Protein Family IF09832

Metagenome Isolate
116 Members
34 Samples
114 Scaffolds
230.04 Avg Length

🧬 Representative Sequence

ID
3300042652|Ga0466708_027958|Ga0466708_027958_7581_8312
Length
243 aa
Sequence
VTASGKGIAFMLQMTGFMLEGAFTSLRVFFLTLLFSVPLALPVAFGRMSKNPPVRAIVNFYLLVMRGTPLILQLIFIYFAPKYFYAFLHNNFSALIVSGAFWDGARAVLSYNRFTAVIIAFSLNYAAYFAEIYRGGIESIPGGQYEAAKVLGFTRSGTFLRIILPQVVKRILPASGNEVITLVKDTALAQVIGVAELFHAAQNAAAREFSTMPIFVAGLFYLVMNWMVTAAFARVEKKLSYYS

📊 Sample Types

Isolate 1.7%
Metagenome 98.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 39.4%
Termitidae 36.4%
Rhinotermitidae 9.1%
Unclassified 6.1%
Termopsidae 6.1%
Hodotermitidae 3.0%

🌳 Taxonomy

Archaea 0
Bacteria 107
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
2 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
3 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
4 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
5 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
6 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
7 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
8 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
9 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
10 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
11 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
12 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
13 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
14 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
15 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
16 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
17 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
18 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
19 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
20 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
21 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
22 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
23 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
24 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
25 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
26 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
27 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
28 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
29 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
30 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
31 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
32 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
33 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
34 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466703_362677 3300042636 Unclassified 9561
2 Ga0466709_417269 3300042648 Bacteria 6862
3 Ga0466708_436649 3300042652 Bacteria 1974
4 Ga0466727_019171 3300042655 Bacteria 2405
5 Ga0466715_177600 3300042616 Bacteria 1225
6 Ga0466715_453261 3300042616 Bacteria 2760
7 Ga0466723_182976 3300042618 Unclassified 3373
8 Ga0466726_260359 3300042619 Bacteria 2463
9 Ga0466726_267515 3300042619 Bacteria 2087
10 Ga0466690_063465 3300042590 Bacteria 4247
11 Ga0466691_010342 3300042593 Bacteria 18793
12 Ga0466691_045548 3300042593 Bacteria 2733
13 Ga0466696_299704 3300042596 Bacteria 6074
14 Ga0123353_10261347 3300010167 Bacteria 2673
15 Ga0123353_10318188 3300010167 Bacteria 2363
16 Ga0466704_124476 3300042643 Bacteria 1059
17 Ga0466708_027958 3300042652 Bacteria 12389
18 Ga0466727_166112 3300042655 Bacteria 1253
19 Ga0466719_422105 3300042606 Bacteria 4432
20 Ga0466715_615105 3300042616 Bacteria 2311
21 Ga0466723_159001 3300042618 Bacteria 43446
22 Ga0466728_481748 3300042620 Bacteria 2151
23 Ga0466691_040043 3300042593 Bacteria 2163
24 Ga0466694_266931 3300042594 Unclassified 2249
25 Ga0466694_336652 3300042594 Bacteria 8120
26 Ga0466696_205482 3300042596 Bacteria 15324
27 Ga0123353_10916760 3300010167 Bacteria 1190
28 Ga0123354_10365783 3300010882 Bacteria 1265
29 Ga0466708_030509 3300042652 Bacteria 4461
