Protein Family IF09798
Metagenome
Isolate
166
Members
113
Samples
109
Scaffolds
433.01
Avg Length
Representative Sequence
- ID
- 3300042649|Ga0466724_56971|Ga0466724_56971_1352_2776
- Length
- 474 aa
- Sequence
- MTSSPSAAFAAHLIDVHGSADAQPVPEPHLQPLQFLQHLYRVAVRDALPLEGLRKHLPAAPKGRTLVIGAGKAGAAMAQAMEQLWPLDAPLSGLVVTRYGHIPPRPPGLARRIEVVEAAHPVPDAAGLLAAERMLALTEGLSADDLVVCLISGGGSALLTLPAEGLSLADKQRINRELLESGAHIGEMNCVRKHLSRIKGGRLGAACHPAQVVSLLISDVPGDSPAIIASGPTVPDPSSCADALAILERYAIAIPEPVRAALHSGALETPKPGDPRFAGHQVQLIATPQQSLQAAAAAARDAGIACHVLSDEIEGESREVAKVHAALARAVALHGQPFSRPCVILSGGETTVTLRKPAEGAARGRGGRAGEFCLGLAQALQAMPGVWALAADTDGIDGVEDNAGAVVTPDTLARAAALQLKPAAYQDRNDSYGFFGPLGDLVVTGPTHTNVNDFRALLILQPMDAPMKKAASSG
Sample Types
Isolate
34.3%
Metagenome
65.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Formicidae
14.3%
Coreidae
13.3%
Termitidae
12.4%
Curculionidae
10.5%
Unclassified
10.5%
Elmidae
10.5%
Culicidae
10.5%
Armadillidiidae
4.8%
Kalotermitidae
4.8%
Hydrophilidae
1.9%
Drosophilidae
1.0%
Termopsidae
1.0%
Passalidae
1.0%
Hodotermitidae
1.0%
Kiwaidae
1.0%
Alydidae
1.0%
Trigoniulidae
1.0%
Taxonomy
Archaea
0
Bacteria
138
Eukaryota
0
Viruses
0
Unclassified
28
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 2 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 3 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 4 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 5 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 6 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 7 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 8 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 9 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 10 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 11 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 12 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 15 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 16 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 17 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 18 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 19 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 20 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 21 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 22 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 23 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 24 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 25 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 26 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 27 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 28 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 29 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 30 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 31 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 32 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 33 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 34 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 35 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 36 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 37 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 38 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 39 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 40 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 41 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 42 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 43 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 44 | 2987233858 | Stutzerimonas stutzeri AR9-4 | Isolate | Unclassified |
