Protein Family IF09835
Metagenome
Isolate
185
Members
73
Samples
154
Scaffolds
280.81
Avg Length
Representative Sequence
- ID
- 3300042652|Ga0466708_036363|Ga0466708_036363_3276_4247
- Length
- 323 aa
- Sequence
- MQKQACHNRSLGFLEVPTVSPAYCIIFVREYFKMNGLLINAAMKTNYEIRYAAHPEDAKQYDTARLRRDFLIEKLFEPDEVQLVYSMYDRMIAGGAMPVKEKLRLEAIPPLKQPFFLRNREIGIYHVGGSTGMVHIGDDSFELQYKEALYLGSGDRELYFESTDPQSPSLFYFNSTTAHRNRPDKKITRNEAVIAEMGAPETSNHRHVNKMIVNQVLPTCQLQMGMTELAVGSVWNTMPAHIHSRRMEVYFYFEVPEEQAVCHFMGEPFETRHIWMKGRQAVLSPEWSIHSAAATSNYTFIWGMGGENLDYGDQDFFKITELK
Sample Types
Isolate
16.8%
Metagenome
83.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
33.8%
Kalotermitidae
19.7%
Termitidae
18.3%
Unclassified
8.5%
Rhinotermitidae
7.0%
Armadillidiidae
4.2%
Termopsidae
4.2%
Passalidae
2.8%
Hodotermitidae
1.4%
Taxonomy
Archaea
0
Bacteria
175
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 2 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 3 | 2940377351 | Ereboglobus sp. PH5-5 | Isolate | Blattidae |
| 4 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 5 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 6 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 7 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 8 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 9 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 10 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 11 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 12 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 13 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 14 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 15 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 16 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 17 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 18 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 23 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 24 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 25 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 26 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 27 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 28 | 2940239174 | Ereboglobus sp. PH5-10 | Isolate | Blattidae |
| 29 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 30 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 31 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 32 | 2706794701 | Opitutaceae bacterium TSB47 | Isolate | Rhinotermitidae |
| 33 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 34 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 35 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 36 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 37 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 38 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 39 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 40 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 41 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 42 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 43 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 44 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 45 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 46 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 47 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 48 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 49 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 