Protein Family IF09784
Metagenome
Isolate
164
Members
105
Samples
125
Scaffolds
207.27
Avg Length
Representative Sequence
- ID
- 3300042649|Ga0466724_51285|Ga0466724_51285_2263_2970
- Length
- 235 aa
- Sequence
- MTRILPKTIRQIEHIIIYLLPLQTQILTMSNQVPEDGTQLPLMEEFYTIQGEGYHTGTAAYFIRLGGCDVGCHWCDVKESWDASIHPLTAADSIIENAKKYPAKTVVITGGEPLIYNLDYLTKGLHAAGIKTFIETSGAYPLSGEWDWICLSPKKFKAPRKDVLDAAGELKVIVFNKSDFAWGEEYAQLVGPDCRLYLQPEWSKSKEMTPSIIDYVKENPKWDISLQTHKFLNIP
Sample Types
Isolate
23.8%
Metagenome
76.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
15.2%
Elmidae
10.9%
Formicidae
10.9%
Termitidae
10.9%
Culicidae
9.8%
Drosophilidae
7.6%
Armadillidiidae
7.6%
Apidae
6.5%
Unclassified
4.3%
Passalidae
3.3%
Daphniidae
2.2%
Termopsidae
2.2%
Cambaridae
2.2%
Hydrophilidae
1.1%
Nephropidae
1.1%
Bombycidae
1.1%
Kiwaidae
1.1%
Tenebrionidae
1.1%
Rhinotermitidae
1.1%
Taxonomy
Archaea
0
Bacteria
155
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 2 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 3 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 4 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 5 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 6 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 7 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 8 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 9 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 13 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 16 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 17 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 18 | 2832343623 | Apibacter adventoris wkB180 | Isolate | Apidae |
| 19 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 20 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 21 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 22 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 23 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 24 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 25 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 26 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 27 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 28 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 29 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 30 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 31 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 32 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 35 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 36 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 37 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 38 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 39 | 2832372155 | Apibacter adventoris wkB301 | Isolate | Apidae |
| 40 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 41 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 42 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 43 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 44 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 45 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 46 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 47 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 48 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 49 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 50 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 51 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 52 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 53 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 54 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 55 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 56 | 3300005307 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut | Metagenome | Drosophilidae |
