Protein Family IF09825

Metagenome Isolate
103 Members
37 Samples
101 Scaffolds
189.62 Avg Length

🧬 Representative Sequence

ID
3300042652|Ga0466708_018857|Ga0466708_018857_150_794
Length
214 aa
Sequence
MSNLEIGSKKGKAMRRSILFVFVVLCTLGIAPDYPLGTGAGMSLLGAAEIDSPAIEVITNNYAARNFAPGTVSKADLDRILAAGVRAPSANNRQPWHFTVVQNQALAKRIVSNITEGNVLIIVSAAGDGTNSRVVLDCALATESIYLAAQALGLGSRIYTGPMDTINRQLKAELEMPKDYSAVALVRIGRVAPDADAVSAASARKPLEGMVNYK

📊 Sample Types

Isolate 1.9%
Metagenome 98.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 41.7%
Kalotermitidae 38.9%
Unclassified 8.3%
Termopsidae 8.3%
Rhinotermitidae 2.8%

🌳 Taxonomy

Archaea 0
Bacteria 96
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
2 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
3 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
4 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
5 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
6 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
7 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
8 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
9 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
10 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
11 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
12 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
13 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
14 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
15 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
16 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
17 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
18 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
19 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
20 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
21 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
22 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
23 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
24 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
25 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
26 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
27 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
28 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
29 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
30 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
31 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
32 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
33 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
34 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
35 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
36 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
37 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123353_10969126 3300010167 Bacteria 1148
2 Ga0466705_264670 3300042612 Bacteria 4546
3 Ga0466712_088292 3300042614 Bacteria 11045
4 Ga0466715_631551 3300042616 Bacteria 3175
5 Ga0466719_065782 3300042606 Bacteria 6668
6 Ga0466719_198234 3300042606 Unclassified 1109
7 Ga0466722_011614 3300042609 Bacteria 1336
8 AustNasuHG_c1005807 3300000089 Bacteria 4410
9 JGI24698J34947_10048840 3300002449 Bacteria 2141
10 Ga0072940_1101401 3300005200 Bacteria 2136
11 Ga0466703_296925 3300042636 Bacteria 1572
12 Ga0466704_011229 3300042643 Bacteria 1398
13 Ga0466691_123053 3300042593 Bacteria 4054
14 Ga0466699_200335 3300042597 Bacteria 11655
15 Ga0123353_11317301 3300010167 Bacteria 936
16 Ga0466705_140924 3300042612 Bacteria 10301
17 Ga0466711_109868 3300042615 Bacteria 21293
18 Ga0466711_144440 3300042615 Bacteria 13911
19 Ga0466726_112974 3300042619 Bacteria 2389
20 Ga0466726_379206 3300042619 Bacteria 1210
21 Ga0466726_437730 3300042619 Unclassified 1164
22 Ga0466703_079174 3300042636 Bacteria 8813
23 Ga0466704_531644 3300042643 Bacteria 4133
24 Ga0466708_076845 3300042652 Bacteria 1971
25 Ga0466727_051219 3300042655 Bacteria 1349
26 Ga0466690_121506 3300042590 Bacteria 4598
27 Ga0466691_030035 3300042593 Bacteria 13573
28 Ga0466699_061223 3300042597 Bacteria 9352
29 Ga0466705_102536 3300042612 Bacteria 6907
30 Ga0466705_108036 3300042612 Bacteria 8382
31 Ga0466712_104687 3300042614 Bacteria 4283
32 Ga0466715_089417 3300042616 Bacteria 27330
33 Ga0466703_425252 3300042636 Bacteria 1505
34 Ga0466704_037583 3300042643 Bacteria 5870
35 Ga0466704_091719 3300042643 Unclassified 3045
36 Ga0466709_015573 3300042648 Bacteria 8838
37 Ga0466709_369742 3300042648 Bacteria 3780
38 Ga0466708_018857 3300042652 Bacteria 3517
39 Ga0264413_102773 3300024493 Bacteria 10529
40 Ga0466699_212238 3300042597 Unclassified 1477
41 Ga0123356_11085059 3300010049 Bacteria 969
42 Ga0466733_007578 3300042659 Bacteria 2305
43 Ga0466705_401535 3300042612 Bacteria 1660
44 Ga0466712_086915 3300042614 Bacteria 1433
45 Ga0466715_489952 3300042616 Bacteria 3245
46 Ga0466723_002059 3300042618 Bacteria 25709
47 Ga0466723_091625 3300042618 Bacteria 45311
48 Ga0466723_278242 3300042618 Bacteria 7920
49 Ga0466726_456378 3300042619 Unclassified 1408
50 JGI24698J34947_10139120 3300002449 Bacteria 1025
51 Ga0466727_030932 3300042655 Bacteria 1266
52 Ga0466691_081016 3300042593 Bacteria 2642
53 Ga0466696_256939 3300042596 Bacteria 3537
54 Ga0466705_202815 3300042612 Bacteria 8591
55 Ga0466711_115209 3300042615 Bacteria 23755
56 Ga0466711_137697 3300042615 Bacteria 22907
57 Ga0466723_008382 3300042618 Bacteria 4662
58 Ga0466717_084057 3300042604 Bacteria 1341
59 Ga0466722_120548 3300042609 Bacteria 6323
60 Ga0466722_126902 3300042609 Bacteria 6085
61 JGI24698J34947_10039294 3300002449 Bacteria 2450
62 JGI24702J35022_10005530 3300002462 Bacteria 7367
63 JGI24702J35022_10174992 3300002462 Bacteria 1216
64 Ga0466735_003104 3300042624 Bacteria 5752
65 Ga0466708_163370 3300042652 Bacteria 6866
66 Ga0264413_113792 3300024493 Bacteria 3722
67 Ga0466690_026884 3300042590 Bacteria 2278
68 Ga0123357_10609711 3300009784 Bacteria 832
69 Ga0466705_211639 3300042612 Bacteria 2521
70 Ga0466711_110580 3300042615 Bacteria 17904
71 Ga0466715_465436 3300042616 Bacteria 4230
72 Ga0466726_013128 3300042619 Bacteria 7144
73 Ga0466717_093330 3300042604 Bacteria 1362
74 Ga0466719_314810 3300042606 Bacteria 8320
75 JGI24695J34938_10008763 3300002450 Bacteria 5729
76 Ga0466735_087808 3300042624 Bacteria 11134
77 Ga0466703_285998 3300042636 Bacteria 10527
78 Ga0466727_294889 3300042655 Bacteria 1469
79 Ga0123353_10359892 3300010167 Bacteria 2187
80 Ga0123353_11820334 3300010167 Bacteria 755
81 Ga0466728_296576 3300042620 Bacteria 10796
82 Ga0466716_181153 3300042605 Bacteria 5782
83 Ga0466719_028855 3300042606 Bacteria 31838
84 Ga0466698_207105 3300042610 Bacteria 1294
85 Ga0466708_407292 3300042652 Bacteria 7009
86 Ga0264413_108720 3300024493 Unclassified 4769
87 Ga0466691_210219 3300042593 Bacteria 1888
88 Ga0466694_167540 3300042594 Bacteria 3579
89 Ga0466696_174630 3300042596 Bacteria 2904
90 Ga0466696_381147 3300042596 Bacteria 5639
91 Ga0466696_506623 3300042596 Bacteria 3588
92 Ga0123353_11995624 3300010167 Unclassified 711
93 Ga0466705_136442 3300042612 Bacteria 3486
94 Ga0466726_098734 3300042619 Bacteria 2671
95 Ga0466707_134760 3300042601 Bacteria 2263
96 Ga0466707_364323 3300042601 Bacteria 1468
97 Ga0466720_116826 3300042607 Bacteria 2116
98 Ga0466720_150961 3300042607 Bacteria 3786
99 Ga0466722_239459 3300042609 Bacteria 1847
100 Ga0466708_042805 3300042652 Bacteria 2332
101 Ga0466696_182257 3300042596 Bacteria 1683