50 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 51 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 52 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 53 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 54 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 55 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 56 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 57 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 58 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 59 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 60 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 61 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 62 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 63 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 64 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 65 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 66 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 67 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 68 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 69 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 70 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 71 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 72 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 73 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466735_042821 | 3300042624 | Bacteria | 2602 |
| 2 | Ga0466727_259681 | 3300042655 | Bacteria | 9175 |
| 3 | Ga0466711_055238 | 3300042615 | Bacteria | 16327 |
| 4 | Ga0466715_038292 | 3300042616 | Bacteria | 5020 |
| 5 | Ga0466728_303164 | 3300042620 | Bacteria | 28612 |
| 6 | Ga0466657_325607 | 3300042582 | Bacteria | 1955 |
| 7 | Ga0466696_248437 | 3300042596 | Bacteria | 1604 |
| 8 | Ga0123354_10000099 | 3300010882 | Bacteria | 64622 |
| 9 | Ga0466706_074152 | 3300042599 | Bacteria | 1658 |
| 10 | Ga0466716_020038 | 3300042605 | Bacteria | 33350 |
| 11 | Ga0466716_074068 | 3300042605 | Bacteria | 5581 |
| 12 | Ga0466719_504944 | 3300042606 | Bacteria | 2660 |
| 13 | Ga0466722_200664 | 3300042609 | Bacteria | 9551 |
| 14 | IMNBL1DRAFT_c0002776 | 3300000062 | Bacteria | 11890 |
| 15 | Ga0068305_10208188 | 3300005083 | Bacteria | 4107 |
| 16 | Ga0466705_009950 | 3300042612 | Bacteria | 28016 |
| 17 | Ga0466733_206577 | 3300042659 | Bacteria | 22282 |
| 18 | Ga0466735_107465 | 3300042624 | Bacteria | 1179 |
| 19 | Ga0466704_313968 | 3300042643 | Bacteria | 4576 |
| 20 | Ga0466704_316220 | 3300042643 | Bacteria | 5871 |
| 21 | Ga0466708_036363 | 3300042652 | Bacteria | 9973 |
| 22 | Ga0466708_461535 | 3300042652 | Bacteria | 12713 |
| 23 | Ga0466711_359360 | 3300042615 | Bacteria | 14266 |
| 24 | Ga0466726_328337 | 3300042619 | Bacteria | 2339 |
| 25 | Ga0466728_009673 | 3300042620 | Bacteria | 2472 |
| 26 | Ga0466728_143836 | 3300042620 | Bacteria | 3848 |
| 27 | Ga0160469_101431 | 3300012824 | Bacteria | 6370 |
| 28 | Ga0466692_049439 | 3300042591 | Bacteria | 34933 |
| 29 | Ga0123353_10164665 | 3300010167 | Bacteria | 3526 |
| 30 | Ga0123354_10147645 | 3300010882 | Bacteria | 2869 |
| 31 | Ga0466706_047496 | 3300042599 | Bacteria | 8216 |
| 32 | Ga0466706_072928 | 3300042599 | Bacteria | 51016 |
| 33 | Ga0466706_151415 | 3300042599 | Bacteria | 14671 |
| 34 | Ga0466707_258930 | 3300042601 | Bacteria | 22459 |
| 35 | Ga0123357_10001211 | 3300009784 | Bacteria | 26983 |