| 45 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 46 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 47 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 48 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 49 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 50 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 51 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 52 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 53 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 54 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 55 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 56 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 57 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 58 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 59 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 60 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 61 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 62 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 63 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 64 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 65 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 66 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 67 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 68 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 69 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 70 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 71 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 72 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 73 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 74 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 75 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 76 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 77 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 78 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 79 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 80 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 81 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 82 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 83 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 84 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 85 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 86 | 2820148564 | Unclassified Proteobacteria Emb289P1bin36 | Isolate | Unclassified |
| 87 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 88 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 89 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 90 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 91 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 92 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 93 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 94 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
| 95 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 96 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 97 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 98 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 99 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 100 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 101 | 2820146621 | Unclassified Proteobacteria Emb289P3bin103 | Isolate | Unclassified |
| 102 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 103 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 104 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 105 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 106 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 107 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 108 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 109 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 110 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 111 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 112 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 113 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160470_103376 | 3300012813 | Unclassified | 2596 |
| 2 | Ga0160460_100307 | 3300012845 | Bacteria | 36044 |
| 3 | Ga0160433_100082 | 3300012846 | Bacteria | 100015 |
| 4 | Ga0157631_138358 | 3300013007 | Bacteria | 7844 |
| 5 | Ga0316159_10300 | 3300030930 | Bacteria | 13506 |
| 6 | Ga0466693_252764 | 3300042592 | Bacteria | 2018 |
| 7 | Ga0466710_457839 | 3300042613 | Bacteria | 13879 |
| 8 | Ga0466724_26494 | 3300042649 | Bacteria | 236200 |
| 9 | Ga0160465_104732 | 3300012803 | Bacteria | 1982 |
| 10 | SPBB_contig11573 | 2044078006 | Bacteria | 32242 |
| 11 | CVPL010W_10000214 | 3300002931 | Unclassified | 52916 |
| 12 | Ga0103263_100052 | 3300007042 | Bacteria | 26688 |
| 13 | Ga0102734_1000114 | 3300007129 | Bacteria | 26508 |
| 14 | Ga0102740_1000021 | 3300007140 | Bacteria | 55729 |
| 15 | Ga0103268_1000179 | 3300007192 | Unclassified | 35156 |
| 16 | Ga0160467_101695 | 3300012829 | Unclassified | 7266 |
| 17 | Ga0160460_101501 | 3300012845 | Unclassified | 7613 |
| 18 | Ga0160435_1005122 | 3300012857 | Unclassified | 2995 |
| 19 | Ga0466724_13715 | 3300042649 | Bacteria | 51736 |
| 20 | Ga0466724_14853 | 3300042649 | Bacteria | 20843 |
| 21 | Ga0466724_42462 | 3300042649 | Bacteria | 351483 |
| 22 | Ga0123355_10067104 | 3300009826 | Bacteria | 5774 |
| 23 | Ga0123356_10033564 | 3300010049 | Unclassified | 4799 |
| 24 | SPBB_contig00067 | 2044078006 | Bacteria | 90332 |
| 25 | Ga0103260_1000046 | 3300007139 | Bacteria | 36821 |
| 26 | Ga0102738_1000259 | 3300007141 | Bacteria | 10492 |
| 27 | Ga0160470_100856 | 3300012813 | Unclassified | 9050 |
| 28 | Ga0160459_100018 | 3300012831 | Bacteria | 386190 |
| 29 | Ga0160446_100734 | 3300012835 | Unclassified | 10569 |
| 30 | Ga0160472_100918 | 3300012839 | Unclassified | 11365 |
| 31 | Ga0160460_105435 | 3300012845 | Bacteria | 1831 |
| 32 | Ga0160443_101541 | 3300012848 | Unclassified | 7383 |
| 33 | Ga0466696_496433 | 3300042596 | Bacteria | 7289 |
| 34 | Ga0466724_25374 | 3300042649 | Bacteria | 80841 |
| 35 | Ga0123356_10028490 | 3300010049 | Bacteria | 5233 |
| 36 | Ga0160465_100683 | 3300012803 | Unclassified | 13467 |
| 37 | Ga0160442_103739 | 3300012806 | Unclassified | 1583 |
| 38 | Ga0466706_066430 | 3300042599 | Bacteria | 19494 |
| 39 | Ga0102739_1000041 | 3300007095 | Bacteria | 36435 |
| 40 | Ga0102740_1000721 | 3300007140 | Bacteria | 8940 |
| 41 | Ga0160452_101467 | 3300012834 | Bacteria | 6709 |
| 42 | Ga0160446_103711 | 3300012835 | Bacteria | 2364 |
| 43 | Ga0160447_102122 | 3300012849 | Unclassified | 7200 |
| 44 | Ga0466657_146344 | 3300042582 | Bacteria | 19012 |
| 45 | Ga0466730_050878 | 3300042625 | Bacteria | 31540 |
| 46 | Ga0466703_167760 | 3300042636 | Bacteria | 3543 |
| 47 | Ga0466724_25034 | 3300042649 | Bacteria | 837337 |
| 48 | Ga0466724_56971 | 3300042649 | Bacteria | 3334 |
| 49 | Ga0123354_10067571 | 3300010882 | Bacteria | 5205 |
| 50 | Ga0160442_100142 | 3300012806 | Bacteria | 69485 |
| 51 | Ga0466701_050491 | 3300042598 | Unclassified | 2460 |
| 52 | Ga0466701_098710 | 3300042598 | Bacteria | 149797 |
| 53 | DPO_contig06928 | 2032320009 | Unclassified | 6757 |
