606 Bacteria 6117
29 Ga0466722_185059 3300042609 Bacteria 11746
30 Ga0466705_399550 3300042612 Bacteria 30994
31 Ga0466705_438199 3300042612 Bacteria 17804
32 Ga0466723_025054 3300042618 Bacteria 2122
33 Ga0466723_354948 3300042618 Bacteria 23912
34 Ga0466728_154188 3300042620 Bacteria 1312
35 Ga0466703_177366 3300042636 Unclassified 8461
36 Ga0466703_250877 3300042636 Bacteria 4114
37 Ga0466727_029179 3300042655 Bacteria 5049
38 JGI24702J35022_10007018 3300002462 Bacteria 6468
39 Ga0466716_222358 3300042605 Bacteria 9643
40 Ga0466705_442429 3300042612 Bacteria 11113
41 Ga0466712_160184 3300042614 Unclassified 2553
42 Ga0466711_064702 3300042615 Bacteria 28145
43 Ga0466715_107883 3300042616 Bacteria 15928
44 Ga0466718_074787 3300042617 Bacteria 2215
45 Ga0466733_213148 3300042659 Bacteria 45617
46 Ga0466690_389876 3300042590 Unclassified 1496
47 Ga0466691_048639 3300042593 Bacteria 38512
48 Ga0466703_197916 3300042636 Bacteria 14155
49 Ga0466708_052688 3300042652 Bacteria 18489
50 Ga0466727_071200 3300042655 Bacteria 9346
51 Ga0466727_169105 3300042655 Bacteria 7986
52 Ga0466716_528684 3300042605 Bacteria 22222
53 Ga0466722_048373 3300042609 Bacteria 17703
54 Ga0466711_033795 3300042615 Bacteria 5505
55 Ga0466711_212398 3300042615 Bacteria 10673
56 Ga0466711_272178 3300042615 Bacteria 1647
57 Ga0466705_013387 3300042612 Bacteria 2709
58 Ga0466733_062564 3300042659 Bacteria 17813
59 Ga0466692_193814 3300042591 Bacteria 23056
60 Ga0466691_146667 3300042593 Bacteria 8924
61 Ga0466703_115474 3300042636 Bacteria 9589
62 Ga0466727_157269 3300042655 Bacteria 5248
63 2227308568 2225789004 Bacteria 6550
64 JGI24702J35022_10112068 3300002462 Bacteria 1500
65 Ga0068302_10322407 3300005071 Bacteria 1039
66 Ga0466707_091828 3300042601 Bacteria 1923
67 Ga0466707_332842 3300042601 Bacteria 12251
68 Ga0466713_093483 3300042602 Bacteria 2289
69 Ga0466722_046557 3300042609 Bacteria 3426
70 Ga0466711_271474 3300042615 Bacteria 4229
71 Ga0466715_074850 3300042616 Bacteria 4550
72 Ga0466726_367695 3300042619 Bacteria 5656
73 Ga0466729_082744 3300042621 Bacteria 9963
74 Ga0466733_064013 3300042659 Bacteria 2853
75 Ga0466656_154814 3300042550 Bacteria 10154
76 Ga0466690_041120 3300042590 Bacteria 21497
77 Ga0466704_044022 3300042643 Bacteria 23517
78 Ga0068305_10050200 3300005083 Bacteria 7119
79 Ga0466700_124909 3300042600 Bacteria 3119
80 Ga0466719_214653 3300042606 Bacteria 6113
81 Ga0466722_160383 3300042609 Bacteria 27402
82 Ga0466711_009554 3300042615 Bacteria 1618
83 Ga0466711_187959 3300042615 Unclassified 2175
84 Ga0466733_038286 3300042659 Bacteria 266317
85 Ga0466696_185558 3300042596 Bacteria 17647
86 Ga0466703_110585 3300042636 Bacteria 5800
87 2227316903 2225789004 Bacteria 6452
88 JGI24702J35022_10000138 3300002462 Bacteria 36376
89 JGI24702J35022_10013176 3300002462 Bacteria 4583
90 JGI24702J35022_10041059 3300002462 Bacteria 2466
91 Ga0466722_061096 3300042609 Unclassified 12742
92 Ga0466722_111472 3300042609 Bacteria 10577
93 Ga0466718_123052 3300042617 Bacteria 1697
94 Ga0466726_222610 3300042619 Bacteria 7867
95 Ga0466690_154142 3300042590 Bacteria 2956
96 Ga0466690_333013 3300042590 Bacteria 1972
97 Ga0466696_001911 3300042596 Bacteria 82336
98 Ga0123356_10008309 3300010049 Bacteria 10330
99 IMNBL1DRAFT_c0000936 3300000062 Bacteria 22561
100 Ga0466719_162727 3300042606 Bacteria 34676
101 Ga0466715_185934 3300042616 Bacteria 13383
102 Ga0466715_508101 3300042616 Bacteria 17805
103 Ga0466726_441370 3300042619 Bacteria 6952
104 Ga0466728_167204 3300042620 Bacteria 7125
105 Ga0466728_277157 3300042620 Bacteria 1627