| 57 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 58 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 59 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 60 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 61 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 62 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 63 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 64 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 65 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 66 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 67 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 68 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 69 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 70 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 71 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 72 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 73 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 74 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 75 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 76 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 77 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 78 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 79 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 80 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 81 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 82 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 83 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 84 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 85 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 86 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 87 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 88 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 89 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 90 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 91 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 92 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 93 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 94 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 95 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
| 96 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 97 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 98 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 99 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 100 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 101 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 102 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 103 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 104 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 105 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10214050 | 3300010049 | Bacteria | 1978 |
| 2 | Ga0466723_088817 | 3300042618 | Bacteria | 2061 |
| 3 | Ga0160432_100004 | 3300012818 | Bacteria | 604772 |
| 4 | Ga0160452_110619 | 3300012834 | Bacteria | 1118 |
| 5 | Ga0160472_100024 | 3300012839 | Bacteria | 325454 |
| 6 | Ga0160433_101666 | 3300012846 | Bacteria | 5725 |
| 7 | Ga0160457_1001545 | 3300012858 | Bacteria | 6193 |
| 8 | Ga0466691_080894 | 3300042593 | Bacteria | 8459 |
| 9 | Ga0466701_014254 | 3300042598 | Bacteria | 1445 |
| 10 | Ga0466730_039992 | 3300042625 | Bacteria | 1355215 |
| 11 | Ga0466725_284756 | 3300042654 | Bacteria | 27984 |