| 54 | DPOL_contig14923 | 2035918003 | Unclassified | 13493 |
| 55 | CVPL010W_10005153 | 3300002931 | Bacteria | 14123 |
| 56 | Ga0103263_103876 | 3300007042 | Bacteria | 1763 |
| 57 | Ga0102738_1000151 | 3300007141 | Bacteria | 18779 |
| 58 | Ga0103264_1002096 | 3300007188 | Bacteria | 9148 |
| 59 | Ga0466730_038558 | 3300042625 | Bacteria | 566435 |
| 60 | Ga0466725_242990 | 3300042654 | Bacteria | 15174 |
| 61 | Ga0102736_1000002 | 3300007052 | Bacteria | 204958 |
| 62 | Ga0103266_1000634 | 3300007067 | Unclassified | 6919 |
| 63 | Ga0160453_100963 | 3300012814 | Unclassified | 13468 |
| 64 | Ga0160469_100731 | 3300012824 | Unclassified | 12264 |
| 65 | Ga0160441_101074 | 3300012825 | Unclassified | 11151 |
| 66 | Ga0160459_104652 | 3300012831 | Bacteria | 1843 |
| 67 | Ga0160447_100030 | 3300012849 | Bacteria | 210871 |
| 68 | Ga0160447_104699 | 3300012849 | Unclassified | 3980 |
| 69 | Ga0466657_085391 | 3300042582 | Bacteria | 3047 |
| 70 | Ga0466711_424872 | 3300042615 | Bacteria | 5633 |
| 71 | Ga0466734_041225 | 3300042623 | Bacteria | 32984 |
| 72 | Ga0466709_060562 | 3300042648 | Bacteria | 9098 |
| 73 | Ga0466724_01086 | 3300042649 | Bacteria | 97579 |
| 74 | Ga0466724_46819 | 3300042649 | Bacteria | 306737 |
| 75 | Ga0123356_10178867 | 3300010049 | Bacteria | 2141 |
| 76 | Ga0160471_100066 | 3300012812 | Bacteria | 105379 |
| 77 | Ga0466701_047715 | 3300042598 | Bacteria | 95995 |
| 78 | DPO_contig00870 | 2032320009 | Unclassified | 20000 |
| 79 | IMNBGM34_c000090 | 3300000036 | Bacteria | 26347 |
| 80 | CVPL010W_10011775 | 3300002931 | Bacteria | 7175 |
| 81 | Ga0102737_1000050 | 3300007142 | Bacteria | 71117 |
| 82 | Ga0160469_100197 | 3300012824 | Bacteria | 54015 |
| 83 | Ga0160446_100084 | 3300012835 | Bacteria | 90262 |
| 84 | Ga0160455_100570 | 3300012837 | Unclassified | 16731 |
| 85 | Ga0466693_078403 | 3300042592 | Bacteria | 3213 |
| 86 | Ga0466704_238791 | 3300042643 | Bacteria | 33459 |
| 87 | Ga0160454_101703 | 3300012798 | Bacteria | 2994 |
| 88 | Ga0160470_100054 | 3300012813 | Bacteria | 167369 |
| 89 | Ga0466701_036390 | 3300042598 | Bacteria | 174320 |
| 90 | Ga0466721_172668 | 3300042608 | Bacteria | 2015 |
| 91 | Ga0102739_1001278 | 3300007095 | Unclassified | 4236 |
| 92 | Ga0105005_1280568 | 3300007505 | Unclassified | 2033 |
| 93 | Ga0160458_102251 | 3300012832 | Bacteria | 2700 |
| 94 | Ga0160447_102717 | 3300012849 | Unclassified | 6043 |
| 95 | Ga0160435_1000906 | 3300012857 | Bacteria | 8029 |
| 96 | Ga0466693_405835 | 3300042592 | Bacteria | 1896 |
| 97 | Ga0466694_168655 | 3300042594 | Bacteria | 2813 |
| 98 | Ga0466710_133811 | 3300042613 | Bacteria | 10772 |
| 99 | Ga0466726_365681 | 3300042619 | Bacteria | 1714 |
| 100 | Ga0466730_062339 | 3300042625 | Bacteria | 155913 |
| 101 | Ga0466725_033152 | 3300042654 | Bacteria | 8188 |
| 102 | Ga0123355_10020159 | 3300009826 | Bacteria | 10638 |
| 103 | Ga0123356_10163197 | 3300010049 | Unclassified | 2229 |
| 104 | Ga0160442_100006 | 3300012806 | Bacteria | 536179 |
| 105 | Ga0466701_041263 | 3300042598 | Bacteria | 158002 |
| 106 | Ga0466701_051910 | 3300042598 | Bacteria | 58590 |
| 107 | Meta3P_1003806 | 3300002464 | Bacteria | 16599 |
| 108 | Ga0103264_1005734 | 3300007188 | Bacteria | 13602 |
| 109 | Ga0103267_1000111 | 3300007190 | Bacteria | 50521 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300012813 | Ga0160470_103376 | Ga0160470_1033762 | 357 |
| 2 | 3300042636 | Ga0466703_167760 | Ga0466703_167760_13_1140 | 366 |
| 3 | 3300007190 | Ga0103267_1000111 | Ga0103267_100011118 | 383 |