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042619 Ga0466726_222610 Ga0466726_222610_2553_3377 239
2 3300042612 Ga0466705_013387 Ga0466705_013387_1951_2694 247
3 3300042602 Ga0466713_010624 Ga0466713_010624_1324_2076 250
4 3300005071 Ga0068302_10322407 Ga0068302_103224071 262
5 3300042596 Ga0466696_001911 Ga0466696_001911_46699_47514 262
6 3300042612 Ga0466705_497131 Ga0466705_497131_14492_15310 264
7 3300042618 Ga0466723_354948 Ga0466723_354948_15694_16518 265
8 3300042606 Ga0466719_162727 Ga0466719_162727_19462_20310 268
9 3300042618 Ga0466723_025054 Ga0466723_025054_611_1468 268
10 3300042605 Ga0466716_528684 Ga0466716_528684_16781_17626 269
11 3300042616 Ga0466715_185934 Ga0466715_185934_371_1216 271
12 3300042612 Ga0466705_102679 Ga0466705_102679_2045_2863 272
13 3300042643 Ga0466704_044022 Ga0466704_044022_795_1613 272
14 3300042643 Ga0466704_163866 Ga0466704_163866_1105_1923 272
15 3300042602 Ga0466713_013575 Ga0466713_013575_3521_4342 273
16 3300042652 Ga0466708_434006 Ga0466708_434006_4765_5610 273
17 3300042590 Ga0466690_333013 Ga0466690_333013_1089_1934 274
18 3300042596 Ga0466696_185558 Ga0466696_185558_6927_7784 274
19 3300042609 Ga0466722_185059 Ga0466722_185059_1750_2574 274
20 3300042619 Ga0466726_367695 Ga0466726_367695_540_1364 274
21 3300042636 Ga0466703_115474 Ga0466703_115474_1653_2498 274
22 3300042655 Ga0466727_157269 Ga0466727_157269_2604_3428 274
23 3300042601 Ga0466707_332842 Ga0466707_332842_7985_8812 275
24 3300042612 Ga0466705_399550 Ga0466705_399550_24815_25663 275
25 3300042636 Ga0466703_250877 Ga0466703_250877_2789_3634 275
26 3300042590 Ga0466690_041120 Ga0466690_041120_3656_4501 276
27 3300042605 Ga0466716_000217 Ga0466716_000217_5850_6695 276
28 3300042615 Ga0466711_187959 Ga0466711_187959_1243_2091 276
29 3300042616 Ga0466715_400041 Ga0466715_400041_4995_5840 276
30 3300042636 Ga0466703_177366 Ga0466703_177366_3066_3914 276
31 3300042659 Ga0466733_062564 Ga0466733_062564_16849_17679 276
32 3300042596 Ga0466696_038246 Ga0466696_038246_14819_15652 277
33 3300042652 Ga0466708_052688 Ga0466708_052688_2424_3284 277
34 3300042655 Ga0466727_169105 Ga0466727_169105_4992_5825 277
35 3300042591 Ga0466692_193814 Ga0466692_193814_15431_16267 278
36 3300042612 Ga0466705_442429 Ga0466705_442429_5070_5906 278
37 3300042615 Ga0466711_271474 Ga0466711_271474_2170_3006 278
38 3300042616 Ga0466715_508101 Ga0466715_508101_7697_8533 278
39 3300042617 Ga0466718_123052 Ga0466718_123052_344_1180 278
40 3300042643 Ga0466704_485734 Ga0466704_485734_2759_3595 278
41 2225789004 2227308568 2227758331 279
42 2225789004 2227316903 2227765794 279
43 3300042590 Ga0466690_069743 Ga0466690_069743_9237_10076 279
44 3300042590 Ga0466690_154142 Ga0466690_154142_515_1354 279
45 3300042593 Ga0466691_048639 Ga0466691_048639_26878_27717 279
46 3300042596 Ga0466696_057822 Ga0466696_057822_20383_21222 279
47 3300042612 Ga0466705_438199 Ga0466705_438199_2141_2980 279
48 3300042643 Ga0466704_235028 Ga0466704_235028_4269_5108 279
49 3300042659 Ga0466733_004812 Ga0466733_004812_1511_2350 279
50 3300000062 IMNBL1DRAFT_c0000936 IMNBL1DRAFT_000093620 280
51 3300042550 Ga0466656_154814 Ga0466656_154814_3715_4557 280
52 3300042601 Ga0466707_091828 Ga0466707_091828_582_1424 280
53 3300042602 Ga0466713_093483 Ga0466713_093483_1297_2139 280
54 3300042609 Ga0466722_160383 Ga0466722_160383_15125_15967 280
55 3300042617 Ga0466718_074787 Ga0466718_074787_158_1000 280
56 3300042593 Ga0466691_146667 Ga0466691_146667_4606_5451 281
57 3300042606 Ga0466719_287400 Ga0466719_287400_3010_3855 281
58 3300042609 Ga0466722_048373 Ga0466722_048373_3441_4286 281
