Protein Family IF09784

Metagenome Isolate
164 Members
105 Samples
125 Scaffolds
207.27 Avg Length

🧬 Representative Sequence

ID
3300042649|Ga0466724_51285|Ga0466724_51285_2263_2970
Length
235 aa
Sequence
MTRILPKTIRQIEHIIIYLLPLQTQILTMSNQVPEDGTQLPLMEEFYTIQGEGYHTGTAAYFIRLGGCDVGCHWCDVKESWDASIHPLTAADSIIENAKKYPAKTVVITGGEPLIYNLDYLTKGLHAAGIKTFIETSGAYPLSGEWDWICLSPKKFKAPRKDVLDAAGELKVIVFNKSDFAWGEEYAQLVGPDCRLYLQPEWSKSKEMTPSIIDYVKENPKWDISLQTHKFLNIP

📊 Sample Types

Isolate 23.8%
Metagenome 76.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 15.2%
Elmidae 10.9%
Formicidae 10.9%
Termitidae 10.9%
Culicidae 9.8%
Drosophilidae 7.6%
Armadillidiidae 7.6%
Apidae 6.5%
Unclassified 4.3%
Passalidae 3.3%
Daphniidae 2.2%
Termopsidae 2.2%
Cambaridae 2.2%
Hydrophilidae 1.1%
Nephropidae 1.1%
Bombycidae 1.1%
Kiwaidae 1.1%
Tenebrionidae 1.1%
Rhinotermitidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 155
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2811995047 Flavobacterium succinicans DD5b Isolate Daphniidae
2 2864831662 Chryseobacterium sediminis S00068 Isolate Elmidae
3 2894649344 Allomuricauda alvinocaridis SCR12 Isolate Unclassified
4 2898741527 Sphingobacterium sp. xlx-73 Isolate
5 2904728850 Flavobacterium sp. xlx-214 Isolate
6 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
7 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
8 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
9 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
10 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
11 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
12 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
13 8020009074 Elizabethkingia anophelis MSU001 Isolate Culicidae
14 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
15 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
16 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
17 8114076984 Elizabethkingia anophelis R26 Isolate Culicidae
18 2832343623 Apibacter adventoris wkB180 Isolate Apidae
19 2864788197 Elizabethkingia anophelis S00027 Isolate Elmidae
20 2864822740 Chryseobacterium shigense S00064 Isolate Elmidae
21 2882250448 Bizionia sp. APA-3 Isolate
22 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
23 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
24 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
25 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
26 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
27 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
28 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
29 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
30 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
31 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
32 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
33 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
34 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
35 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
36 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
37 2529292732 Elizabethkingia anophelis R26 Isolate Culicidae
38 2718218155 Flavobacteriaceae bacterium UJ101 Isolate
39 2832372155 Apibacter adventoris wkB301 Isolate Apidae
40 2864836148 Arcicella rosea S00070 Isolate Elmidae
41 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
42 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
43 2896330536 Sphingobacterium sp. xlx-96 Isolate
44 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
45 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
46 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
47 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
48 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