| 12 | IMNBGM34_c006864 | 3300000036 | Bacteria | 1471 |
| 13 | Meta3P_1005494 | 3300002464 | Bacteria | 9262 |
| 14 | Ga0102734_1000590 | 3300007129 | Bacteria | 10127 |
| 15 | Ga0103267_1007680 | 3300007190 | Bacteria | 3148 |
| 16 | Ga0105005_1020652 | 3300007505 | Bacteria | 2332 |
| 17 | Ga0466705_168389 | 3300042612 | Bacteria | 2226 |
| 18 | Ga0466723_227268 | 3300042618 | Bacteria | 8623 |
| 19 | Ga0466723_326767 | 3300042618 | Bacteria | 7130 |
| 20 | Ga0466726_474980 | 3300042619 | Bacteria | 4556 |
| 21 | Ga0466728_085034 | 3300042620 | Bacteria | 9498 |
| 22 | Ga0466734_134432 | 3300042623 | Bacteria | 2702 |
| 23 | Ga0466703_048361 | 3300042636 | Bacteria | 8077 |
| 24 | Ga0466724_38523 | 3300042649 | Bacteria | 121795 |
| 25 | Ga0466701_030911 | 3300042598 | Bacteria | 23075 |
| 26 | Ga0102735_1000103 | 3300007080 | Bacteria | 22156 |
| 27 | Ga0104045_1005764 | 3300007085 | Bacteria | 20363 |
| 28 | Ga0102739_1000129 | 3300007095 | Bacteria | 21218 |
| 29 | Ga0104050_1204752 | 3300007153 | Bacteria | 1328 |
| 30 | Ga0160465_100198 | 3300012803 | Bacteria | 48589 |
| 31 | Ga0466711_175803 | 3300042615 | Bacteria | 25847 |
| 32 | Ga0466715_183450 | 3300042616 | Bacteria | 7562 |
| 33 | Ga0160469_100850 | 3300012824 | Bacteria | 10546 |
| 34 | Ga0160458_100021 | 3300012832 | Bacteria | 258610 |
| 35 | Ga0160452_102211 | 3300012834 | Bacteria | 4365 |
| 36 | Ga0160460_100151 | 3300012845 | Bacteria | 78148 |
| 37 | Ga0160443_107794 | 3300012848 | Bacteria | 1313 |
| 38 | Ga0466691_089458 | 3300042593 | Bacteria | 3701 |
| 39 | Ga0466734_126311 | 3300042623 | Bacteria | 1574 |
| 40 | Ga0466724_46543 | 3300042649 | Bacteria | 311178 |
| 41 | Ga0466725_120047 | 3300042654 | Bacteria | 1211 |
| 42 | Ga0466701_031730 | 3300042598 | Bacteria | 202867 |
| 43 | Ga0466701_064616 | 3300042598 | Bacteria | 2750 |
| 44 | Ga0466719_377988 | 3300042606 | Bacteria | 6332 |
| 45 | Ga0466722_057000 | 3300042609 | Bacteria | 1394 |
| 46 | Ga0068302_10222894 | 3300005071 | Bacteria | 776 |
| 47 | Ga0102734_1000781 | 3300007129 | Bacteria | 16428 |
| 48 | Ga0102740_1001031 | 3300007140 | Bacteria | 7336 |
| 49 | Ga0104050_1000445 | 3300007153 | Bacteria | 3519 |
| 50 | Ga0466723_029341 | 3300042618 | Bacteria | 7756 |
| 51 | Ga0160455_100001 | 3300012837 | Bacteria | 1265300 |
| 52 | Ga0157631_135381 | 3300013007 | Bacteria | 3434 |
| 53 | Ga0466690_341355 | 3300042590 | Bacteria | 23370 |
| 54 | Ga0466724_45139 | 3300042649 | Bacteria | 8878 |
| 55 | Ga0466708_418672 | 3300042652 | Bacteria | 17523 |
| 56 | Ga0466719_479919 | 3300042606 | Bacteria | 1029 |
| 57 | Ga0466722_120146 | 3300042609 | Bacteria | 1489 |
| 58 | CVPL010W_10004528 | 3300002931 | Bacteria | 15396 |
| 59 | Ga0102740_1001327 | 3300007140 | Bacteria | 6339 |
| 60 | Ga0104048_1001745 | 3300007143 | Bacteria | 4315 |
| 61 | Ga0104048_1026929 | 3300007143 | Unclassified | 5526 |
| 62 | Ga0104050_1003258 | 3300007153 | Bacteria | 3833 |
| 63 | Ga0103267_1020227 | 3300007190 | Bacteria | 2177 |
| 64 | Ga0466710_068333 | 3300042613 | Bacteria | 4105 |
| 65 | Ga0466711_109554 | 3300042615 | Bacteria | 6873 |
| 66 | Ga0160433_100070 | 3300012846 | Bacteria | 109420 |
| 67 | Ga0466657_365935 | 3300042582 | Bacteria | 4623 |
| 68 | Ga0466724_51285 | 3300042649 | Bacteria | 6629 |
| 69 | Ga0466701_016596 | 3300042598 | Unclassified | 46491 |
| 70 | Ga0466722_138946 | 3300042609 | Bacteria | 3928 |
| 71 | HBC_ctgsDRAFT_1003355 | 3300000333 | Bacteria | 3673 |
| 72 | CVPL010W_10002346 | 3300002931 | Bacteria | 25428 |
| 73 | Ga0074308_1018195 | 3300005307 | Bacteria | 5350 |
