Protein Family IF09770

Metagenome Metatranscriptome Isolate
209 Members
99 Samples
167 Scaffolds
443.68 Avg Length

🧬 Representative Sequence

ID
3300042649|Ga0466724_43483|Ga0466724_43483_3683_5062
Length
459 aa
Sequence
VKILILKTKLFGKTYEFKSLREVMAKANEEKSGDKLAGIAAQSAEERVAAKVVLSHITLADLRNNPAVPYEEDEVTRIIQDGVNETIYNEIKGKTVSEFREWILDTQTSGEMIKHASRGMTAEMVAAVCKLMSNLDLVYGAKKIVITAHCNTTIGLPGTFSSRLQPNHTTDDPKGIMASLMEGFSLGCGDAVLGLNPVDDSTESVARILSSFDEFKRKWEVPTQICVLAHVTTQMDAIQKFNAPIDLLFQSIAGSQKGNEAFGLTGTMLDEAHDMMLKHGTCTGPNVMYFETGQGAELSAEAHNGWDQVTMEARCYGLAKRYNPFLVNTVVGFIGPEYLYDSKQVIRAGLEDHFMGKLSGVSMGCDACYTNHMKADQNDIENLATLLVAAGCNYIMGVPQGDDCMLMYQCTGYNEAATLREIFGLRPIKEFDMWLEKMGFSKDGKLTPLAGDASVFMSK

📊 Sample Types

Isolate 20.1%
Metagenome 79.0%
MAG 0.0%
Metatranscriptome 1.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 24.7%
Termitidae 23.7%
Kalotermitidae 15.1%
Apidae 7.5%
Tenebrionidae 6.5%
Rhinotermitidae 4.3%
Termopsidae 4.3%
Drosophilidae 3.2%
Blattidae 2.2%
Formicidae 2.2%
Calliphoridae 1.1%
Bombycidae 1.1%
Hodotermitidae 1.1%
Passalidae 1.1%
Elmidae 1.1%
Libellulidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 181
Eukaryota 0
Viruses 0
Unclassified 28

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820901319 Unclassified Actinobacteria Emb289P4bin58 Isolate Unclassified
2 2820944107 Unclassified Actinobacteria Cu122P5bin14 Isolate Unclassified
3 2827179085 Paenibacillus alvei DSM 29 Isolate Apidae
4 2849104611 Paenibacillus larvae larvae Eric_IV Isolate Apidae
5 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
6 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
7 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
8 2808606958 Lactobacillus sp. ESL0449 v2 Isolate Unclassified
9 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
10 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
11 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
12 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
13 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
14 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
15 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
16 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
17 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
18 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
19 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
20 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
21 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
22 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
23 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
24 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
25 2850744690 Paenibacillus larvae larvae DSM 25430 Isolate Apidae
26 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
27 2820027804 Unclassified Spirochaetes Lab288P1bin105 Isolate Unclassified
28 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
29 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
30 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
31 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
32 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
33 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
34 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
35 2590828841 Oscillospiraceae bacterium Ne3 Isolate Termitidae
36 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
37 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
38 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
39 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
40 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
41 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
42 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
43 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