| 4 | 3300010049 | Ga0123356_10163197 | Ga0123356_101631972 | 386 |
| 5 | 3300042594 | Ga0466694_168655 | Ga0466694_168655_35_1216 | 393 |
| 6 | 3300010882 | Ga0123354_10067571 | Ga0123354_100675712 | 398 |
| 7 | 3300030930 | Ga0316159_10300 | Ga0316159_103007 | 400 |
| 8 | 3300012849 | Ga0160447_100030 | Ga0160447_10003058 | 404 |
| 9 | 3300042615 | Ga0466711_424872 | Ga0466711_424872_3197_4465 | 404 |
| 10 | 3300012831 | Ga0160459_104652 | Ga0160459_1046521 | 409 |
| 11 | 3300042619 | Ga0466726_365681 | Ga0466726_365681_105_1388 | 409 |
| 12 | 3300042596 | Ga0466696_496433 | Ga0466696_496433_4587_5819 | 410 |
| 13 | iso_pr_bacteria | 2556921622 | 2558101119 | 413 |
| 14 | 3300042592 | Ga0466693_078403 | Ga0466693_078403_1574_2926 | 415 |
| 15 | 3300042582 | Ga0466657_146344 | Ga0466657_146344_3629_4882 | 417 |
| 16 | 3300010049 | Ga0123356_10028490 | Ga0123356_100284902 | 420 |
| 17 | 3300042613 | Ga0466710_457839 | Ga0466710_457839_5476_6807 | 421 |
| 18 | iso_pr_bacteria | 2864903489 | 2864904807 | 421 |
| 19 | iso_pr_bacteria | 2864937364 | 2864941339 | 421 |
| 20 | 3300042625 | Ga0466730_050878 | Ga0466730_050878_22759_24027 | 422 |
| 21 | 3300007188 | Ga0103264_1002096 | Ga0103264_100209611 | 423 |
| 22 | 3300012845 | Ga0160460_100307 | Ga0160460_1003073 | 423 |
| 23 | 3300013007 | Ga0157631_138358 | Ga0157631_1383586 | 423 |
| 24 | 3300042599 | Ga0466706_066430 | Ga0466706_066430_3502_4773 | 423 |
| 25 | 3300042643 | Ga0466704_238791 | Ga0466704_238791_9055_10326 | 423 |
| 26 | iso_pr_bacteria | 2864926767 | 2864933083 | 423 |
| 27 | iso_pr_bacteria | 2987233858 | 2987235673 | 423 |
| 28 | 3300042598 | Ga0466701_041263 | Ga0466701_041263_26573_27847 | 424 |
| 29 | 3300042649 | Ga0466724_13715 | Ga0466724_13715_32010_33284 | 424 |
| 30 | 3300042649 | Ga0466724_25374 | Ga0466724_25374_34188_35462 | 424 |
| 31 | iso_pr_bacteria | 2864847319 | 2864849763 | 424 |
| 32 | iso_pr_bacteria | 2864937364 | 2864939841 | 424 |
| 33 | iso_pr_bacteria | 3007473699 | 3007475812 | 424 |
| 34 | iso_pr_bacteria | 3007478678 | 3007481272 | 424 |
| 35 | iso_pr_bacteria | 637000219 | 638000715 | 424 |
| 36 | iso_pr_bacteria | 8011329375 | 8011334683 | 424 |
| 37 | iso_pr_bacteria | 8011357093 | 8011361272 | 424 |
| 38 | iso_pr_bacteria | 8035422605 | 8035426350 | 424 |
| 39 | iso_pr_bacteria | 8052469819 | 8052473393 | 424 |
| 40 | 3300009826 | Ga0123355_10067104 | Ga0123355_100671042 | 425 |
| 41 | 3300012803 | Ga0160465_100683 | Ga0160465_1006839 | 425 |
| 42 | 3300012814 | Ga0160453_100963 | Ga0160453_1009639 | 425 |
| 43 | 3300012824 | Ga0160469_100731 | Ga0160469_1007313 | 425 |
| 44 | 3300012825 | Ga0160441_101074 | Ga0160441_1010749 | 425 |
| 45 | 3300012837 | Ga0160455_100570 | Ga0160455_10057020 | 425 |
| 46 | 3300012839 | Ga0160472_100918 | Ga0160472_10091812 | 425 |
| 47 | 3300012845 | Ga0160460_101501 | Ga0160460_1015012 | 425 |
| 48 | 3300012846 | Ga0160433_100082 | Ga0160433_10008261 | 425 |
| 49 | iso_pr_bacteria | 2599185261 | 2599817478 | 425 |
| 50 | 2032320009 | DPO_contig00870 | DPOB_423730 | 426 |
| 51 | 2032320009 | DPO_contig06928 | DPOB_325160 | 426 |
| 52 | 2044078006 | SPBB_contig00067 | SPBB_837830 | 426 |
| 53 | 2044078006 | SPBB_contig11573 | SPBB_479450 | 426 |
| 54 | 3300042598 | Ga0466701_036390 | Ga0466701_036390_79694_80974 | 426 |
| 55 | iso_pr_bacteria | 2820146621 | 2820147263 | 426 |
| 56 | iso_pr_bacteria | 2820148564 | 2820148693 | 426 |
| 57 | iso_pr_bacteria | 2864745180 | 2864748010 | 426 |
| 58 | iso_pr_bacteria | 2864755708 | 2864759082 | 426 |
| 59 | iso_pr_bacteria | 2864853652 | 2864857497 | 426 |