49 2687453786 Chryseobacterium culicis DSM 23031 Isolate Unclassified
50 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
51 2832298047 Apibacter sp. wkB309 Isolate Apidae
52 2847090942 Elizabethkingia anophelis Ag1 Isolate Culicidae
53 2864882932 Chryseobacterium shingense S00136 Isolate Elmidae
54 2864891731 Chryseobacterium defluvii S00151 Isolate Elmidae
55 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
56 3300005307 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut Metagenome Drosophilidae
57 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
58 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
59 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
60 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
61 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
62 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
63 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
64 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
65 2785510743 Apibacter sp. ESL0404 Isolate Apidae
66 2864948220 Elizabethkingia anophelis S00205 Isolate Elmidae
67 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
68 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
69 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
70 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
71 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
72 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
73 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
74 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
75 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
76 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
77 2799112231 Apibacter sp. ESL0432 Isolate Unclassified
78 2838772460 Aquimarina sp. I32.4 Isolate Nephropidae
79 2896350215 Sphingobacterium sp. xlx-183 Isolate
80 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
81 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
82 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
83 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
84 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
85 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
86 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
87 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
88 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
89 2579779088 Sphingobacterium paucimobilis HER1398 Isolate Bombycidae
90 2921902974 Chryseobacterium sp. cx-624 Isolate Cambaridae
91 2958471994 Flavobacterium sp. xlx-221 Isolate Cambaridae
92 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
93 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
94 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
95 3300013007 Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts Metagenome Kiwaidae
96 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
97 2864923010 Elizabethkingia anophelis S00177 Isolate Elmidae
98 2896321640 Sphingobacterium sp. xlx-130 Isolate
99 2899132286 Myroides albus BIT-d1 Isolate Tenebrionidae
100 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
101 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
102 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
103 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
104 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
105 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10214050 3300010049 Bacteria 1978
2 Ga0466723_088817 3300042618 Bacteria 2061
3 Ga0160432_100004 3300012818 Bacteria 604772
4 Ga0160452_110619 3300012834 Bacteria 1118
5 Ga0160472_100024 3300012839 Bacteria 325454
6 Ga0160433_101666 3300012846 Bacteria 5725
7 Ga0160457_1001545 3300012858 Bacteria 6193
8 Ga0466691_080894 3300042593 Bacteria 8459