44 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
45 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
46 2523231078 Paenibacillus larvae larvae 4-309, DSM 25430 Isolate Apidae
47 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
48 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
49 2971438493 Paenibacillus apiarius NRRL B-23460 Isolate Apidae
50 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
51 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
52 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
53 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
54 646311952 Sebaldella termitidis ATCC 33386 Isolate Unclassified
55 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
56 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
57 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
58 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
59 2820290662 Unclassified Firmicutes Th196P3bin135 Isolate Unclassified
60 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
61 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
62 3300021235 Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA Metatranscriptome
63 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
64 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
65 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
66 641736255 Paenibacillus larvae larvae BRL-230010 Isolate Unclassified
67 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
68 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
69 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
70 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
71 8114555646 Enterococcus sp. DIV1094 Isolate
72 2836667214 Paenibacillus larvae larvae B-3650 Isolate Apidae
73 2849099867 Paenibacillus larvae larvae ERIC_I Isolate Unclassified
74 2864981449 Sporosarcina sp. S00266 Isolate Elmidae
75 2585428141 Pilibacter termitis ATCC BAA-1030 Isolate Rhinotermitidae
76 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
77 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
78 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
79 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
80 2820007728 Unclassified Synergistetes Lab288P3bin114 Isolate Unclassified
81 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
82 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
83 8064531044 Terrisporobacter mayombei DSM 6539 Isolate Unclassified
84 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
85 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
86 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
87 2820899690 Unclassified Actinobacteria Emb289P4bin9 Isolate Unclassified
88 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
89 2740892556 Enterococcus sp. JR029-101 Isolate Unclassified
90 2820504582 Unclassified Firmicutes Lab288P1bin5 Isolate Unclassified
91 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
92 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
93 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
94 8108568626 Enterococcus sp. DIV1094 Isolate
95 8108576847 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
96 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
97 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
98 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
99 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562379_0011 3300056790 Bacteria 1623141
2 Ga0105553_1019925 3300007767 Bacteria 5528
3 Ga0466715_584264 3300042616 Bacteria 12619
4 Ga0466726_491709 3300042619 Bacteria 5531
5 Ga0466691_151509 3300042593 Bacteria 42451
6 Ga0466699_179323 3300042597 Bacteria 7742
7 Ga0466714_020610 3300042603 Bacteria 12324
8 Ga0466716_153284 3300042605 Bacteria 3702