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042609 Ga0466722_011614 Ga0466722_011614_754_1308 167
2 3300042606 Ga0466719_314810 Ga0466719_314810_4891_5448 169
3 3300024493 Ga0264413_108720 Ga0264413_1087202 171
4 3300042624 Ga0466735_003104 Ga0466735_003104_4339_4860 173
5 3300042590 Ga0466690_121506 Ga0466690_121506_14_538 174
6 3300042607 Ga0466720_150961 Ga0466720_150961_1379_1936 175
7 3300042612 Ga0466705_401535 Ga0466705_401535_536_1114 175
8 3300042636 Ga0466703_079174 Ga0466703_079174_1786_2373 182
9 3300042652 Ga0466708_042805 Ga0466708_042805_1295_1843 182
10 3300000089 AustNasuHG_c1005807 AustNasuHG_10058073 183
11 3300042610 Ga0466698_207105 Ga0466698_207105_117_671 184
12 3300024493 Ga0264413_102773 Ga0264413_1027732 185
13 3300042601 Ga0466707_364323 Ga0466707_364323_246_803 185
14 3300042612 Ga0466705_202815 Ga0466705_202815_6977_7534 185
15 3300042615 Ga0466711_144440 Ga0466711_144440_7161_7718 185
16 3300042616 Ga0466715_465436 Ga0466715_465436_1104_1661 185
17 3300042616 Ga0466715_489952 Ga0466715_489952_1560_2117 185
18 3300042620 Ga0466728_296576 Ga0466728_296576_1328_1885 185
19 3300042655 Ga0466727_051219 Ga0466727_051219_630_1187 185
20 3300042604 Ga0466717_084057 Ga0466717_084057_582_1142 186
21 3300042612 Ga0466705_211639 Ga0466705_211639_534_1094 186
22 3300042636 Ga0466703_285998 Ga0466703_285998_618_1178 186
23 3300042636 Ga0466703_425252 Ga0466703_425252_463_1023 186
24 3300042643 Ga0466704_037583 Ga0466704_037583_4526_5086 186
25 iso_pr_bacteria 2781125629 2781263577 186
26 3300005200 Ga0072940_1101401 Ga0072940_11014012 187
27 3300042593 Ga0466691_210219 Ga0466691_210219_944_1507 187
28 3300042606 Ga0466719_198234 Ga0466719_198234_243_806 187
29 3300042609 Ga0466722_120548 Ga0466722_120548_4418_4981 187
30 3300042615 Ga0466711_110580 Ga0466711_110580_1483_2046 187
31 3300042615 Ga0466711_115209 Ga0466711_115209_2747_3310 187
32 3300042615 Ga0466711_137697 Ga0466711_137697_6146_6709 187
33 3300042616 Ga0466715_631551 Ga0466715_631551_465_1028 187
34 3300042619 Ga0466726_112974 Ga0466726_112974_219_782 187
35 3300042619 Ga0466726_379206 Ga0466726_379206_402_965 187
36 3300042655 Ga0466727_294889 Ga0466727_294889_383_946 187
37 3300002449 JGI24698J34947_10139120 JGI24698J34947_101391202 188
38 3300010049 Ga0123356_11085059 Ga0123356_110850592 188
39 3300042593 Ga0466691_081016 Ga0466691_081016_1333_1899 188
40 3300042594 Ga0466694_167540 Ga0466694_167540_779_1345 188
41 3300042596 Ga0466696_506623 Ga0466696_506623_2245_2811 188
42 3300042606 Ga0466719_065782 Ga0466719_065782_4263_4829 188
43 3300042612 Ga0466705_108036 Ga0466705_108036_242_808 188
44 3300042612 Ga0466705_264670 Ga0466705_264670_3643_4209 188
45 3300042615 Ga0466711_109868 Ga0466711_109868_4129_4695 188
46 3300042616 Ga0466715_089417 Ga0466715_089417_3481_4047 188
47 3300042618 Ga0466723_002059 Ga0466723_002059_3506_4072 188
48 3300042619 Ga0466726_098734 Ga0466726_098734_1199_1765 188
49 3300042643 Ga0466704_531644 Ga0466704_531644_3427_3993 188
50 3300042652 Ga0466708_076845 Ga0466708_076845_1326_1892 188
51 3300002449 JGI24698J34947_10039294 JGI24698J34947_100392942 189