30 Ga0466706_182594 3300042599 Bacteria 1666
31 Ga0466714_089873 3300042603 Bacteria 1118
32 Ga0466722_078186 3300042609 Bacteria 4595
33 Ga0466712_204614 3300042614 Bacteria 1459
34 Ga0466712_299006 3300042614 Unclassified 1300
35 Ga0466715_049697 3300042616 Bacteria 16425
36 Ga0466715_283949 3300042616 Bacteria 3353
37 Ga0456237_0004167 3300041968 Bacteria 2328
38 Ga0466692_001160 3300042591 Bacteria 2297
39 Ga0466694_079822 3300042594 Bacteria 1554
40 Ga0466696_393547 3300042596 Bacteria 1918
41 Ga0466705_245609 3300042612 Bacteria 3099
42 Ga0466703_113296 3300042636 Bacteria 4956
43 Ga0466704_291003 3300042643 Bacteria 20080
44 Ga0466709_013124 3300042648 Unclassified 5130
45 Ga0466719_119934 3300042606 Bacteria 1124
46 Ga0466722_095242 3300042609 Bacteria 1069
47 Ga0466722_236386 3300042609 Bacteria 1919
48 Ga0456237_0005130 3300041968 Bacteria 2084
49 Ga0466692_039354 3300042591 Bacteria 1561
50 Ga0466691_175191 3300042593 Bacteria 7694
51 Ga0466694_094664 3300042594 Bacteria 6479
52 Ga0466699_084155 3300042597 Bacteria 1195
53 Ga0123357_10473221 3300009784 Bacteria 1066
54 Ga0466708_065466 3300042652 Bacteria 4617
55 Ga0466716_286341 3300042605 Bacteria 3655
56 Ga0466716_362855 3300042605 Bacteria 2492
57 Ga0466698_363026 3300042610 Bacteria 1305
58 Ga0466705_410975 3300042612 Bacteria 2644
59 Ga0466712_311051 3300042614 Bacteria 3657
60 Ga0466690_120542 3300042590 Bacteria 2670
61 Ga0466694_236336 3300042594 Bacteria 2234
62 Ga0123357_10098401 3300009784 Bacteria 3781
63 Ga0123356_10387679 3300010049 Bacteria 1531
64 Ga0123353_10018984 3300010167 Bacteria 10199
65 Ga0466703_310515 3300042636 Bacteria 11029
66 Ga0466708_043622 3300042652 Bacteria 12780
67 Ga0466716_133127 3300042605 Bacteria 2098
68 Ga0466716_426069 3300042605 Bacteria 2025
69 Ga0466719_186590 3300042606 Bacteria 2314
70 Ga0466719_410277 3300042606 Bacteria 2724
71 Ga0466719_536845 3300042606 Bacteria 2018
72 Ga0466712_045873 3300042614 Bacteria 2774
73 Ga0466715_114300 3300042616 Bacteria 1206
74 Ga0466723_031358 3300042618 Bacteria 23219
75 Ga0466723_190368 3300042618 Bacteria 4204
76 Ga0466726_341514 3300042619 Bacteria 1157
77 Ga0466728_005545 3300042620 Bacteria 3035
78 Ga0466690_016388 3300042590 Bacteria 4727
79 Ga0466690_403980 3300042590 Bacteria 18990
80 Ga0466696_243649 3300042596 Bacteria 16252
81 JGI24702J35022_10000858 3300002462 Bacteria 18804
82 Ga0072941_1015278 3300005201 Bacteria 7926
83 Ga0466709_001185 3300042648 Bacteria 1423
84 Ga0466708_201392 3300042652 Bacteria 9634
85 Ga0466708_233463 3300042652 Bacteria 3427
86 Ga0466708_299459 3300042652 Bacteria 6691
87 Ga0466701_028119 3300042598 Bacteria 1127
88 Ga0466719_049120 3300042606 Bacteria 3106
89 Ga0466719_371145 3300042606 Bacteria 4094
90 Ga0466722_139518 3300042609 Bacteria 2835
91 Ga0466715_240439 3300042616 Bacteria 8619
92 Ga0466715_383132 3300042616 Unclassified 2937
93 Ga0466723_003343 3300042618 Bacteria 5529
94 Ga0466728_251956 3300042620 Bacteria 2285
95 Ga0466692_073514 3300042591 Bacteria 12002
96 Ga0466692_085945 3300042591 Bacteria 6285
97 Ga0466696_273379 3300042596 Unclassified 2603
98 Ga0466696_323292 3300042596 Bacteria 1162
99 Ga0123353_10285418 3300010167 Bacteria 2531
100 JGI24698J34947_10000331 3300002449 Bacteria 20915
101 Ga0466704_275324 3300042643 Bacteria 11087
102 Ga0466709_191447 3300042648 Bacteria 8596
103 Ga0466716_014951 3300042605 Bacteria 2929
104 Ga0466716_328779 3300042605 Bacteria 17729
105 Ga0466722_267288 3300042609 Bacteria 4603
106 Ga0466726_279513 3300042619 Bacteria 3945
107 Ga0466692_010852 3300042591 Unclassified 3178
108 Ga0466694_172031 3300042594 Bacteria 1166
109 Ga0123357_10051382 3300009784 Bacteria 5572
110 Ga0123357_10164420 3300009784 Bacteria 2648
111 Ga0123356_10694116 3300010049 Unclassified 1187
112 Ga0123353_10445254 3300010167 Bacteria 1909
113 JGI24702J35022_10019686 3300002462 Bacteria 3671
114 Ga0072941_1004526 3300005201 Bacteria 12514