9 Ga0466716_364727 3300042605 Bacteria 2144
10 Ga0466720_101410 3300042607 Bacteria 24290
11 Ga0466704_149713 3300042643 Bacteria 1943
12 Ga0466704_349181 3300042643 Bacteria 24462
13 Ga0123356_10003912 3300010049 Bacteria 15506
14 Ga0123356_10021227 3300010049 Bacteria 6133
15 Ga0466705_015540 3300042612 Bacteria 18829
16 Ga0466733_180186 3300042659 Bacteria 3737
17 Ga0562379_0180 3300056790 Bacteria 182121
18 Ga0562378_0234 3300056814 Unclassified 130023
19 Ga0562377_0121 3300056842 Bacteria 244322
20 Ga0562375_0100 3300056856 Bacteria 265693
21 JGI24699J35502_11134017 3300002509 Bacteria 24388
22 Ga0466723_076554 3300042618 Bacteria 3174
23 Ga0466726_023497 3300042619 Bacteria 5621
24 Ga0466728_060707 3300042620 Bacteria 27349
25 Ga0466692_101751 3300042591 Bacteria 9153
26 Ga0466707_166627 3300042601 Bacteria 4486
27 Ga0466713_130188 3300042602 Bacteria 9287
28 Ga0466719_334198 3300042606 Bacteria 7146
29 Ga0466719_555053 3300042606 Bacteria 24337
30 Ga0466703_136758 3300042636 Bacteria 2683
31 Ga0466704_446954 3300042643 Bacteria 37901
32 Ga0466708_071280 3300042652 Unclassified 6956
33 Ga0466727_007283 3300042655 Bacteria 19246
34 Ga0123356_10011537 3300010049 Bacteria 8608
35 Ga0123354_10303682 3300010882 Unclassified 1504
36 JGI24698J34947_10012101 3300002449 Bacteria 4734
37 JGI24698J34947_10029636 3300002449 Bacteria 2890
38 Ga0068305_10061910 3300005083 Bacteria 11319
39 Ga0123357_10001005 3300009784 Bacteria 28869
40 Ga0466705_411571 3300042612 Bacteria 9119
41 Ga0466711_483506 3300042615 Bacteria 4607
42 Ga0466715_314467 3300042616 Bacteria 26093
43 Ga0466715_353133 3300042616 Bacteria 33453
44 Ga0466715_462653 3300042616 Bacteria 2329
45 Ga0466723_012162 3300042618 Bacteria 2734
46 Ga0223674_1001359 3300021235 Unclassified 1724
47 Ga0466692_062004 3300042591 Bacteria 1620
48 Ga0466691_122560 3300042593 Bacteria 7137
49 Ga0466713_123130 3300042602 Bacteria 16210
50 Ga0466713_130028 3300042602 Bacteria 61506
51 Ga0466716_190094 3300042605 Bacteria 7986
52 Ga0466716_335142 3300042605 Unclassified 18209
53 Ga0466719_233678 3300042606 Bacteria 6381
54 Ga0466722_034720 3300042609 Bacteria 11820
55 Ga0466698_011111 3300042610 Bacteria 1580
56 Ga0466727_232273 3300042655 Bacteria 10216
57 Ga0123355_10029319 3300009826 Bacteria 8906
58 Ga0466733_090314 3300042659 Bacteria 23419
59 Ga0530661_000056 3300056564 Bacteria 112781
60 Ga0562379_0083 3300056790 Bacteria 343504
61 IMNBL1DRAFT_c0000349 3300000062 Bacteria 39000
62 HBC_ctgsDRAFT_1001707 3300000333 Bacteria 4833
63 JGI24702J35022_10000197 3300002462 Bacteria 32672
64 Ga0123357_10000620 3300009784 Bacteria 35228
65 Ga0466715_399815 3300042616 Bacteria 13034
66 Ga0466723_185528 3300042618 Bacteria 2477
67 Ga0466729_106339 3300042621 Bacteria 41427
68 Ga0255809_1003342 3300022820 Bacteria 2006
69 Ga0264413_102031 3300024493 Bacteria 23746
70 Ga0264413_111172 3300024493 Unclassified 6199
71 Ga0466692_178935 3300042591 Bacteria 17826
72 Ga0466691_181989 3300042593 Bacteria 31345
73 Ga0466707_287775 3300042601 Bacteria 73891
74 Ga0466713_031809 3300042602 Unclassified 7565
75 Ga0466714_027164 3300042603 Unclassified 3423
76 Ga0466714_100930 3300042603 Unclassified 3139
77 Ga0466720_179168 3300042607 Bacteria 11542
78 Ga0466735_046857 3300042624 Bacteria 6366
79 Ga0466702_192353 3300042635 Bacteria 2253
80 Ga0466703_247394 3300042636 Bacteria 6648
81 Ga0466704_010101 3300042643 Bacteria 6986
82 Ga0466704_579195 3300042643 Bacteria 3111
83 Ga0466724_00717 3300042649 Bacteria 1962
84 Ga0123355_10002977 3300009826 Bacteria 24075
85 Ga0123355_10044320 3300009826 Bacteria 7241
86 Ga0123356_10008041 3300010049 Bacteria 10497
87 Ga0123353_10046059 3300010167 Bacteria 6926
88 Ga0466705_199377 3300042612 Unclassified 5174