| 74 | Ga0103263_100893 | 3300007042 | Unclassified | 3990 |
| 75 | Ga0102735_1000659 | 3300007080 | Bacteria | 7333 |
| 76 | Ga0104048_1003767 | 3300007143 | Bacteria | 2601 |
| 77 | Ga0104048_1024708 | 3300007143 | Bacteria | 3357 |
| 78 | Ga0104048_1168543 | 3300007143 | Bacteria | 4000 |
| 79 | Ga0104050_1026947 | 3300007153 | Unclassified | 2469 |
| 80 | Ga0160460_107319 | 3300012845 | Unclassified | 1461 |
| 81 | Ga0160445_100402 | 3300012847 | Bacteria | 23842 |
| 82 | Ga0160445_106827 | 3300012847 | Unclassified | 1839 |
| 83 | Ga0160434_100110 | 3300012850 | Bacteria | 47210 |
| 84 | Ga0466690_025734 | 3300042590 | Bacteria | 11601 |
| 85 | Ga0466690_191290 | 3300042590 | Bacteria | 2838 |
| 86 | Ga0466694_089319 | 3300042594 | Bacteria | 2423 |
| 87 | Ga0466701_007176 | 3300042598 | Bacteria | 9921 |
| 88 | Ga0466704_155159 | 3300042643 | Bacteria | 10115 |
| 89 | Ga0466724_40582 | 3300042649 | Unclassified | 1850 |
| 90 | Ga0466708_029339 | 3300042652 | Bacteria | 20997 |
| 91 | Ga0466716_155295 | 3300042605 | Bacteria | 7938 |
| 92 | Ga0466719_561104 | 3300042606 | Bacteria | 1536 |
| 93 | Ga0072941_1031664 | 3300005201 | Bacteria | 4762 |
| 94 | Ga0103268_1000083 | 3300007192 | Bacteria | 29500 |
| 95 | Ga0466733_077254 | 3300042659 | Bacteria | 26018 |
| 96 | Ga0160454_100012 | 3300012798 | Bacteria | 390121 |
| 97 | Ga0466715_122298 | 3300042616 | Bacteria | 9543 |
| 98 | Ga0160467_100091 | 3300012829 | Bacteria | 133372 |
| 99 | Ga0160458_100038 | 3300012832 | Bacteria | 185944 |
| 100 | Ga0466696_146459 | 3300042596 | Bacteria | 9428 |
| 101 | Ga0466730_103185 | 3300042625 | Bacteria | 215676 |
| 102 | Ga0466709_101317 | 3300042648 | Bacteria | 5608 |
| 103 | Ga0466708_008911 | 3300042652 | Bacteria | 13055 |
| 104 | IMNBGM34_c001743 | 3300000036 | Bacteria | 3482 |
| 105 | Ga0104041_1001120 | 3300007106 | Bacteria | 2708 |
| 106 | Ga0466705_049460 | 3300042612 | Bacteria | 7947 |
| 107 | Ga0466723_027644 | 3300042618 | Bacteria | 14041 |
| 108 | Ga0466726_138996 | 3300042619 | Unclassified | 1052 |
| 109 | Ga0466726_465489 | 3300042619 | Bacteria | 28018 |
| 110 | Ga0160431_108323 | 3300012828 | Bacteria | 1417 |
| 111 | Ga0160433_100025 | 3300012846 | Bacteria | 185749 |
| 112 | Ga0160457_1000001 | 3300012858 | Bacteria | 1192173 |
| 113 | Ga0466703_131105 | 3300042636 | Bacteria | 29788 |
| 114 | Ga0466724_59158 | 3300042649 | Bacteria | 434991 |
| 115 | Ga0466708_170875 | 3300042652 | Bacteria | 19923 |
| 116 | Ga0466719_241574 | 3300042606 | Bacteria | 2489 |
| 117 | Ga0466722_079945 | 3300042609 | Bacteria | 16403 |
| 118 | Ga0466722_190847 | 3300042609 | Bacteria | 33466 |
| 119 | 2227372481 | 2225789004 | Bacteria | 5990 |
| 120 | IMNBL1DRAFT_c0002391 | 3300000062 | Bacteria | 13066 |
| 121 | Ga0103265_1013785 | 3300007068 | Bacteria | 1055 |
| 122 | Ga0104045_1028181 | 3300007085 | Unclassified | 4752 |
| 123 | Ga0102737_1000002 | 3300007142 | Bacteria | 138174 |
| 124 | Ga0104019_1031255 | 3300007150 | Bacteria | 2561 |
| 125 | Ga0104050_1001365 | 3300007153 | Bacteria | 22088 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300007505 | Ga0105005_1020652 | Ga0105005_10206522 | 179 |
| 2 | 3300007085 | Ga0104045_1028181 | Ga0104045_10281816 | 183 |
| 3 | 3300042636 | Ga0466703_131105 | Ga0466703_131105_28753_29373 | 185 |
| 4 | 2225789004 | 2227372481 | 2227818953 | 189 |
| 5 | 3300042609 | Ga0466722_057000 | Ga0466722_057000_634_1206 | 190 |
| 6 | 3300042625 | Ga0466730_103185 | Ga0466730_103185_109073_109702 | 192 |
| 7 | 3300042623 | Ga0466734_134432 | Ga0466734_134432_1434_2015 | 193 |