9 Ga0466701_014254 3300042598 Bacteria 1445
10 Ga0466730_039992 3300042625 Bacteria 1355215
11 Ga0466725_284756 3300042654 Bacteria 27984
12 IMNBGM34_c006864 3300000036 Bacteria 1471
13 Meta3P_1005494 3300002464 Bacteria 9262
14 Ga0102734_1000590 3300007129 Bacteria 10127
15 Ga0103267_1007680 3300007190 Bacteria 3148
16 Ga0105005_1020652 3300007505 Bacteria 2332
17 Ga0466705_168389 3300042612 Bacteria 2226
18 Ga0466723_227268 3300042618 Bacteria 8623
19 Ga0466723_326767 3300042618 Bacteria 7130
20 Ga0466726_474980 3300042619 Bacteria 4556
21 Ga0466728_085034 3300042620 Bacteria 9498
22 Ga0466734_134432 3300042623 Bacteria 2702
23 Ga0466703_048361 3300042636 Bacteria 8077
24 Ga0466724_38523 3300042649 Bacteria 121795
25 Ga0466701_030911 3300042598 Bacteria 23075
26 Ga0102735_1000103 3300007080 Bacteria 22156
27 Ga0104045_1005764 3300007085 Bacteria 20363
28 Ga0102739_1000129 3300007095 Bacteria 21218
29 Ga0104050_1204752 3300007153 Bacteria 1328
30 Ga0160465_100198 3300012803 Bacteria 48589
31 Ga0466711_175803 3300042615 Bacteria 25847
32 Ga0466715_183450 3300042616 Bacteria 7562
33 Ga0160469_100850 3300012824 Bacteria 10546
34 Ga0160458_100021 3300012832 Bacteria 258610
35 Ga0160452_102211 3300012834 Bacteria 4365
36 Ga0160460_100151 3300012845 Bacteria 78148
37 Ga0160443_107794 3300012848 Bacteria 1313
38 Ga0466691_089458 3300042593 Bacteria 3701
39 Ga0466734_126311 3300042623 Bacteria 1574
40 Ga0466724_46543 3300042649 Bacteria 311178
41 Ga0466725_120047 3300042654 Bacteria 1211
42 Ga0466701_031730 3300042598 Bacteria 202867
43 Ga0466701_064616 3300042598 Bacteria 2750
44 Ga0466719_377988 3300042606 Bacteria 6332
45 Ga0466722_057000 3300042609 Bacteria 1394
46 Ga0068302_10222894 3300005071 Bacteria 776
47 Ga0102734_1000781 3300007129 Bacteria 16428
48 Ga0102740_1001031 3300007140 Bacteria 7336
49 Ga0104050_1000445 3300007153 Bacteria 3519
50 Ga0466723_029341 3300042618 Bacteria 7756
51 Ga0160455_100001 3300012837 Bacteria 1265300
52 Ga0157631_135381 3300013007 Bacteria 3434
53 Ga0466690_341355 3300042590 Bacteria 23370
54 Ga0466724_45139 3300042649 Bacteria 8878
55 Ga0466708_418672 3300042652 Bacteria 17523
56 Ga0466719_479919 3300042606 Bacteria 1029
57 Ga0466722_120146 3300042609 Bacteria 1489
58 CVPL010W_10004528 3300002931 Bacteria 15396
59 Ga0102740_1001327 3300007140 Bacteria 6339
60 Ga0104048_1001745 3300007143 Bacteria 4315
61 Ga0104048_1026929 3300007143 Unclassified 5526
62 Ga0104050_1003258 3300007153 Bacteria 3833
63 Ga0103267_1020227 3300007190 Bacteria 2177
64 Ga0466710_068333 3300042613 Bacteria 4105
65 Ga0466711_109554 3300042615 Bacteria 6873
66 Ga0160433_100070 3300012846 Bacteria 109420
67 Ga0466657_365935 3300042582 Bacteria 4623
68 Ga0466724_51285 3300042649 Bacteria 6629
69 Ga0466701_016596 3300042598 Unclassified 46491
70 Ga0466722_138946 3300042609 Bacteria 3928
71 HBC_ctgsDRAFT_1003355 3300000333 Bacteria 3673
72 CVPL010W_10002346 3300002931 Bacteria 25428
73 Ga0074308_1018195 3300005307 Bacteria 5350
74 Ga0103263_100893 3300007042 Unclassified 3990
75 Ga0102735_1000659 3300007080 Bacteria 7333
76 Ga0104048_1003767 3300007143 Bacteria 2601
77 Ga0104048_1024708 3300007143 Bacteria 3357
78 Ga0104048_1168543 3300007143 Bacteria 4000
79 Ga0104050_1026947 3300007153 Unclassified 2469
80 Ga0160460_107319 3300012845 Unclassified 1461
81 Ga0160445_100402 3300012847 Bacteria 23842
82 Ga0160445_106827 3300012847 Unclassified 1839
83 Ga0160434_100110 3300012850 Bacteria 47210
84 Ga0466690_025734 3300042590 Bacteria 11601
85 Ga0466690_191290 3300042590 Bacteria 2838
86 Ga0466694_089319 3300042594 Bacteria 2423
87 Ga0466701_007176 3300042598 Bacteria 9921
88 Ga0466704_155159 3300042643 Bacteria 10115
89 Ga0466724_40582 3300042649 Unclassified 1850