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042652 Ga0466708_043622 Ga0466708_043622_12163_12750 195
2 3300042652 Ga0466708_233463 Ga0466708_233463_2810_3397 195
3 3300042606 Ga0466719_536845 Ga0466719_536845_13_603 196
4 3300005201 Ga0072941_1015278 Ga0072941_10152782 203
5 3300042652 Ga0466708_201392 Ga0466708_201392_5239_5931 217
6 3300042590 Ga0466690_120542 Ga0466690_120542_972_1664 218
7 3300002462 JGI24702J35022_10019686 JGI24702J35022_100196862 224
8 3300042590 Ga0466690_403980 Ga0466690_403980_13784_14464 226
9 3300042591 Ga0466692_001160 Ga0466692_001160_437_1117 226
10 3300042591 Ga0466692_010852 Ga0466692_010852_2320_3000 226
11 3300042591 Ga0466692_073514 Ga0466692_073514_4078_4758 226
12 3300042591 Ga0466692_085945 Ga0466692_085945_5427_6107 226
13 3300042594 Ga0466694_172031 Ga0466694_172031_356_1036 226
14 3300042596 Ga0466696_299704 Ga0466696_299704_3411_4091 226
15 3300042609 Ga0466722_139518 Ga0466722_139518_671_1351 226
16 3300042609 Ga0466722_267288 Ga0466722_267288_1840_2520 226
17 3300042616 Ga0466715_177600 Ga0466715_177600_336_1016 226
18 3300042620 Ga0466728_251956 Ga0466728_251956_954_1634 226
19 3300042652 Ga0466708_436649 Ga0466708_436649_326_1006 226
20 3300010049 Ga0123356_10387679 Ga0123356_103876792 227
21 3300042616 Ga0466715_049697 Ga0466715_049697_5863_6552 229
22 3300041968 Ga0456237_0004167 Ga0456237_0004167_1024_1716 230
23 3300042590 Ga0466690_016388 Ga0466690_016388_452_1144 230
24 3300042593 Ga0466691_010342 Ga0466691_010342_7742_8434 230
25 3300042593 Ga0466691_040043 Ga0466691_040043_1166_1858 230
26 3300042593 Ga0466691_045548 Ga0466691_045548_802_1494 230
27 3300042594 Ga0466694_079822 Ga0466694_079822_738_1430 230
28 3300042596 Ga0466696_323292 Ga0466696_323292_395_1087 230
29 3300042596 Ga0466696_393547 Ga0466696_393547_148_840 230
30 3300042598 Ga0466701_028119 Ga0466701_028119_422_1114 230
31 3300042605 Ga0466716_014951 Ga0466716_014951_1255_1947 230
32 3300042605 Ga0466716_286341 Ga0466716_286341_2919_3611 230
33 3300042606 Ga0466719_049120 Ga0466719_049120_579_1271 230
34 3300042606 Ga0466719_186590 Ga0466719_186590_1007_1699 230
35 3300042606 Ga0466719_410277 Ga0466719_410277_1166_1858 230
36 3300042616 Ga0466715_240439 Ga0466715_240439_6789_7481 230
37 3300042616 Ga0466715_283949 Ga0466715_283949_1792_2484 230
38 3300042616 Ga0466715_383132 Ga0466715_383132_1409_2101 230
39 3300042618 Ga0466723_031358 Ga0466723_031358_9966_10658 230
40 3300042618 Ga0466723_190368 Ga0466723_190368_2462_3154 230
41 3300042619 Ga0466726_260359 Ga0466726_260359_804_1496 230
42 3300042619 Ga0466726_267515 Ga0466726_267515_146_838 230
43 3300042619 Ga0466726_341514 Ga0466726_341514_29_721 230
44 3300042620 Ga0466728_481748 Ga0466728_481748_139_831 230
45 3300042636 Ga0466703_113296 Ga0466703_113296_2714_3406 230
46 3300042643 Ga0466704_275324 Ga0466704_275324_5089_5781 230
47 3300042648 Ga0466709_417269 Ga0466709_417269_2264_2956 230
48 3300042652 Ga0466708_030509 Ga0466708_030509_1175_1867 230
49 3300042655 Ga0466727_019171 Ga0466727_019171_332_1024 230
50 3300042655 Ga0466727_166112 Ga0466727_166112_154_846 230
51 3300009784 Ga0123357_10164420 Ga0123357_101644202 231
52 3300010882 Ga0123354_10365783 Ga0123354_103657832 231
53 3300042599 Ga0466706_182594 Ga0466706_182594_824_1519 231
54 3300041968 Ga0456237_0005130 Ga0456237_0005130_633_1331 232
55 3300042590 Ga0466690_063465 Ga0466690_063465_2575_3276 233
56 3300042593 Ga0466691_175191 Ga0466691_175191_6063_6764 233
57 3300042594 Ga0466694_094664 Ga0466694_094664_5763_6464 233
58 3300042594 Ga0466694_236336 Ga0466694_236336_1380_2081 233
59 3300042594 Ga0466694_266931 Ga0466694_266931_1479_2180 233