| 8 | 3300042654 | Ga0466725_120047 | Ga0466725_120047_196_840 | 193 |
| 9 | 3300012839 | Ga0160472_100024 | Ga0160472_100024218 | 194 |
| 10 | 3300000036 | IMNBGM34_c001743 | IMNBGM34_0017434 | 198 |
| 11 | 3300005071 | Ga0068302_10222894 | Ga0068302_102228941 | 198 |
| 12 | 3300042606 | Ga0466719_479919 | Ga0466719_479919_386_982 | 198 |
| 13 | 3300042616 | Ga0466715_183450 | Ga0466715_183450_4430_5026 | 198 |
| 14 | 3300042606 | Ga0466719_377988 | Ga0466719_377988_911_1510 | 199 |
| 15 | iso_pr_bacteria | 2718218155 | 2720328231 | 199 |
| 16 | 3300007143 | Ga0104048_1026929 | Ga0104048_10269299 | 200 |
| 17 | 3300042619 | Ga0466726_138996 | Ga0466726_138996_216_818 | 200 |
| 18 | 3300042590 | Ga0466690_025734 | Ga0466690_025734_10807_11412 | 201 |
| 19 | 3300042590 | Ga0466690_341355 | Ga0466690_341355_10099_10704 | 201 |
| 20 | 3300042594 | Ga0466694_089319 | Ga0466694_089319_990_1595 | 201 |
| 21 | 3300042609 | Ga0466722_079945 | Ga0466722_079945_6112_6717 | 201 |
| 22 | 3300042609 | Ga0466722_120146 | Ga0466722_120146_835_1440 | 201 |
| 23 | 3300000062 | IMNBL1DRAFT_c0002391 | IMNBL1DRAFT_00023915 | 202 |
| 24 | 3300042606 | Ga0466719_561104 | Ga0466719_561104_166_774 | 202 |
| 25 | 3300042609 | Ga0466722_138946 | Ga0466722_138946_349_957 | 202 |
| 26 | 3300042652 | Ga0466708_170875 | Ga0466708_170875_9131_9739 | 202 |
| 27 | 3300042652 | Ga0466708_418672 | Ga0466708_418672_12746_13354 | 202 |
| 28 | 3300042659 | Ga0466733_077254 | Ga0466733_077254_23702_24310 | 202 |
| 29 | 3300042615 | Ga0466711_109554 | Ga0466711_109554_5283_5894 | 203 |
| 30 | 3300042593 | Ga0466691_080894 | Ga0466691_080894_5231_5845 | 204 |
| 31 | 3300042593 | Ga0466691_089458 | Ga0466691_089458_559_1173 | 204 |
| 32 | 3300042612 | Ga0466705_168389 | Ga0466705_168389_1399_2013 | 204 |
| 33 | 3300042616 | Ga0466715_122298 | Ga0466715_122298_4745_5359 | 204 |
| 34 | 3300042618 | Ga0466723_029341 | Ga0466723_029341_7058_7672 | 204 |
| 35 | 3300042618 | Ga0466723_227268 | Ga0466723_227268_7661_8275 | 204 |
| 36 | 3300042618 | Ga0466723_326767 | Ga0466723_326767_392_1006 | 204 |
| 37 | 3300042643 | Ga0466704_155159 | Ga0466704_155159_8090_8704 | 204 |
| 38 | 3300042652 | Ga0466708_029339 | Ga0466708_029339_17617_18231 | 204 |
| 39 | 3300042590 | Ga0466690_191290 | Ga0466690_191290_828_1445 | 205 |
| 40 | 3300042609 | Ga0466722_190847 | Ga0466722_190847_9464_10081 | 205 |
| 41 | 3300042618 | Ga0466723_088817 | Ga0466723_088817_417_1034 | 205 |
| 42 | iso_pr_bacteria | 2904728850 | 2904730973 | 205 |
| 43 | iso_pr_bacteria | 2958471994 | 2958474298 | 205 |
| 44 | 3300007153 | Ga0104050_1204752 | Ga0104050_12047521 | 206 |
| 45 | 3300042612 | Ga0466705_049460 | Ga0466705_049460_2390_3010 | 206 |
| 46 | 3300042618 | Ga0466723_027644 | Ga0466723_027644_6868_7488 | 206 |
| 47 | 3300042620 | Ga0466728_085034 | Ga0466728_085034_1679_2299 | 206 |
| 48 | 3300042605 | Ga0466716_155295 | Ga0466716_155295_2163_2786 | 207 |
| 49 | 3300042625 | Ga0466730_039992 | Ga0466730_039992_1050931_1051554 | 207 |
| 50 | 3300042648 | Ga0466709_101317 | Ga0466709_101317_3530_4153 | 207 |
| 51 | 3300042649 | Ga0466724_40582 | Ga0466724_40582_632_1255 | 207 |
| 52 | 3300042649 | Ga0466724_45139 | Ga0466724_45139_4848_5471 | 207 |
| 53 | iso_pr_bacteria | 2579779088 | 2582237831 | 207 |
| 54 | iso_pr_bacteria | 2590828803 | 2592928522 | 207 |
| 55 | iso_pr_bacteria | 2873776654 | 2873781737 | 207 |
| 56 | iso_pr_bacteria | 2896321640 | 2896325224 | 207 |
| 57 | iso_pr_bacteria | 2896330536 | 2896331727 | 207 |