59 3300042609 Ga0466722_061096 Ga0466722_061096_10732_11577 281
60 3300042618 Ga0466723_301081 Ga0466723_301081_5809_6654 281
61 3300042618 Ga0466723_363366 Ga0466723_363366_5913_6779 281
62 3300042621 Ga0466729_082744 Ga0466729_082744_8260_9105 281
63 3300042636 Ga0466703_110585 Ga0466703_110585_1572_2417 281
64 3300002462 JGI24702J35022_10041059 JGI24702J35022_100410592 282
65 3300005083 Ga0068305_10050200 Ga0068305_1005020010 282
66 3300042606 Ga0466719_086420 Ga0466719_086420_177_1079 282
67 3300042606 Ga0466719_214653 Ga0466719_214653_1873_2721 282
68 3300042615 Ga0466711_009554 Ga0466711_009554_64_912 282
69 3300042615 Ga0466711_033795 Ga0466711_033795_52_900 282
70 3300042615 Ga0466711_064702 Ga0466711_064702_16593_17441 282
71 3300042620 Ga0466728_154188 Ga0466728_154188_196_1044 282
72 3300042643 Ga0466704_090993 Ga0466704_090993_4069_4917 282
73 3300042643 Ga0466704_582225 Ga0466704_582225_47845_48693 282
74 3300002462 JGI24702J35022_10007018 JGI24702J35022_100070185 283
75 3300042590 Ga0466690_389876 Ga0466690_389876_134_985 283
76 3300042652 Ga0466708_029387 Ga0466708_029387_2930_3781 283
77 3300002462 JGI24702J35022_10013176 JGI24702J35022_100131762 284
78 3300042609 Ga0466722_046557 Ga0466722_046557_2131_2985 284
79 3300042619 Ga0466726_441370 Ga0466726_441370_755_1609 284
80 3300042659 Ga0466733_213148 Ga0466733_213148_31994_32848 284
81 3300042605 Ga0466716_222358 Ga0466716_222358_5838_6695 285
82 3300042616 Ga0466715_074850 Ga0466715_074850_3129_3986 285
83 3300042636 Ga0466703_197916 Ga0466703_197916_7378_8235 285
84 3300042659 Ga0466733_038286 Ga0466733_038286_174724_175581 285
85 iso_pr_bacteria 2940195863 2940196672 285
86 3300042598 Ga0466701_077922 Ga0466701_077922_2473_3333 286
87 3300042655 Ga0466727_071200 Ga0466727_071200_7528_8388 286
88 3300042659 Ga0466733_064013 Ga0466733_064013_843_1703 286
89 3300010049 Ga0123356_10008309 Ga0123356_100083098 287
90 3300042614 Ga0466712_160184 Ga0466712_160184_452_1315 287
91 3300042636 Ga0466703_209026 Ga0466703_209026_7010_7873 287
92 3300042655 Ga0466727_029179 Ga0466727_029179_3073_3936 287
93 iso_pr_bacteria 2820757377 2820759961 287
94 3300005071 Ga0068302_10238004 Ga0068302_102380042 288
95 3300042590 Ga0466690_269418 Ga0466690_269418_1875_2741 288
96 3300042590 Ga0466690_398515 Ga0466690_398515_403_1269 288
97 3300042600 Ga0466700_124909 Ga0466700_124909_525_1391 288
98 3300042615 Ga0466711_212398 Ga0466711_212398_2985_3851 288
99 3300042615 Ga0466711_272178 Ga0466711_272178_236_1102 288
100 3300042620 Ga0466728_277157 Ga0466728_277157_192_1058 288
101 3300042616 Ga0466715_107883 Ga0466715_107883_12652_13521 289
102 3300042620 Ga0466728_167204 Ga0466728_167204_3335_4204 289
103 3300002462 JGI24702J35022_10033941 JGI24702J35022_100339413 290
104 3300002462 JGI24702J35022_10112068 JGI24702J35022_101120682 290
105 3300042609 Ga0466722_111472 Ga0466722_111472_6430_7302 290
106 iso_pr_bacteria 2940202316 2940205068 291
107 iso_pr_bacteria 2940199050 2940199514 292
108 iso_pr_bacteria 2940209341 2940209391 292
109 iso_pr_bacteria 2940346213 2940347157 292
110 iso_pr_bacteria 2940199050 2940199513 293
111 iso_pr_bacteria 2940346213 2940347158 293
112 3300002462 JGI24702J35022_10000967 JGI24702J35022_100009676 294
113 3300002462 JGI24702J35022_10000138 JGI24702J35022_1000013822 296
114 iso_pr_bacteria 2940209341 2940209392 296
115 iso_pr_bacteria 2923982719 2923985157 298
116 iso_pr_bacteria 2940371297 2940373580 298

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01790 LGT Prolipoprotein diacylglyceryl transferase 12 257 0.85

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.