60 3300042594 Ga0466694_336652 Ga0466694_336652_875_1576 233
61 3300042596 Ga0466696_205482 Ga0466696_205482_6858_7559 233
62 3300042596 Ga0466696_243649 Ga0466696_243649_1433_2134 233
63 3300042596 Ga0466696_273379 Ga0466696_273379_440_1141 233
64 3300042597 Ga0466699_084155 Ga0466699_084155_320_1021 233
65 3300042603 Ga0466714_089873 Ga0466714_089873_66_767 233
66 3300042605 Ga0466716_133127 Ga0466716_133127_1048_1749 233
67 3300042605 Ga0466716_328779 Ga0466716_328779_15164_15865 233
68 3300042605 Ga0466716_362855 Ga0466716_362855_165_866 233
69 3300042605 Ga0466716_426069 Ga0466716_426069_1112_1813 233
70 3300042606 Ga0466719_119934 Ga0466719_119934_293_994 233
71 3300042606 Ga0466719_371145 Ga0466719_371145_130_831 233
72 3300042606 Ga0466719_422105 Ga0466719_422105_2609_3310 233
73 3300042609 Ga0466722_078186 Ga0466722_078186_1277_1978 233
74 3300042609 Ga0466722_095242 Ga0466722_095242_327_1028 233
75 3300042609 Ga0466722_236386 Ga0466722_236386_57_758 233
76 3300042610 Ga0466698_363026 Ga0466698_363026_312_1013 233
77 3300042612 Ga0466705_245609 Ga0466705_245609_2255_2956 233
78 3300042612 Ga0466705_410975 Ga0466705_410975_607_1308 233
79 3300042614 Ga0466712_045873 Ga0466712_045873_1375_2076 233
80 3300042614 Ga0466712_204614 Ga0466712_204614_464_1165 233
81 3300042614 Ga0466712_299006 Ga0466712_299006_491_1192 233
82 3300042614 Ga0466712_311051 Ga0466712_311051_1826_2527 233
83 3300042616 Ga0466715_114300 Ga0466715_114300_233_934 233
84 3300042616 Ga0466715_453261 Ga0466715_453261_1848_2549 233
85 3300042616 Ga0466715_615105 Ga0466715_615105_549_1250 233
86 3300042618 Ga0466723_003343 Ga0466723_003343_4004_4705 233
87 3300042618 Ga0466723_159001 Ga0466723_159001_13406_14107 233
88 3300042618 Ga0466723_182976 Ga0466723_182976_2135_2836 233
89 3300042619 Ga0466726_279513 Ga0466726_279513_913_1614 233
90 3300042620 Ga0466728_005545 Ga0466728_005545_915_1616 233
91 3300042636 Ga0466703_310515 Ga0466703_310515_2100_2801 233
92 3300042636 Ga0466703_362677 Ga0466703_362677_8107_8808 233
93 3300042643 Ga0466704_124476 Ga0466704_124476_294_995 233
94 3300042643 Ga0466704_291003 Ga0466704_291003_3766_4467 233
95 3300042648 Ga0466709_001185 Ga0466709_001185_200_901 233
96 3300042648 Ga0466709_013124 Ga0466709_013124_729_1430 233
97 3300042648 Ga0466709_191447 Ga0466709_191447_984_1685 233
98 3300042652 Ga0466708_065466 Ga0466708_065466_1938_2639 233
99 3300042652 Ga0466708_299459 Ga0466708_299459_4140_4841 233
100 iso_pr_bacteria 2781125695 2781438875 233
101 iso_pr_bacteria 2781125696 2781441733 233
102 3300002449 JGI24698J34947_10000331 JGI24698J34947_100003319 234
103 3300002462 JGI24702J35022_10000858 JGI24702J35022_100008588 234
104 3300005201 Ga0072941_1004526 Ga0072941_10045265 234
105 3300009784 Ga0123357_10051382 Ga0123357_100513823 234
106 3300009784 Ga0123357_10098401 Ga0123357_100984013 234
107 3300009784 Ga0123357_10473221 Ga0123357_104732212 234
108 3300010049 Ga0123356_10694116 Ga0123356_106941162 234
109 3300010167 Ga0123353_10018984 Ga0123353_100189847 234
110 3300010167 Ga0123353_10261347 Ga0123353_102613473 234
111 3300010167 Ga0123353_10285418 Ga0123353_102854183 234
112 3300010167 Ga0123353_10318188 Ga0123353_103181883 234
113 3300010167 Ga0123353_10445254 Ga0123353_104452542 234
114 3300010167 Ga0123353_10916760 Ga0123353_109167602 234
115 3300042591 Ga0466692_039354 Ga0466692_039354_787_1503 238
116 3300042652 Ga0466708_027958 Ga0466708_027958_7581_8312 243

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00528 BPD_transp_1 Binding-protein-dependent transport system inner membrane component 37 240 0.93

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.72 0.77 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.