89 Ga0466705_203071 3300042612 Unclassified 14274
90 Ga0562379_0882 3300056790 Unclassified 44920
91 Ga0466711_080726 3300042615 Bacteria 6587
92 Ga0466711_163545 3300042615 Bacteria 5475
93 Ga0466723_122161 3300042618 Unclassified 7474
94 Ga0466723_171803 3300042618 Bacteria 59143
95 Ga0466726_459986 3300042619 Bacteria 2259
96 Ga0466728_016711 3300042620 Unclassified 29183
97 Ga0466690_015100 3300042590 Bacteria 9406
98 Ga0466693_361691 3300042592 Bacteria 2578
99 Ga0466722_101098 3300042609 Bacteria 11490
100 Ga0466703_132117 3300042636 Unclassified 2451
101 Ga0466709_103879 3300042648 Bacteria 25802
102 Ga0123357_10074262 3300009784 Bacteria 4499
103 Ga0123357_10081284 3300009784 Unclassified 4259
104 Ga0466733_138033 3300042659 Bacteria 29090
105 Ga0562375_0096 3300056856 Bacteria 273717
106 Ga0562376_0273 3300056857 Bacteria 102744
107 JGI24698J34947_10012838 3300002449 Bacteria 4583
108 JGI24699J35502_11100293 3300002509 Unclassified 2343
109 Ga0466723_140042 3300042618 Unclassified 4198
110 Ga0466723_156113 3300042618 Bacteria 8569
111 Ga0466726_064508 3300042619 Bacteria 29319
112 Ga0466726_099444 3300042619 Bacteria 2355
113 Ga0466726_172257 3300042619 Bacteria 4698
114 Ga0415639_079234 3300038395 Unclassified 5268
115 Ga0466699_094542 3300042597 Bacteria 3398
116 Ga0466699_115474 3300042597 Bacteria 10724
117 Ga0466706_065116 3300042599 Bacteria 4934
118 Ga0466719_434722 3300042606 Unclassified 4114
119 Ga0466703_110935 3300042636 Bacteria 10315
120 Ga0466704_199097 3300042643 Bacteria 4231
121 Ga0466709_105063 3300042648 Bacteria 3866
122 Ga0466708_212877 3300042652 Bacteria 79784
123 Ga0123353_10219787 3300010167 Bacteria 2972
124 Ga0123353_10322165 3300010167 Bacteria 2345
125 Ga0123354_10055614 3300010882 Bacteria 5918
126 Ga0072941_1184461 3300005201 Bacteria 15468
127 Ga0466711_099301 3300042615 Bacteria 13113
128 Ga0466715_019839 3300042616 Unclassified 1659
129 Ga0466718_067358 3300042617 Bacteria 2976
130 Ga0466723_010964 3300042618 Bacteria 19788
131 Ga0466729_192533 3300042621 Bacteria 4699
132 Ga0466691_110726 3300042593 Bacteria 19058
133 Ga0466707_379533 3300042601 Bacteria 60700
134 Ga0466713_040578 3300042602 Bacteria 2483
135 Ga0466720_179727 3300042607 Bacteria 10615
136 Ga0466722_011667 3300042609 Bacteria 11492
137 Ga0466722_041519 3300042609 Bacteria 4299
138 Ga0466722_184170 3300042609 Bacteria 4618
139 Ga0466703_017494 3300042636 Bacteria 9516
140 Ga0466724_43483 3300042649 Bacteria 15072
141 Ga0466727_266265 3300042655 Bacteria 8007
142 Ga0123357_10033701 3300009784 Bacteria 6962
143 Ga0123356_10059720 3300010049 Unclassified 3557
144 Ga0123356_10274498 3300010049 Unclassified 1777
145 Ga0123353_10233159 3300010167 Bacteria 2867
146 Ga0123353_10321404 3300010167 Bacteria 2348
147 Ga0562377_0264 3300056842 Bacteria 116515
148 Ga0562377_2616 3300056842 Unclassified 12733
149 CVPL010L_1000205 3300002932 Bacteria 21696
150 Ga0068302_10199719 3300005071 Unclassified 2489
151 Ga0466712_050234 3300042614 Bacteria 2434
152 Ga0466723_356996 3300042618 Bacteria 27577
153 Ga0466728_468774 3300042620 Bacteria 8273
154 Ga0466692_170530 3300042591 Unclassified 2390
155 Ga0466696_269984 3300042596 Bacteria 11396
156 Ga0466701_011083 3300042598 Bacteria 4776
157 Ga0466701_061069 3300042598 Bacteria 27167
158 Ga0466713_000418 3300042602 Bacteria 1724
159 Ga0466713_030932 3300042602 Bacteria 92656
160 Ga0466735_010853 3300042624 Bacteria 17037
161 Ga0466703_297824 3300042636 Bacteria 25464
162 Ga0466709_005451 3300042648 Bacteria 19590
163 Ga0466709_091746 3300042648 Unclassified 11306
164 Ga0466709_151353 3300042648 Unclassified 8034
165 Ga0466727_198980 3300042655 Bacteria 64809
166 Ga0123357_10083810 3300009784 Bacteria 4182
167 Ga0123353_10073262 3300010167 Bacteria 5504