52 3300042597 Ga0466699_061223 Ga0466699_061223_6428_6997 189
53 3300042597 Ga0466699_200335 Ga0466699_200335_1520_2089 189
54 3300042597 Ga0466699_212238 Ga0466699_212238_890_1459 189
55 3300042601 Ga0466707_134760 Ga0466707_134760_316_885 189
56 3300042606 Ga0466719_028855 Ga0466719_028855_29375_29962 189
57 3300042609 Ga0466722_239459 Ga0466722_239459_908_1477 189
58 3300042614 Ga0466712_086915 Ga0466712_086915_474_1043 189
59 iso_pr_bacteria 2781125697 2781442732 189
60 3300002462 JGI24702J35022_10005530 JGI24702J35022_100055306 190
61 3300010167 Ga0123353_11820334 Ga0123353_118203341 190
62 3300024493 Ga0264413_113792 Ga0264413_1137925 190
63 3300042593 Ga0466691_030035 Ga0466691_030035_12345_12917 190
64 3300042596 Ga0466696_256939 Ga0466696_256939_2735_3307 190
65 3300042607 Ga0466720_116826 Ga0466720_116826_598_1170 190
66 3300042609 Ga0466722_126902 Ga0466722_126902_804_1376 190
67 3300042619 Ga0466726_437730 Ga0466726_437730_358_930 190
68 3300042624 Ga0466735_087808 Ga0466735_087808_9111_9683 190
69 3300009784 Ga0123357_10609711 Ga0123357_106097112 191
70 3300010167 Ga0123353_10969126 Ga0123353_109691261 191
71 3300042590 Ga0466690_026884 Ga0466690_026884_1419_1994 191
72 3300042596 Ga0466696_174630 Ga0466696_174630_2268_2843 191
73 3300042596 Ga0466696_381147 Ga0466696_381147_1150_1725 191
74 3300042604 Ga0466717_093330 Ga0466717_093330_215_790 191
75 3300042614 Ga0466712_104687 Ga0466712_104687_3392_3967 191
76 3300042648 Ga0466709_369742 Ga0466709_369742_522_1097 191
77 3300042593 Ga0466691_123053 Ga0466691_123053_506_1084 192
78 3300042618 Ga0466723_008382 Ga0466723_008382_116_694 192
79 3300042618 Ga0466723_091625 Ga0466723_091625_11511_12089 192
80 3300042652 Ga0466708_163370 Ga0466708_163370_6256_6834 192
81 3300002450 JGI24695J34938_10008763 JGI24695J34938_100087632 193
82 3300042636 Ga0466703_296925 Ga0466703_296925_786_1367 193
83 3300042648 Ga0466709_015573 Ga0466709_015573_4812_5393 193
84 3300002449 JGI24698J34947_10048840 JGI24698J34947_100488402 194
85 3300010167 Ga0123353_11317301 Ga0123353_113173012 194
86 3300042614 Ga0466712_088292 Ga0466712_088292_6217_6804 195
87 3300002462 JGI24702J35022_10174992 JGI24702J35022_101749921 196
88 3300010167 Ga0123353_10359892 Ga0123353_103598922 196
89 3300042612 Ga0466705_102536 Ga0466705_102536_2592_3182 196
90 3300042643 Ga0466704_011229 Ga0466704_011229_343_933 196
91 3300042618 Ga0466723_278242 Ga0466723_278242_7099_7692 197
92 3300042655 Ga0466727_030932 Ga0466727_030932_444_1037 197
93 3300042612 Ga0466705_136442 Ga0466705_136442_145_741 198
94 3300042643 Ga0466704_091719 Ga0466704_091719_1568_2167 199
95 3300010167 Ga0123353_11995624 Ga0123353_119956241 201
96 3300042619 Ga0466726_013128 Ga0466726_013128_4865_5470 201
97 3300042612 Ga0466705_140924 Ga0466705_140924_1920_2528 202
98 3300042619 Ga0466726_456378 Ga0466726_456378_682_1293 203
99 3300042605 Ga0466716_181153 Ga0466716_181153_3715_4341 208
100 3300042659 Ga0466733_007578 Ga0466733_007578_185_814 209
101 3300042596 Ga0466696_182257 Ga0466696_182257_168_809 213
102 3300042652 Ga0466708_018857 Ga0466708_018857_150_794 214
103 3300042652 Ga0466708_407292 Ga0466708_407292_2875_3525 216