| 36 | Ga0466705_172676 | 3300042612 | Bacteria | 3864 |
| 37 | Ga0466705_210712 | 3300042612 | Bacteria | 1576 |
| 38 | Ga0466703_330870 | 3300042636 | Bacteria | 1825 |
| 39 | Ga0466704_036765 | 3300042643 | Bacteria | 16967 |
| 40 | Ga0466708_019276 | 3300042652 | Bacteria | 21307 |
| 41 | Ga0466708_164096 | 3300042652 | Bacteria | 7334 |
| 42 | Ga0466711_403972 | 3300042615 | Bacteria | 61875 |
| 43 | Ga0466715_011112 | 3300042616 | Bacteria | 16804 |
| 44 | Ga0466715_076767 | 3300042616 | Bacteria | 23423 |
| 45 | Ga0466726_371359 | 3300042619 | Bacteria | 11043 |
| 46 | Ga0466729_090939 | 3300042621 | Bacteria | 9735 |
| 47 | Ga0160433_100831 | 3300012846 | Unclassified | 11024 |
| 48 | Ga0466690_092512 | 3300042590 | Bacteria | 12938 |
| 49 | Ga0123354_10148889 | 3300010882 | Bacteria | 2848 |
| 50 | Ga0466700_271423 | 3300042600 | Bacteria | 2854 |
| 51 | Ga0466707_119211 | 3300042601 | Bacteria | 2972 |
| 52 | Ga0466713_012561 | 3300042602 | Bacteria | 3244 |
| 53 | Ga0466719_451335 | 3300042606 | Bacteria | 1815 |
| 54 | Ga0466722_031735 | 3300042609 | Bacteria | 1151 |
| 55 | Ga0466733_095282 | 3300042659 | Bacteria | 5457 |
| 56 | Ga0466733_113480 | 3300042659 | Bacteria | 2218 |
| 57 | Ga0466735_005377 | 3300042624 | Bacteria | 3261 |
| 58 | Ga0466735_115470 | 3300042624 | Unclassified | 4379 |
| 59 | Ga0466735_141629 | 3300042624 | Bacteria | 6302 |
| 60 | Ga0466709_287914 | 3300042648 | Bacteria | 5883 |
| 61 | Ga0466708_321419 | 3300042652 | Bacteria | 16374 |
| 62 | Ga0466715_409757 | 3300042616 | Bacteria | 45403 |
| 63 | Ga0160453_100767 | 3300012814 | Bacteria | 18070 |
| 64 | Ga0466690_307159 | 3300042590 | Bacteria | 1501 |
| 65 | Ga0466692_202921 | 3300042591 | Bacteria | 23461 |
| 66 | Ga0466691_080667 | 3300042593 | Bacteria | 14393 |
| 67 | Ga0466691_183265 | 3300042593 | Bacteria | 11148 |
| 68 | Ga0466696_190324 | 3300042596 | Bacteria | 2643 |
| 69 | Ga0123357_10111153 | 3300009784 | Bacteria | 3492 |
| 70 | Ga0123354_10034725 | 3300010882 | Bacteria | 7883 |
| 71 | Ga0466706_253279 | 3300042599 | Bacteria | 2379 |
| 72 | Ga0466700_347223 | 3300042600 | Bacteria | 6265 |
| 73 | Ga0466722_173580 | 3300042609 | Bacteria | 1979 |
| 74 | 2227153022 | 2225789004 | Bacteria | 8525 |
| 75 | Ga0466735_036712 | 3300042624 | Bacteria | 2329 |
| 76 | Ga0466703_183704 | 3300042636 | Bacteria | 3343 |
| 77 | Ga0466704_263554 | 3300042643 | Unclassified | 1531 |
| 78 | Ga0466709_113294 | 3300042648 | Bacteria | 28711 |
| 79 | Ga0466725_085064 | 3300042654 | Bacteria | 1186 |
| 80 | Ga0466727_291497 | 3300042655 | Bacteria | 1683 |
| 81 | Ga0466729_107895 | 3300042621 | Bacteria | 2939 |
| 82 | Ga0466692_003319 | 3300042591 | Bacteria | 71632 |
| 83 | Ga0466691_187524 | 3300042593 | Bacteria | 8186 |
| 84 | Ga0466696_280513 | 3300042596 | Unclassified | 1989 |
| 85 | Ga0466696_431230 | 3300042596 | Bacteria | 2404 |
| 86 | Ga0123357_10004567 | 3300009784 | Bacteria | 16299 |
| 87 | Ga0123357_10078067 | 3300009784 | Unclassified | 4365 |
| 88 | Ga0123357_10134841 | 3300009784 | Bacteria | 3058 |
| 89 | Ga0123354_10285182 | 3300010882 | Bacteria | 1595 |
| 90 | Ga0466701_073331 | 3300042598 | Bacteria | 1132 |
| 91 | Ga0466706_052347 | 3300042599 | Bacteria | 5149 |
| 92 | Ga0466706_226311 | 3300042599 | Bacteria | 10163 |
| 93 | Ga0466707_322791 | 3300042601 | Bacteria | 29199 |
| 94 | Ga0466714_013660 | 3300042603 | Unclassified | 1383 |