| 58 | iso_pr_bacteria | 2896350215 | 2896351113 | 207 |
| 59 | iso_pr_bacteria | 2898741527 | 2898742137 | 207 |
| 60 | 3300002931 | CVPL010W_10002346 | CVPL010W_1000234623 | 208 |
| 61 | 3300007042 | Ga0103263_100893 | Ga0103263_1008932 | 208 |
| 62 | 3300007068 | Ga0103265_1013785 | Ga0103265_10137852 | 208 |
| 63 | 3300007080 | Ga0102735_1000659 | Ga0102735_10006596 | 208 |
| 64 | 3300007106 | Ga0104041_1001120 | Ga0104041_10011202 | 208 |
| 65 | 3300007129 | Ga0102734_1000781 | Ga0102734_10007814 | 208 |
| 66 | 3300007140 | Ga0102740_1001031 | Ga0102740_10010318 | 208 |
| 67 | 3300007143 | Ga0104048_1024708 | Ga0104048_10247084 | 208 |
| 68 | 3300007153 | Ga0104050_1003258 | Ga0104050_10032582 | 208 |
| 69 | 3300007153 | Ga0104050_1026947 | Ga0104050_10269474 | 208 |
| 70 | 3300012798 | Ga0160454_100012 | Ga0160454_100012223 | 208 |
| 71 | 3300012803 | Ga0160465_100198 | Ga0160465_10019815 | 208 |
| 72 | 3300012818 | Ga0160432_100004 | Ga0160432_100004131 | 208 |
| 73 | 3300012824 | Ga0160469_100850 | Ga0160469_1008504 | 208 |
| 74 | 3300012828 | Ga0160431_108323 | Ga0160431_1083232 | 208 |
| 75 | 3300012829 | Ga0160467_100091 | Ga0160467_100091117 | 208 |
| 76 | 3300012832 | Ga0160458_100021 | Ga0160458_10002184 | 208 |
| 77 | 3300012832 | Ga0160458_100038 | Ga0160458_10003887 | 208 |
| 78 | 3300012834 | Ga0160452_102211 | Ga0160452_1022112 | 208 |
| 79 | 3300012834 | Ga0160452_110619 | Ga0160452_1106191 | 208 |
| 80 | 3300012837 | Ga0160455_100001 | Ga0160455_100001992 | 208 |
| 81 | 3300012845 | Ga0160460_100151 | Ga0160460_10015119 | 208 |
| 82 | 3300012845 | Ga0160460_107319 | Ga0160460_1073192 | 208 |
| 83 | 3300012846 | Ga0160433_100025 | Ga0160433_10002535 | 208 |
| 84 | 3300012846 | Ga0160433_100070 | Ga0160433_100070105 | 208 |
| 85 | 3300012846 | Ga0160433_101666 | Ga0160433_1016665 | 208 |
| 86 | 3300012847 | Ga0160445_100402 | Ga0160445_1004026 | 208 |
| 87 | 3300012847 | Ga0160445_106827 | Ga0160445_1068272 | 208 |
| 88 | 3300012848 | Ga0160443_107794 | Ga0160443_1077942 | 208 |
| 89 | 3300012850 | Ga0160434_100110 | Ga0160434_10011026 | 208 |
| 90 | 3300012858 | Ga0160457_1000001 | Ga0160457_1000001310 | 208 |
| 91 | 3300012858 | Ga0160457_1001545 | Ga0160457_10015454 | 208 |
| 92 | 3300042615 | Ga0466711_175803 | Ga0466711_175803_20994_21620 | 208 |
| 93 | 3300042619 | Ga0466726_465489 | Ga0466726_465489_25111_25737 | 208 |
| 94 | iso_pr_bacteria | 2820789850 | 2820790202 | 208 |
| 95 | 3300000036 | IMNBGM34_c006864 | IMNBGM34_0068642 | 209 |
| 96 | 3300042598 | Ga0466701_031730 | Ga0466701_031730_55498_56127 | 209 |
| 97 | 3300042623 | Ga0466734_126311 | Ga0466734_126311_32_661 | 209 |
| 98 | 3300042649 | Ga0466724_46543 | Ga0466724_46543_192148_192777 | 209 |
| 99 | 3300042649 | Ga0466724_59158 | Ga0466724_59158_115683_116312 | 209 |
| 100 | 3300042652 | Ga0466708_008911 | Ga0466708_008911_9885_10514 | 209 |
| 101 | iso_pr_bacteria | 2687453786 | 2690173827 | 209 |
| 102 | iso_pr_bacteria | 2785510743 | 2785735156 | 209 |
| 103 | iso_pr_bacteria | 2799112231 | 2799233090 | 209 |
| 104 | iso_pr_bacteria | 2832298047 | 2832298364 | 209 |
| 105 | iso_pr_bacteria | 2832343623 | 2832346003 | 209 |
| 106 | iso_pr_bacteria | 2832372155 | 2832373523 | 209 |
| 107 | iso_pr_bacteria | 2838772460 | 2838776544 | 209 |
| 108 | iso_pr_bacteria | 2847090942 | 2847093162 | 209 |
| 109 | iso_pr_bacteria | 2864788197 | 2864791044 | 209 |
| 110 | iso_pr_bacteria | 2864822740 | 2864824892 | 209 |
| 111 | iso_pr_bacteria | 2864831662 | 2864835933 | 209 |
| 112 | iso_pr_bacteria | 2864882932 | 2864885083 | 209 |