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00881 Nitroreductase Nitroreductase family 63 112 0.89
PF14512 TM1586_NiRdase Putative TM nitroreductase 74 107 0.8

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
7t33-assembly1.cif.gz_B The structure of Haemophilus influenzae Rd KW20 nitroreductase complexed with nicotinic acid 0.841 54 214
1zch-assembly1.cif.gz_A-2 Structure of the hypothetical oxidoreductase YcnD from Bacillus subtilis 0.834 51 214
3e39-assembly1.cif.gz_B Crystal structure of a putative nitroreductase in complex with fmn (dde_0787) from desulfovibrio desulfuricans subsp. at 1.70 A resolution 0.832 51 214
5hdj-assembly1.cif.gz_A Structure of B. megaterium NfrA1 0.832 52 214
5uu6-assembly1.cif.gz_B The crystal structure of nitroreductase A from Vibrio parahaemolyticus RIMD 2210633 0.83 51 213
IDDescriptionScoreStartEndSuperfamily
5heiD00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8475 51 212 3.40.109.10
af_Q2G0Z5_3_251_3.40.109.10 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8258 52 213 3.40.109.10
5j62B00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8224 51 197 3.40.109.10
3e39B00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8207 51 214 3.40.109.10
3n2sC00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.8181 52 213 3.40.109.10
IDDescriptionScoreStartEndGO Terms
AF-A0A1F8M792-F1-model_v4 Uncharacterized/unreviewed 0.8738 54 214
AF-A0A3M1YQ17-F1-model_v4 Uncharacterized/unreviewed 0.8652 47 194

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.71 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.