| 95 | Ga0466714_072285 | 3300042603 | Bacteria | 4885 |
| 96 | Ga0466714_154944 | 3300042603 | Bacteria | 103066 |
| 97 | Ga0466705_126070 | 3300042612 | Bacteria | 23735 |
| 98 | Ga0466733_167333 | 3300042659 | Bacteria | 2489 |
| 99 | Ga0466703_390239 | 3300042636 | Bacteria | 3060 |
| 100 | Ga0466705_436235 | 3300042612 | Bacteria | 8441 |
| 101 | Ga0466711_014387 | 3300042615 | Bacteria | 11413 |
| 102 | Ga0466726_145705 | 3300042619 | Bacteria | 31377 |
| 103 | Ga0160444_101389 | 3300012841 | Unclassified | 4785 |
| 104 | Ga0265387_1000217 | 3300024582 | Bacteria | 10028 |
| 105 | Ga0466690_327307 | 3300042590 | Bacteria | 13972 |
| 106 | Ga0466691_228206 | 3300042593 | Bacteria | 1497 |
| 107 | Ga0466696_003763 | 3300042596 | Bacteria | 106079 |
| 108 | Ga0466696_017736 | 3300042596 | Unclassified | 4143 |
| 109 | Ga0466696_035748 | 3300042596 | Bacteria | 10479 |
| 110 | Ga0466696_241948 | 3300042596 | Bacteria | 2674 |
| 111 | Ga0466699_289528 | 3300042597 | Bacteria | 3315 |
| 112 | Ga0123353_10710571 | 3300010167 | Bacteria | 1408 |
| 113 | Ga0123354_10066467 | 3300010882 | Bacteria | 5264 |
| 114 | Ga0123354_10109791 | 3300010882 | Bacteria | 3652 |
| 115 | Ga0466700_262615 | 3300042600 | Bacteria | 9989 |
| 116 | Ga0466716_147451 | 3300042605 | Bacteria | 22878 |
| 117 | Ga0466716_308756 | 3300042605 | Bacteria | 5345 |
| 118 | Ga0466722_054466 | 3300042609 | Bacteria | 10893 |
| 119 | JGI24699J35502_11133510 | 3300002509 | Bacteria | 11319 |
| 120 | JGI24699J35502_11133861 | 3300002509 | Bacteria | 17399 |
| 121 | Ga0466705_302559 | 3300042612 | Bacteria | 1211 |
| 122 | Ga0466733_177981 | 3300042659 | Bacteria | 1661 |
| 123 | Ga0466734_049972 | 3300042623 | Bacteria | 1455 |
| 124 | Ga0466735_077476 | 3300042624 | Bacteria | 3230 |
| 125 | Ga0466703_130753 | 3300042636 | Bacteria | 9893 |
| 126 | Ga0466703_374980 | 3300042636 | Bacteria | 2027 |
| 127 | Ga0466727_251974 | 3300042655 | Bacteria | 41475 |
| 128 | Ga0466715_051157 | 3300042616 | Bacteria | 50381 |
| 129 | Ga0466723_035858 | 3300042618 | Bacteria | 52046 |
| 130 | Ga0466723_329006 | 3300042618 | Bacteria | 14408 |
| 131 | Ga0466728_070833 | 3300042620 | Bacteria | 41238 |
| 132 | Ga0466691_203760 | 3300042593 | Bacteria | 22262 |
| 133 | Ga0123357_10054852 | 3300009784 | Unclassified | 5370 |
| 134 | Ga0123357_10224568 | 3300009784 | Bacteria | 2075 |
| 135 | Ga0466706_059970 | 3300042599 | Bacteria | 23340 |
| 136 | Ga0466706_094212 | 3300042599 | Bacteria | 15235 |
| 137 | Ga0466706_140343 | 3300042599 | Bacteria | 15711 |
| 138 | Ga0466713_134320 | 3300042602 | Bacteria | 10928 |
| 139 | Ga0466719_156952 | 3300042606 | Unclassified | 4658 |
| 140 | Ga0466697_276902 | 3300042611 | Bacteria | 1024 |
| 141 | Ga0466735_197760 | 3300042624 | Bacteria | 2288 |
| 142 | Ga0466709_301311 | 3300042648 | Bacteria | 10280 |
| 143 | Ga0466711_118278 | 3300042615 | Bacteria | 21306 |
| 144 | Ga0466690_011526 | 3300042590 | Bacteria | 10291 |
| 145 | Ga0466696_444554 | 3300042596 | Bacteria | 19303 |
| 146 | Ga0123357_10041797 | 3300009784 | Bacteria | 6235 |
| 147 | Ga0123354_10039410 | 3300010882 | Bacteria | 7323 |
| 148 | Ga0466706_031962 | 3300042599 | Bacteria | 11375 |
| 149 | Ga0466706_034191 | 3300042599 | Bacteria | 44289 |
| 150 | Ga0466714_050410 | 3300042603 | Bacteria | 40060 |
| 151 | Ga0466714_090485 | 3300042603 | Bacteria | 2712 |
| 152 | Ga0466719_319297 | 3300042606 | Bacteria | 2498 |