90 Ga0466708_029339 3300042652 Bacteria 20997
91 Ga0466716_155295 3300042605 Bacteria 7938
92 Ga0466719_561104 3300042606 Bacteria 1536
93 Ga0072941_1031664 3300005201 Bacteria 4762
94 Ga0103268_1000083 3300007192 Bacteria 29500
95 Ga0466733_077254 3300042659 Bacteria 26018
96 Ga0160454_100012 3300012798 Bacteria 390121
97 Ga0466715_122298 3300042616 Bacteria 9543
98 Ga0160467_100091 3300012829 Bacteria 133372
99 Ga0160458_100038 3300012832 Bacteria 185944
100 Ga0466696_146459 3300042596 Bacteria 9428
101 Ga0466730_103185 3300042625 Bacteria 215676
102 Ga0466709_101317 3300042648 Bacteria 5608
103 Ga0466708_008911 3300042652 Bacteria 13055
104 IMNBGM34_c001743 3300000036 Bacteria 3482
105 Ga0104041_1001120 3300007106 Bacteria 2708
106 Ga0466705_049460 3300042612 Bacteria 7947
107 Ga0466723_027644 3300042618 Bacteria 14041
108 Ga0466726_138996 3300042619 Unclassified 1052
109 Ga0466726_465489 3300042619 Bacteria 28018
110 Ga0160431_108323 3300012828 Bacteria 1417
111 Ga0160433_100025 3300012846 Bacteria 185749
112 Ga0160457_1000001 3300012858 Bacteria 1192173
113 Ga0466703_131105 3300042636 Bacteria 29788
114 Ga0466724_59158 3300042649 Bacteria 434991
115 Ga0466708_170875 3300042652 Bacteria 19923
116 Ga0466719_241574 3300042606 Bacteria 2489
117 Ga0466722_079945 3300042609 Bacteria 16403
118 Ga0466722_190847 3300042609 Bacteria 33466
119 2227372481 2225789004 Bacteria 5990
120 IMNBL1DRAFT_c0002391 3300000062 Bacteria 13066
121 Ga0103265_1013785 3300007068 Bacteria 1055
122 Ga0104045_1028181 3300007085 Unclassified 4752
123 Ga0102737_1000002 3300007142 Bacteria 138174
124 Ga0104019_1031255 3300007150 Bacteria 2561
125 Ga0104050_1001365 3300007153 Bacteria 22088

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300007505 Ga0105005_1020652 Ga0105005_10206522 179
2 3300007085 Ga0104045_1028181 Ga0104045_10281816 183
3 3300042636 Ga0466703_131105 Ga0466703_131105_28753_29373 185
4 2225789004 2227372481 2227818953 189
5 3300042609 Ga0466722_057000 Ga0466722_057000_634_1206 190
6 3300042625 Ga0466730_103185 Ga0466730_103185_109073_109702 192
7 3300042623 Ga0466734_134432 Ga0466734_134432_1434_2015 193
8 3300042654 Ga0466725_120047 Ga0466725_120047_196_840 193
9 3300012839 Ga0160472_100024 Ga0160472_100024218 194
10 3300000036 IMNBGM34_c001743 IMNBGM34_0017434 198
11 3300005071 Ga0068302_10222894 Ga0068302_102228941 198
12 3300042606 Ga0466719_479919 Ga0466719_479919_386_982 198
13 3300042616 Ga0466715_183450 Ga0466715_183450_4430_5026 198
14 3300042606 Ga0466719_377988 Ga0466719_377988_911_1510 199
15 iso_pr_bacteria 2718218155 2720328231 199
16 3300007143 Ga0104048_1026929 Ga0104048_10269299 200
17 3300042619 Ga0466726_138996 Ga0466726_138996_216_818 200
18 3300042590 Ga0466690_025734 Ga0466690_025734_10807_11412 201
19 3300042590 Ga0466690_341355 Ga0466690_341355_10099_10704 201
20 3300042594 Ga0466694_089319 Ga0466694_089319_990_1595 201
21 3300042609 Ga0466722_079945 Ga0466722_079945_6112_6717 201
22 3300042609 Ga0466722_120146 Ga0466722_120146_835_1440 201
23 3300000062 IMNBL1DRAFT_c0002391 IMNBL1DRAFT_00023915 202
24 3300042606 Ga0466719_561104 Ga0466719_561104_166_774 202
25 3300042609 Ga0466722_138946 Ga0466722_138946_349_957 202
26 3300042652 Ga0466708_170875 Ga0466708_170875_9131_9739 202
27 3300042652 Ga0466708_418672 Ga0466708_418672_12746_13354 202
28 3300042659 Ga0466733_077254 Ga0466733_077254_23702_24310 202
29 3300042615 Ga0466711_109554 Ga0466711_109554_5283_5894 203
30 3300042593 Ga0466691_080894 Ga0466691_080894_5231_5845 204
31 3300042593 Ga0466691_089458 Ga0466691_089458_559_1173 204
32 3300042612 Ga0466705_168389 Ga0466705_168389_1399_2013 204
33 3300042616 Ga0466715_122298 Ga0466715_122298_4745_5359 204