| 60 | iso_pr_bacteria | 8035321120 | 8035323263 | 426 |
| 61 | iso_pr_bacteria | 8035326735 | 8035328366 | 426 |
| 62 | 3300007141 | Ga0102738_1000259 | Ga0102738_10002598 | 427 |
| 63 | 3300007505 | Ga0105005_1280568 | Ga0105005_12805681 | 427 |
| 64 | 3300009826 | Ga0123355_10020159 | Ga0123355_100201593 | 427 |
| 65 | 3300010049 | Ga0123356_10033564 | Ga0123356_100335643 | 427 |
| 66 | 3300012806 | Ga0160442_100142 | Ga0160442_10014270 | 427 |
| 67 | 3300012806 | Ga0160442_103739 | Ga0160442_1037391 | 427 |
| 68 | 3300012829 | Ga0160467_101695 | Ga0160467_1016955 | 427 |
| 69 | 3300012834 | Ga0160452_101467 | Ga0160452_1014674 | 427 |
| 70 | 3300012835 | Ga0160446_100084 | Ga0160446_10008474 | 427 |
| 71 | 3300012848 | Ga0160443_101541 | Ga0160443_1015414 | 427 |
| 72 | iso_pr_bacteria | 2963630348 | 2963630785 | 427 |
| 73 | iso_pr_bacteria | 2518285616 | 2518643171 | 428 |
| 74 | 3300007140 | Ga0102740_1000721 | Ga0102740_10007217 | 429 |
| 75 | 3300012832 | Ga0160458_102251 | Ga0160458_1022512 | 430 |
| 76 | 3300042648 | Ga0466709_060562 | Ga0466709_060562_1341_2699 | 430 |
| 77 | 3300042649 | Ga0466724_14853 | Ga0466724_14853_1543_2877 | 430 |
| 78 | iso_pr_bacteria | 2873571580 | 2873574152 | 430 |
| 79 | 2035918003 | DPOL_contig14923 | DPOLB_350420 | 431 |
| 80 | 3300002931 | CVPL010W_10011775 | CVPL010W_100117752 | 431 |
| 81 | 3300012824 | Ga0160469_100197 | Ga0160469_10019713 | 431 |
| 82 | 3300012835 | Ga0160446_103711 | Ga0160446_1037112 | 431 |
| 83 | 3300042623 | Ga0466734_041225 | Ga0466734_041225_10800_12152 | 431 |
| 84 | iso_pr_bacteria | 2519899622 | 2520387784 | 431 |
| 85 | 3300002464 | Meta3P_1003806 | Meta3P_100380617 | 432 |
| 86 | 3300042649 | Ga0466724_26494 | Ga0466724_26494_112902_114200 | 432 |
| 87 | iso_pr_bacteria | 2600255074 | 2600846768 | 432 |
| 88 | iso_pr_bacteria | 2873571580 | 2873575202 | 432 |
| 89 | 3300007188 | Ga0103264_1005734 | Ga0103264_10057347 | 433 |
| 90 | iso_pr_bacteria | 2873565274 | 2873570412 | 433 |
| 91 | 3300010049 | Ga0123356_10178867 | Ga0123356_101788672 | 435 |
| 92 | 3300012845 | Ga0160460_105435 | Ga0160460_1054351 | 436 |
| 93 | 3300042649 | Ga0466724_01086 | Ga0466724_01086_82645_83955 | 436 |
| 94 | 3300042649 | Ga0466724_46819 | Ga0466724_46819_302123_303433 | 436 |
| 95 | iso_pr_bacteria | 2912636047 | 2912640447 | 436 |
| 96 | iso_pr_bacteria | 8022116796 | 8022118270 | 436 |
| 97 | iso_pr_bacteria | 8022345672 | 8022346548 | 436 |
| 98 | 3300012849 | Ga0160447_104699 | Ga0160447_1046992 | 437 |
| 99 | 3300012857 | Ga0160435_1005122 | Ga0160435_10051222 | 437 |
| 100 | 3300042582 | Ga0466657_085391 | Ga0466657_085391_129_1442 | 437 |
| 101 | iso_pr_bacteria | 8101951471 | 8101958326 | 437 |
| 102 | iso_pr_bacteria | 8101960468 | 8101967316 | 437 |
| 103 | iso_pr_bacteria | 8101967387 | 8101974233 | 437 |
| 104 | iso_pr_bacteria | 8101974301 | 8101981534 | 437 |
| 105 | iso_pr_bacteria | 8102312426 | 8102319648 | 437 |
| 106 | 3300042649 | Ga0466724_42462 | Ga0466724_42462_267514_268875 | 438 |
| 107 | 3300012806 | Ga0160442_100006 | Ga0160442_100006134 | 439 |
| 108 | 3300012813 | Ga0160470_100856 | Ga0160470_1008569 | 439 |
| 109 | 3300002931 | CVPL010W_10005153 | CVPL010W_1000515311 | 440 |
| 110 | 3300007067 | Ga0103266_1000634 | Ga0103266_10006346 | 440 |
| 111 | 3300042598 | Ga0466701_051910 | Ga0466701_051910_32827_34149 | 440 |
| 112 | 3300042625 | Ga0466730_038558 | Ga0466730_038558_533790_535112 | 440 |
| 113 | iso_pr_bacteria | 2868169047 | 2868170989 | 440 |
| 114 | iso_pr_bacteria | 8100449422 | 8100455200 | 440 |