| 153 | Ga0466722_200952 | 3300042609 | Bacteria | 7045 |
| 154 | Ga0068305_10001223 | 3300005083 | Bacteria | 98255 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042599 | Ga0466706_059970 | Ga0466706_059970_724_1566 | 264 |
| 2 | 3300042603 | Ga0466714_050410 | Ga0466714_050410_8136_8999 | 264 |
| 3 | 3300042621 | Ga0466729_107895 | Ga0466729_107895_1921_2718 | 265 |
| 4 | 3300042624 | Ga0466735_115470 | Ga0466735_115470_561_1403 | 266 |
| 5 | 3300042652 | Ga0466708_461535 | Ga0466708_461535_3025_3867 | 268 |
| 6 | 3300042624 | Ga0466735_107465 | Ga0466735_107465_60_902 | 271 |
| 7 | 3300042652 | Ga0466708_321419 | Ga0466708_321419_12140_12982 | 271 |
| 8 | 3300042598 | Ga0466701_073331 | Ga0466701_073331_241_1065 | 274 |
| 9 | 3300042612 | Ga0466705_436235 | Ga0466705_436235_2309_3133 | 274 |
| 10 | 3300042615 | Ga0466711_359360 | Ga0466711_359360_12748_13593 | 274 |
| 11 | 3300042654 | Ga0466725_085064 | Ga0466725_085064_102_926 | 274 |
| 12 | iso_pr_bacteria | 2706794701 | 2708047331 | 274 |
| 13 | iso_pr_bacteria | 2940239174 | 2940241619 | 274 |
| 14 | iso_pr_bacteria | 2940377351 | 2940379780 | 274 |
| 15 | 3300009784 | Ga0123357_10224568 | Ga0123357_102245682 | 275 |
| 16 | 3300010882 | Ga0123354_10147645 | Ga0123354_101476453 | 275 |
| 17 | 3300010882 | Ga0123354_10285182 | Ga0123354_102851822 | 275 |
| 18 | 3300042602 | Ga0466713_012561 | Ga0466713_012561_1511_2356 | 275 |
| 19 | 3300042593 | Ga0466691_203760 | Ga0466691_203760_5828_6667 | 279 |
| 20 | 3300042596 | Ga0466696_444554 | Ga0466696_444554_2132_2971 | 279 |
| 21 | 3300042606 | Ga0466719_319297 | Ga0466719_319297_424_1263 | 279 |
| 22 | 3300042609 | Ga0466722_200664 | Ga0466722_200664_336_1175 | 279 |
| 23 | 3300042612 | Ga0466705_009950 | Ga0466705_009950_25607_26446 | 279 |
| 24 | 3300042615 | Ga0466711_403972 | Ga0466711_403972_32636_33475 | 279 |
| 25 | 3300042619 | Ga0466726_328337 | Ga0466726_328337_1072_1911 | 279 |
| 26 | 3300042619 | Ga0466726_371359 | Ga0466726_371359_3588_4427 | 279 |
| 27 | 3300042636 | Ga0466703_330870 | Ga0466703_330870_760_1599 | 279 |
| 28 | 3300042643 | Ga0466704_263554 | Ga0466704_263554_27_866 | 279 |
| 29 | 3300042655 | Ga0466727_259681 | Ga0466727_259681_171_1010 | 279 |
| 30 | 2225789004 | 2227153022 | 2227559577 | 280 |
| 31 | 3300024582 | Ga0265387_1000217 | Ga0265387_10002176 | 280 |
| 32 | 3300042582 | Ga0466657_325607 | Ga0466657_325607_614_1456 | 280 |
| 33 | 3300042590 | Ga0466690_092512 | Ga0466690_092512_8388_9230 | 280 |
| 34 | 3300042590 | Ga0466690_327307 | Ga0466690_327307_8621_9463 | 280 |
| 35 | 3300042591 | Ga0466692_003319 | Ga0466692_003319_63360_64202 | 280 |
| 36 | 3300042591 | Ga0466692_049439 | Ga0466692_049439_3616_4458 | 280 |
| 37 | 3300042593 | Ga0466691_183265 | Ga0466691_183265_1030_1872 | 280 |
| 38 | 3300042593 | Ga0466691_228206 | Ga0466691_228206_304_1146 | 280 |
| 39 | 3300042596 | Ga0466696_017736 | Ga0466696_017736_2644_3486 | 280 |
| 40 | 3300042596 | Ga0466696_035748 | Ga0466696_035748_5585_6427 | 280 |
| 41 | 3300042596 | Ga0466696_190324 | Ga0466696_190324_430_1272 | 280 |
| 42 | 3300042596 | Ga0466696_241948 | Ga0466696_241948_1088_1930 | 280 |
| 43 | 3300042596 | Ga0466696_280513 | Ga0466696_280513_607_1449 | 280 |
| 44 | 3300042596 | Ga0466696_431230 | Ga0466696_431230_1280_2122 | 280 |
| 45 | 3300042599 | Ga0466706_031962 | Ga0466706_031962_7178_8020 | 280 |