34 3300042618 Ga0466723_029341 Ga0466723_029341_7058_7672 204
35 3300042618 Ga0466723_227268 Ga0466723_227268_7661_8275 204
36 3300042618 Ga0466723_326767 Ga0466723_326767_392_1006 204
37 3300042643 Ga0466704_155159 Ga0466704_155159_8090_8704 204
38 3300042652 Ga0466708_029339 Ga0466708_029339_17617_18231 204
39 3300042590 Ga0466690_191290 Ga0466690_191290_828_1445 205
40 3300042609 Ga0466722_190847 Ga0466722_190847_9464_10081 205
41 3300042618 Ga0466723_088817 Ga0466723_088817_417_1034 205
42 iso_pr_bacteria 2904728850 2904730973 205
43 iso_pr_bacteria 2958471994 2958474298 205
44 3300007153 Ga0104050_1204752 Ga0104050_12047521 206
45 3300042612 Ga0466705_049460 Ga0466705_049460_2390_3010 206
46 3300042618 Ga0466723_027644 Ga0466723_027644_6868_7488 206
47 3300042620 Ga0466728_085034 Ga0466728_085034_1679_2299 206
48 3300042605 Ga0466716_155295 Ga0466716_155295_2163_2786 207
49 3300042625 Ga0466730_039992 Ga0466730_039992_1050931_1051554 207
50 3300042648 Ga0466709_101317 Ga0466709_101317_3530_4153 207
51 3300042649 Ga0466724_40582 Ga0466724_40582_632_1255 207
52 3300042649 Ga0466724_45139 Ga0466724_45139_4848_5471 207
53 iso_pr_bacteria 2579779088 2582237831 207
54 iso_pr_bacteria 2590828803 2592928522 207
55 iso_pr_bacteria 2873776654 2873781737 207
56 iso_pr_bacteria 2896321640 2896325224 207
57 iso_pr_bacteria 2896330536 2896331727 207
58 iso_pr_bacteria 2896350215 2896351113 207
59 iso_pr_bacteria 2898741527 2898742137 207
60 3300002931 CVPL010W_10002346 CVPL010W_1000234623 208
61 3300007042 Ga0103263_100893 Ga0103263_1008932 208
62 3300007068 Ga0103265_1013785 Ga0103265_10137852 208
63 3300007080 Ga0102735_1000659 Ga0102735_10006596 208
64 3300007106 Ga0104041_1001120 Ga0104041_10011202 208
65 3300007129 Ga0102734_1000781 Ga0102734_10007814 208
66 3300007140 Ga0102740_1001031 Ga0102740_10010318 208
67 3300007143 Ga0104048_1024708 Ga0104048_10247084 208
68 3300007153 Ga0104050_1003258 Ga0104050_10032582 208
69 3300007153 Ga0104050_1026947 Ga0104050_10269474 208
70 3300012798 Ga0160454_100012 Ga0160454_100012223 208
71 3300012803 Ga0160465_100198 Ga0160465_10019815 208
72 3300012818 Ga0160432_100004 Ga0160432_100004131 208
73 3300012824 Ga0160469_100850 Ga0160469_1008504 208
74 3300012828 Ga0160431_108323 Ga0160431_1083232 208
75 3300012829 Ga0160467_100091 Ga0160467_100091117 208
76 3300012832 Ga0160458_100021 Ga0160458_10002184 208
77 3300012832 Ga0160458_100038 Ga0160458_10003887 208
78 3300012834 Ga0160452_102211 Ga0160452_1022112 208
79 3300012834 Ga0160452_110619 Ga0160452_1106191 208
80 3300012837 Ga0160455_100001 Ga0160455_100001992 208
81 3300012845 Ga0160460_100151 Ga0160460_10015119 208
82 3300012845 Ga0160460_107319 Ga0160460_1073192 208
83 3300012846 Ga0160433_100025 Ga0160433_10002535 208
84 3300012846 Ga0160433_100070 Ga0160433_100070105 208
85 3300012846 Ga0160433_101666 Ga0160433_1016665 208
86 3300012847 Ga0160445_100402 Ga0160445_1004026 208
87 3300012847 Ga0160445_106827 Ga0160445_1068272 208
88 3300012848 Ga0160443_107794 Ga0160443_1077942 208
89 3300012850 Ga0160434_100110 Ga0160434_10011026 208
90 3300012858 Ga0160457_1000001 Ga0160457_1000001310 208
91 3300012858 Ga0160457_1001545 Ga0160457_10015454 208
92 3300042615 Ga0466711_175803 Ga0466711_175803_20994_21620 208
93 3300042619 Ga0466726_465489 Ga0466726_465489_25111_25737 208
94 iso_pr_bacteria 2820789850 2820790202 208
95 3300000036 IMNBGM34_c006864 IMNBGM34_0068642 209
96 3300042598 Ga0466701_031730 Ga0466701_031730_55498_56127 209
97 3300042623 Ga0466734_126311 Ga0466734_126311_32_661 209
98 3300042649 Ga0466724_46543 Ga0466724_46543_192148_192777 209
99 3300042649 Ga0466724_59158 Ga0466724_59158_115683_116312 209
100 3300042652 Ga0466708_008911 Ga0466708_008911_9885_10514 209