| 115 | iso_pr_bacteria | 8100455565 | 8100455915 | 440 |
| 116 | iso_pr_bacteria | 8100461708 | 8100467296 | 440 |
| 117 | 3300007095 | Ga0102739_1001278 | Ga0102739_10012782 | 441 |
| 118 | 3300007192 | Ga0103268_1000179 | Ga0103268_100017920 | 441 |
| 119 | 3300042592 | Ga0466693_252764 | Ga0466693_252764_461_1786 | 441 |
| 120 | 3300042598 | Ga0466701_047715 | Ga0466701_047715_66297_67622 | 441 |
| 121 | 3300000036 | IMNBGM34_c000090 | IMNBGM34_00009020 | 443 |
| 122 | iso_pr_bacteria | 8024031916 | 8024034987 | 443 |
| 123 | 3300012812 | Ga0160471_100066 | Ga0160471_10006643 | 444 |
| 124 | 3300012835 | Ga0160446_100734 | Ga0160446_1007349 | 444 |
| 125 | 3300042654 | Ga0466725_033152 | Ga0466725_033152_5854_7188 | 444 |
| 126 | iso_pr_bacteria | 2864870719 | 2864874070 | 444 |
| 127 | iso_pr_bacteria | 2864960361 | 2864963719 | 444 |
| 128 | 3300012798 | Ga0160454_101703 | Ga0160454_1017032 | 445 |
| 129 | iso_pr_bacteria | 8025650824 | 8025654296 | 446 |
| 130 | iso_pr_bacteria | 8025678175 | 8025682120 | 446 |
| 131 | iso_pr_bacteria | 8025685901 | 8025690915 | 446 |
| 132 | iso_pr_bacteria | 8025694439 | 8025697857 | 446 |
| 133 | iso_pr_bacteria | 8102109360 | 8102115750 | 446 |
| 134 | iso_pr_bacteria | 8102208438 | 8102211910 | 446 |
| 135 | iso_pr_bacteria | 8102216467 | 8102219885 | 446 |
| 136 | iso_pr_bacteria | 8102230706 | 8102235720 | 446 |
| 137 | iso_pr_bacteria | 8102239244 | 8102243187 | 446 |
| 138 | 3300012813 | Ga0160470_100054 | Ga0160470_10005425 | 447 |
| 139 | 3300012849 | Ga0160447_102717 | Ga0160447_1027173 | 447 |
| 140 | iso_pr_bacteria | 2864937364 | 2864939478 | 447 |
| 141 | 3300042654 | Ga0466725_242990 | Ga0466725_242990_13707_15053 | 448 |
| 142 | 3300042598 | Ga0466701_098710 | Ga0466701_098710_133025_134377 | 450 |
| 143 | 3300042625 | Ga0466730_062339 | Ga0466730_062339_137912_139264 | 450 |
| 144 | 3300042649 | Ga0466724_25034 | Ga0466724_25034_225388_226740 | 450 |
| 145 | 3300007095 | Ga0102739_1000041 | Ga0102739_100004118 | 451 |
| 146 | 3300012803 | Ga0160465_104732 | Ga0160465_1047322 | 452 |
| 147 | 3300012831 | Ga0160459_100018 | Ga0160459_100018192 | 452 |
| 148 | 3300012849 | Ga0160447_102122 | Ga0160447_1021226 | 452 |
| 149 | 3300012857 | Ga0160435_1000906 | Ga0160435_10009063 | 453 |
| 150 | iso_pr_bacteria | 2873571580 | 2873575317 | 453 |
| 151 | iso_pr_bacteria | 2864826666 | 2864828869 | 454 |
| 152 | iso_pr_bacteria | 2873565274 | 2873568514 | 456 |
| 153 | 3300002931 | CVPL010W_10000214 | CVPL010W_1000021434 | 458 |
| 154 | 3300007042 | Ga0103263_100052 | Ga0103263_10005225 | 458 |
| 155 | 3300007052 | Ga0102736_1000002 | Ga0102736_100000236 | 458 |
| 156 | 3300007141 | Ga0102738_1000151 | Ga0102738_10001514 | 458 |
| 157 | 3300007142 | Ga0102737_1000050 | Ga0102737_100005069 | 458 |
| 158 | 3300042613 | Ga0466710_133811 | Ga0466710_133811_4496_5872 | 458 |
| 159 | 3300042608 | Ga0466721_172668 | Ga0466721_172668_441_1823 | 460 |
| 160 | 3300007129 | Ga0102734_1000114 | Ga0102734_100011423 | 462 |
| 161 | 3300007139 | Ga0103260_1000046 | Ga0103260_10000464 | 463 |
| 162 | 3300007140 | Ga0102740_1000021 | Ga0102740_100002141 | 463 |
| 163 | 3300042592 | Ga0466693_405835 | Ga0466693_405835_142_1536 | 464 |
| 164 | 3300007042 | Ga0103263_103876 | Ga0103263_1038761 | 465 |
| 165 | 3300042598 | Ga0466701_050491 | Ga0466701_050491_571_1989 | 472 |
| 166 | 3300042649 | Ga0466724_56971 | Ga0466724_56971_1352_2776 | 474 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.89 | 0.91 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.