| 46 | 3300042599 | Ga0466706_034191 | Ga0466706_034191_27291_28133 | 280 |
| 47 | 3300042599 | Ga0466706_052347 | Ga0466706_052347_2767_3609 | 280 |
| 48 | 3300042599 | Ga0466706_072928 | Ga0466706_072928_11179_12021 | 280 |
| 49 | 3300042599 | Ga0466706_074152 | Ga0466706_074152_522_1364 | 280 |
| 50 | 3300042599 | Ga0466706_140343 | Ga0466706_140343_6664_7506 | 280 |
| 51 | 3300042599 | Ga0466706_151415 | Ga0466706_151415_12593_13435 | 280 |
| 52 | 3300042599 | Ga0466706_253279 | Ga0466706_253279_1413_2255 | 280 |
| 53 | 3300042600 | Ga0466700_271423 | Ga0466700_271423_907_1749 | 280 |
| 54 | 3300042601 | Ga0466707_119211 | Ga0466707_119211_1837_2679 | 280 |
| 55 | 3300042601 | Ga0466707_258930 | Ga0466707_258930_19273_20115 | 280 |
| 56 | 3300042601 | Ga0466707_322791 | Ga0466707_322791_4508_5350 | 280 |
| 57 | 3300042602 | Ga0466713_134320 | Ga0466713_134320_2130_2972 | 280 |
| 58 | 3300042603 | Ga0466714_013660 | Ga0466714_013660_441_1283 | 280 |
| 59 | 3300042603 | Ga0466714_072285 | Ga0466714_072285_501_1343 | 280 |
| 60 | 3300042603 | Ga0466714_090485 | Ga0466714_090485_1640_2482 | 280 |
| 61 | 3300042603 | Ga0466714_154944 | Ga0466714_154944_60589_61431 | 280 |
| 62 | 3300042605 | Ga0466716_074068 | Ga0466716_074068_4283_5125 | 280 |
| 63 | 3300042605 | Ga0466716_147451 | Ga0466716_147451_14930_15772 | 280 |
| 64 | 3300042605 | Ga0466716_308756 | Ga0466716_308756_4376_5218 | 280 |
| 65 | 3300042606 | Ga0466719_156952 | Ga0466719_156952_1071_1913 | 280 |
| 66 | 3300042606 | Ga0466719_504944 | Ga0466719_504944_957_1799 | 280 |
| 67 | 3300042609 | Ga0466722_031735 | Ga0466722_031735_133_975 | 280 |
| 68 | 3300042609 | Ga0466722_054466 | Ga0466722_054466_5148_5990 | 280 |
| 69 | 3300042609 | Ga0466722_173580 | Ga0466722_173580_464_1306 | 280 |
| 70 | 3300042609 | Ga0466722_200952 | Ga0466722_200952_2122_2964 | 280 |
| 71 | 3300042611 | Ga0466697_276902 | Ga0466697_276902_109_951 | 280 |
| 72 | 3300042612 | Ga0466705_126070 | Ga0466705_126070_5189_6031 | 280 |
| 73 | 3300042612 | Ga0466705_172676 | Ga0466705_172676_2905_3747 | 280 |
| 74 | 3300042615 | Ga0466711_055238 | Ga0466711_055238_3251_4093 | 280 |
| 75 | 3300042616 | Ga0466715_011112 | Ga0466715_011112_1091_1933 | 280 |
| 76 | 3300042616 | Ga0466715_038292 | Ga0466715_038292_2989_3831 | 280 |
| 77 | 3300042616 | Ga0466715_051157 | Ga0466715_051157_10716_11558 | 280 |
| 78 | 3300042616 | Ga0466715_076767 | Ga0466715_076767_8229_9071 | 280 |
| 79 | 3300042616 | Ga0466715_409757 | Ga0466715_409757_29595_30437 | 280 |
| 80 | 3300042619 | Ga0466726_145705 | Ga0466726_145705_13623_14465 | 280 |
| 81 | 3300042620 | Ga0466728_070833 | Ga0466728_070833_26793_27635 | 280 |
| 82 | 3300042620 | Ga0466728_143836 | Ga0466728_143836_2630_3472 | 280 |
| 83 | 3300042620 | Ga0466728_303164 | Ga0466728_303164_1237_2079 | 280 |
| 84 | 3300042621 | Ga0466729_090939 | Ga0466729_090939_1586_2428 | 280 |
| 85 | 3300042623 | Ga0466734_049972 | Ga0466734_049972_53_895 | 280 |
| 86 | 3300042624 | Ga0466735_005377 | Ga0466735_005377_1702_2544 | 280 |
| 87 | 3300042624 | Ga0466735_036712 | Ga0466735_036712_196_1038 | 280 |
| 88 | 3300042624 | Ga0466735_042821 | Ga0466735_042821_1257_2099 | 280 |
| 89 | 3300042624 | Ga0466735_077476 | Ga0466735_077476_296_1138 | 280 |
| 90 | 3300042624 | Ga0466735_141629 | Ga0466735_141629_2656_3498 | 280 |
| 91 | 3300042624 | Ga0466735_197760 | Ga0466735_197760_1317_2159 | 280 |