101 iso_pr_bacteria 2687453786 2690173827 209
102 iso_pr_bacteria 2785510743 2785735156 209
103 iso_pr_bacteria 2799112231 2799233090 209
104 iso_pr_bacteria 2832298047 2832298364 209
105 iso_pr_bacteria 2832343623 2832346003 209
106 iso_pr_bacteria 2832372155 2832373523 209
107 iso_pr_bacteria 2838772460 2838776544 209
108 iso_pr_bacteria 2847090942 2847093162 209
109 iso_pr_bacteria 2864788197 2864791044 209
110 iso_pr_bacteria 2864822740 2864824892 209
111 iso_pr_bacteria 2864831662 2864835933 209
112 iso_pr_bacteria 2864882932 2864885083 209
113 iso_pr_bacteria 2864891731 2864895051 209
114 iso_pr_bacteria 2864923010 2864925858 209
115 iso_pr_bacteria 2864948220 2864951066 209
116 iso_pr_bacteria 2921902974 2921904410 209
117 iso_pr_bacteria 8020009074 8020012605 209
118 iso_pr_bacteria 8114076984 8114079566 209
119 iso_pr_bacteria 8114076984 8114080960 209
120 3300000333 HBC_ctgsDRAFT_1003355 HBC_ctgsDRAFT_10033554 210
121 3300002464 Meta3P_1005494 Meta3P_10054949 210
122 3300007143 Ga0104048_1001745 Ga0104048_10017455 210
123 3300007153 Ga0104050_1000445 Ga0104050_10004452 210
124 3300013007 Ga0157631_135381 Ga0157631_1353812 210
125 3300042596 Ga0466696_146459 Ga0466696_146459_7660_8292 210
126 3300042598 Ga0466701_014254 Ga0466701_014254_89_721 210
127 3300042598 Ga0466701_030911 Ga0466701_030911_17128_17760 210
128 iso_pr_bacteria 2811995047 2812945201 210
129 iso_pr_bacteria 2864878056 2864878061 210
130 iso_pr_bacteria 2864886855 2864888253 210
131 iso_pr_bacteria 2882250448 2882252645 210
132 iso_pr_bacteria 2894649344 2894650542 210
133 iso_pr_bacteria 2899132286 2899134007 210
134 3300005307 Ga0074308_1018195 Ga0074308_10181952 211
135 3300007142 Ga0102737_1000002 Ga0102737_100000213 211
136 3300007150 Ga0104019_1031255 Ga0104019_10312553 211
137 3300007190 Ga0103267_1007680 Ga0103267_10076802 211
138 3300042582 Ga0466657_365935 Ga0466657_365935_766_1401 211
139 3300042598 Ga0466701_016596 Ga0466701_016596_29751_30386 211
140 iso_pr_bacteria 2529292732 2529758981 211
141 iso_pr_bacteria 8065497608 8065501220 211
142 3300002931 CVPL010W_10004528 CVPL010W_100045287 212
143 3300007095 Ga0102739_1000129 Ga0102739_100012917 212
144 3300007140 Ga0102740_1001327 Ga0102740_10013272 212
145 3300007143 Ga0104048_1003767 Ga0104048_10037672 212
146 3300007143 Ga0104048_1168543 Ga0104048_11685437 212
147 3300007190 Ga0103267_1020227 Ga0103267_10202272 212
148 3300007192 Ga0103268_1000083 Ga0103268_10000833 212
149 3300010049 Ga0123356_10214050 Ga0123356_102140501 212
150 3300042654 Ga0466725_284756 Ga0466725_284756_17720_18358 212
151 3300007080 Ga0102735_1000103 Ga0102735_10001038 213
152 3300007129 Ga0102734_1000590 Ga0102734_100059012 213
153 3300042619 Ga0466726_474980 Ga0466726_474980_2133_2774 213
154 iso_pr_bacteria 2864836148 2864838471 213
155 3300042598 Ga0466701_007176 Ga0466701_007176_6242_6886 214
156 3300042649 Ga0466724_38523 Ga0466724_38523_93170_93814 214
157 3300007153 Ga0104050_1001365 Ga0104050_10013652 215
158 3300042598 Ga0466701_064616 Ga0466701_064616_652_1299 215
159 3300042636 Ga0466703_048361 Ga0466703_048361_1829_2482 217
160 3300042613 Ga0466710_068333 Ga0466710_068333_2540_3199 219
161 3300042606 Ga0466719_241574 Ga0466719_241574_139_825 228
162 3300005201 Ga0072941_1031664 Ga0072941_10316643 231
163 3300007085 Ga0104045_1005764 Ga0104045_100576412 234
164 3300042649 Ga0466724_51285 Ga0466724_51285_2263_2970 235

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04055 Radical_SAM Radical SAM superfamily 66 141 0.87
PF13353 Fer4_12 4Fe-4S single cluster domain 50 122 0.81

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.78 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.