| 113 | iso_pr_bacteria | 2864891731 | 2864895051 | 209 |
| 114 | iso_pr_bacteria | 2864923010 | 2864925858 | 209 |
| 115 | iso_pr_bacteria | 2864948220 | 2864951066 | 209 |
| 116 | iso_pr_bacteria | 2921902974 | 2921904410 | 209 |
| 117 | iso_pr_bacteria | 8020009074 | 8020012605 | 209 |
| 118 | iso_pr_bacteria | 8114076984 | 8114079566 | 209 |
| 119 | iso_pr_bacteria | 8114076984 | 8114080960 | 209 |
| 120 | 3300000333 | HBC_ctgsDRAFT_1003355 | HBC_ctgsDRAFT_10033554 | 210 |
| 121 | 3300002464 | Meta3P_1005494 | Meta3P_10054949 | 210 |
| 122 | 3300007143 | Ga0104048_1001745 | Ga0104048_10017455 | 210 |
| 123 | 3300007153 | Ga0104050_1000445 | Ga0104050_10004452 | 210 |
| 124 | 3300013007 | Ga0157631_135381 | Ga0157631_1353812 | 210 |
| 125 | 3300042596 | Ga0466696_146459 | Ga0466696_146459_7660_8292 | 210 |
| 126 | 3300042598 | Ga0466701_014254 | Ga0466701_014254_89_721 | 210 |
| 127 | 3300042598 | Ga0466701_030911 | Ga0466701_030911_17128_17760 | 210 |
| 128 | iso_pr_bacteria | 2811995047 | 2812945201 | 210 |
| 129 | iso_pr_bacteria | 2864878056 | 2864878061 | 210 |
| 130 | iso_pr_bacteria | 2864886855 | 2864888253 | 210 |
| 131 | iso_pr_bacteria | 2882250448 | 2882252645 | 210 |
| 132 | iso_pr_bacteria | 2894649344 | 2894650542 | 210 |
| 133 | iso_pr_bacteria | 2899132286 | 2899134007 | 210 |
| 134 | 3300005307 | Ga0074308_1018195 | Ga0074308_10181952 | 211 |
| 135 | 3300007142 | Ga0102737_1000002 | Ga0102737_100000213 | 211 |
| 136 | 3300007150 | Ga0104019_1031255 | Ga0104019_10312553 | 211 |
| 137 | 3300007190 | Ga0103267_1007680 | Ga0103267_10076802 | 211 |
| 138 | 3300042582 | Ga0466657_365935 | Ga0466657_365935_766_1401 | 211 |
| 139 | 3300042598 | Ga0466701_016596 | Ga0466701_016596_29751_30386 | 211 |
| 140 | iso_pr_bacteria | 2529292732 | 2529758981 | 211 |
| 141 | iso_pr_bacteria | 8065497608 | 8065501220 | 211 |
| 142 | 3300002931 | CVPL010W_10004528 | CVPL010W_100045287 | 212 |
| 143 | 3300007095 | Ga0102739_1000129 | Ga0102739_100012917 | 212 |
| 144 | 3300007140 | Ga0102740_1001327 | Ga0102740_10013272 | 212 |
| 145 | 3300007143 | Ga0104048_1003767 | Ga0104048_10037672 | 212 |
| 146 | 3300007143 | Ga0104048_1168543 | Ga0104048_11685437 | 212 |
| 147 | 3300007190 | Ga0103267_1020227 | Ga0103267_10202272 | 212 |
| 148 | 3300007192 | Ga0103268_1000083 | Ga0103268_10000833 | 212 |
| 149 | 3300010049 | Ga0123356_10214050 | Ga0123356_102140501 | 212 |
| 150 | 3300042654 | Ga0466725_284756 | Ga0466725_284756_17720_18358 | 212 |
| 151 | 3300007080 | Ga0102735_1000103 | Ga0102735_10001038 | 213 |
| 152 | 3300007129 | Ga0102734_1000590 | Ga0102734_100059012 | 213 |
| 153 | 3300042619 | Ga0466726_474980 | Ga0466726_474980_2133_2774 | 213 |
| 154 | iso_pr_bacteria | 2864836148 | 2864838471 | 213 |
| 155 | 3300042598 | Ga0466701_007176 | Ga0466701_007176_6242_6886 | 214 |
| 156 | 3300042649 | Ga0466724_38523 | Ga0466724_38523_93170_93814 | 214 |
| 157 | 3300007153 | Ga0104050_1001365 | Ga0104050_10013652 | 215 |
| 158 | 3300042598 | Ga0466701_064616 | Ga0466701_064616_652_1299 | 215 |
| 159 | 3300042636 | Ga0466703_048361 | Ga0466703_048361_1829_2482 | 217 |
| 160 | 3300042613 | Ga0466710_068333 | Ga0466710_068333_2540_3199 | 219 |
| 161 | 3300042606 | Ga0466719_241574 | Ga0466719_241574_139_825 | 228 |
| 162 | 3300005201 | Ga0072941_1031664 | Ga0072941_10316643 | 231 |
| 163 | 3300007085 | Ga0104045_1005764 | Ga0104045_100576412 | 234 |
| 164 | 3300042649 | Ga0466724_51285 | Ga0466724_51285_2263_2970 | 235 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.78 | 0.85 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.