| 92 | 3300042636 | Ga0466703_183704 | Ga0466703_183704_1523_2365 | 280 |
| 93 | 3300042636 | Ga0466703_374980 | Ga0466703_374980_755_1597 | 280 |
| 94 | 3300042636 | Ga0466703_390239 | Ga0466703_390239_1271_2113 | 280 |
| 95 | 3300042643 | Ga0466704_036765 | Ga0466704_036765_1619_2461 | 280 |
| 96 | 3300042643 | Ga0466704_313968 | Ga0466704_313968_3152_3994 | 280 |
| 97 | 3300042643 | Ga0466704_316220 | Ga0466704_316220_4670_5512 | 280 |
| 98 | 3300042648 | Ga0466709_113294 | Ga0466709_113294_18988_19830 | 280 |
| 99 | 3300042648 | Ga0466709_301311 | Ga0466709_301311_8415_9257 | 280 |
| 100 | 3300042652 | Ga0466708_019276 | Ga0466708_019276_1831_2673 | 280 |
| 101 | 3300042652 | Ga0466708_164096 | Ga0466708_164096_5493_6335 | 280 |
| 102 | 3300042655 | Ga0466727_251974 | Ga0466727_251974_40316_41158 | 280 |
| 103 | 3300042655 | Ga0466727_291497 | Ga0466727_291497_705_1547 | 280 |
| 104 | 3300042659 | Ga0466733_113480 | Ga0466733_113480_567_1409 | 280 |
| 105 | 3300042659 | Ga0466733_167333 | Ga0466733_167333_402_1244 | 280 |
| 106 | 3300042659 | Ga0466733_206577 | Ga0466733_206577_15508_16350 | 280 |
| 107 | iso_pr_bacteria | 2609459943 | 2610744389 | 280 |
| 108 | iso_pr_bacteria | 2830041218 | 2830043155 | 280 |
| 109 | iso_pr_bacteria | 2920168565 | 2920170711 | 280 |
| 110 | iso_pr_bacteria | 2922326829 | 2922327679 | 280 |
| 111 | iso_pr_bacteria | 2923982719 | 2923982955 | 280 |
| 112 | iso_pr_bacteria | 2940195863 | 2940197750 | 280 |
| 113 | iso_pr_bacteria | 2940199050 | 2940199676 | 280 |
| 114 | iso_pr_bacteria | 2940202316 | 2940203580 | 280 |
| 115 | iso_pr_bacteria | 2940209341 | 2940212041 | 280 |
| 116 | iso_pr_bacteria | 2940346213 | 2940346995 | 280 |
| 117 | iso_pr_bacteria | 2940371297 | 2940372725 | 280 |
| 118 | iso_pr_bacteria | 2967483437 | 2967487024 | 280 |
| 119 | iso_pr_bacteria | 3004672520 | 3004674186 | 280 |
| 120 | 3300000062 | IMNBL1DRAFT_c0002776 | IMNBL1DRAFT_00027765 | 281 |
| 121 | 3300002509 | JGI24699J35502_11133510 | JGI24699J35502_111335108 | 281 |
| 122 | 3300005083 | Ga0068305_10001223 | Ga0068305_1000122348 | 281 |
| 123 | 3300009784 | Ga0123357_10001211 | Ga0123357_1000121125 | 281 |
| 124 | 3300009784 | Ga0123357_10041797 | Ga0123357_100417974 | 281 |
| 125 | 3300009784 | Ga0123357_10054852 | Ga0123357_100548526 | 281 |
| 126 | 3300009784 | Ga0123357_10078067 | Ga0123357_100780674 | 281 |
| 127 | 3300009784 | Ga0123357_10111153 | Ga0123357_101111531 | 281 |
| 128 | 3300010167 | Ga0123353_10164665 | Ga0123353_101646653 | 281 |
| 129 | 3300010167 | Ga0123353_10710571 | Ga0123353_107105711 | 281 |
| 130 | 3300010882 | Ga0123354_10000099 | Ga0123354_1000009940 | 281 |
| 131 | 3300010882 | Ga0123354_10034725 | Ga0123354_100347255 | 281 |
| 132 | 3300010882 | Ga0123354_10039410 | Ga0123354_100394105 | 281 |
| 133 | 3300010882 | Ga0123354_10066467 | Ga0123354_100664675 | 281 |
| 134 | 3300010882 | Ga0123354_10109791 | Ga0123354_101097914 | 281 |
| 135 | 3300010882 | Ga0123354_10148889 | Ga0123354_101488892 | 281 |
| 136 | 3300012814 | Ga0160453_100767 | Ga0160453_1007674 | 281 |
| 137 | 3300012824 | Ga0160469_101431 | Ga0160469_1014317 | 281 |
| 138 | 3300012841 | Ga0160444_101389 | Ga0160444_1013896 | 281 |
| 139 | 3300012846 | Ga0160433_100831 | Ga0160433_1008318 | 281 |
| 140 | 3300042590 | Ga0466690_307159 | Ga0466690_307159_261_1106 | 281 |
| 141 | 3300042593 | Ga0466691_080667 | Ga0466691_080667_12845_13690 | 281 |
| 142 | 3300042593 | Ga0466691_187524 | Ga0466691_187524_6115_6960 | 281 |
| 143 | 3300042596 | Ga0466696_003763 | Ga0466696_003763_76354_77199 | 281 |
| 144 | 3300042596 | Ga0466696_248437 | Ga0466696_248437_354_1199 | 281 |
| 145 | 3300042597 | Ga0466699_289528 | Ga0466699_289528_2310_3155 | 281 |
| 146 | 3300042599 | Ga0466706_047496 | Ga0466706_047496_2418_3263 | 281 |
| 147 | 3300042600 | Ga0466700_262615 | Ga0466700_262615_7692_8537 | 281 |
| 148 | 3300042600 | Ga0466700_347223 | Ga0466700_347223_1521_2366 | 281 |
| 149 | 3300042605 | Ga0466716_020038 | Ga0466716_020038_19457_20302 | 281 |
| 150 | 3300042606 | Ga0466719_451335 | Ga0466719_451335_943_1788 | 281 |
| 151 | 3300042612 | Ga0466705_210712 | Ga0466705_210712_449_1294 | 281 |
| 152 | 3300042615 | Ga0466711_014387 | Ga0466711_014387_3249_4094 | 281 |
| 153 | 3300042615 | Ga0466711_118278 | Ga0466711_118278_4304_5149 | 281 |
| 154 | 3300042618 | Ga0466723_035858 | Ga0466723_035858_12421_13266 | 281 |
| 155 | 3300042620 | Ga0466728_009673 | Ga0466728_009673_1276_2121 | 281 |
| 156 | 3300042636 | Ga0466703_130753 | Ga0466703_130753_2831_3676 | 281 |
| 157 | 3300042648 | Ga0466709_287914 | Ga0466709_287914_466_1311 | 281 |
| 158 | 3300042659 | Ga0466733_177981 | Ga0466733_177981_748_1593 | 281 |
| 159 | iso_pr_bacteria | 2820757377 | 2820757926 | 281 |
| 160 | iso_pr_bacteria | 2940205530 | 2940208534 | 281 |
| 161 | iso_pr_bacteria | 2940212447 | 2940215448 | 281 |
| 162 | iso_pr_bacteria | 2940298504 | 2940301502 | 281 |
| 163 | iso_pr_bacteria | 2940302308 | 2940305304 | 281 |
| 164 | iso_pr_bacteria | 2940306115 | 2940308822 | 281 |
| 165 | iso_pr_bacteria | 2940309933 | 2940312660 | 281 |
| 166 | iso_pr_bacteria | 2940313741 | 2940316473 | 281 |
| 167 | iso_pr_bacteria | 2940317558 | 2940320288 | 281 |
| 168 | iso_pr_bacteria | 2940321370 | 2940324044 | 281 |
| 169 | iso_pr_bacteria | 2940325180 | 2940328174 | 281 |
| 170 | iso_pr_bacteria | 2940328985 | 2940331981 | 281 |
| 171 | iso_pr_bacteria | 2940332795 | 2940335496 | 281 |
| 172 | 3300002509 | JGI24699J35502_11133861 | JGI24699J35502_1113386112 | 282 |
| 173 | 3300042659 | Ga0466733_095282 | Ga0466733_095282_1390_2238 | 282 |
| 174 | 3300009784 | Ga0123357_10004567 | Ga0123357_1000456711 | 286 |
| 175 | 3300042590 | Ga0466690_011526 | Ga0466690_011526_921_1784 | 287 |
| 176 | 3300042591 | Ga0466692_202921 | Ga0466692_202921_15930_16796 | 288 |
| 177 | 3300009784 | Ga0123357_10134841 | Ga0123357_101348411 | 290 |
| 178 | 3300042599 | Ga0466706_226311 | Ga0466706_226311_3561_4457 | 298 |
| 179 | 3300005083 | Ga0068305_10208188 | Ga0068305_102081882 | 300 |
| 180 | 3300042618 | Ga0466723_329006 | Ga0466723_329006_6962_7864 | 300 |
| 181 | 3300042599 | Ga0466706_094212 | Ga0466706_094212_10960_11880 | 306 |
| 182 | iso_pr_bacteria | 2830041218 | 2830044186 | 306 |
| 183 | iso_pr_bacteria | 2609459943 | 2610741969 | 316 |
| 184 | 3300042612 | Ga0466705_302559 | Ga0466705_302559_33_986 | 317 |
| 185 | 3300042652 | Ga0466708_036363 | Ga0466708_036363_3276_4247 | 323 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04962 | KduI | KduI/IolB family | 139 | 308 | 0.87 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF04962 | GO:0016861 | intramolecular oxidoreductase activity, interconverting aldoses and ketoses | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.85 | 0.91 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.