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005201 Ga0072941_1184461 Ga0072941_118446119 401
2 iso_pr_bacteria 2740892556 2743949681 401
3 3300042606 Ga0466719_334198 Ga0466719_334198_4963_6324 402
4 3300042624 Ga0466735_010853 Ga0466735_010853_4756_6117 408
5 3300042593 Ga0466691_110726 Ga0466691_110726_10874_12232 409
6 3300042618 Ga0466723_076554 Ga0466723_076554_448_1806 409
7 3300042619 Ga0466726_491709 Ga0466726_491709_184_1542 409
8 3300024493 Ga0264413_111172 Ga0264413_1111722 411
9 3300002449 JGI24698J34947_10012838 JGI24698J34947_100128385 414
10 3300042596 Ga0466696_269984 Ga0466696_269984_7269_8636 414
11 3300042591 Ga0466692_170530 Ga0466692_170530_702_2063 415
12 3300042605 Ga0466716_335142 Ga0466716_335142_2937_4298 415
13 3300042615 Ga0466711_080726 Ga0466711_080726_383_1744 415
14 3300042655 Ga0466727_007283 Ga0466727_007283_2762_4111 415
15 3300056842 Ga0562377_0121 Ga0562377_0121_32847_34211 415
16 3300009784 Ga0123357_10081284 Ga0123357_100812842 416
17 3300042620 Ga0466728_016711 Ga0466728_016711_5720_7081 416
18 3300024493 Ga0264413_102031 Ga0264413_1020316 417
19 3300042591 Ga0466692_062004 Ga0466692_062004_45_1406 417
20 3300009784 Ga0123357_10083810 Ga0123357_100838104 418
21 3300042593 Ga0466691_181989 Ga0466691_181989_11335_12696 418
22 3300042607 Ga0466720_101410 Ga0466720_101410_12940_14301 418
23 3300042621 Ga0466729_192533 Ga0466729_192533_65_1426 418
24 3300042616 Ga0466715_353133 Ga0466715_353133_9778_11139 419
25 3300042617 Ga0466718_067358 Ga0466718_067358_1007_2368 419
26 3300042643 Ga0466704_349181 Ga0466704_349181_6699_8060 419
27 3300042652 Ga0466708_071280 Ga0466708_071280_977_2338 419
28 3300042607 Ga0466720_179168 Ga0466720_179168_9259_10620 420
29 3300042612 Ga0466705_199377 Ga0466705_199377_2409_3770 420
30 3300005083 Ga0068305_10061910 Ga0068305_100619103 421
31 3300009784 Ga0123357_10074262 Ga0123357_100742622 421
32 3300042597 Ga0466699_094542 Ga0466699_094542_832_2205 421
33 3300042597 Ga0466699_115474 Ga0466699_115474_2061_3434 421
34 3300042609 Ga0466722_041519 Ga0466722_041519_107_1486 423
35 3300042635 Ga0466702_192353 Ga0466702_192353_458_1819 423
36 3300042602 Ga0466713_130188 Ga0466713_130188_2685_4055 424
37 3300042636 Ga0466703_017494 Ga0466703_017494_4587_5957 424
38 3300042606 Ga0466719_233678 Ga0466719_233678_2734_4092 425
39 3300042602 Ga0466713_031809 Ga0466713_031809_5140_6510 426
40 3300042612 Ga0466705_203071 Ga0466705_203071_1098_2459 426
41 3300042618 Ga0466723_185528 Ga0466723_185528_944_2311 426
42 3300042636 Ga0466703_247394 Ga0466703_247394_78_1439 426
43 3300042607 Ga0466720_179727 Ga0466720_179727_2690_4051 427
44 3300042616 Ga0466715_019839 Ga0466715_019839_195_1556 427
45 3300042618 Ga0466723_122161 Ga0466723_122161_496_1857 427
46 3300021235 Ga0223674_1001359 Ga0223674_10013591 428
47 3300038395 Ga0415639_079234 Ga0415639_079234_3001_4287 428
48 3300042606 Ga0466719_434722 Ga0466719_434722_1560_2921 428
49 3300042609 Ga0466722_101098 Ga0466722_101098_8981_10348 428
50 3300042609 Ga0466722_184170 Ga0466722_184170_211_1572 428
51 3300042612 Ga0466705_411571 Ga0466705_411571_5137_6498 428
52 3300042618 Ga0466723_171803 Ga0466723_171803_5497_6858 428
53 3300010167 Ga0123353_10219787 Ga0123353_102197872 429
54 3300010882 Ga0123354_10055614 Ga0123354_100556144 429
55 3300042598 Ga0466701_011083 Ga0466701_011083_1449_2813 429
56 3300042636 Ga0466703_297824 Ga0466703_297824_19964_21355 430
57 3300042655 Ga0466727_232273 Ga0466727_232273_8279_9646 430
58 3300042602 Ga0466713_130028 Ga0466713_130028_9895_11271 431
59 3300009784 Ga0123357_10001005 Ga0123357_1000100520 432
60 3300042601 Ga0466707_166627 Ga0466707_166627_517_1899 433
61 3300042648 Ga0466709_091746 Ga0466709_091746_4468_5829 433
62 3300042618 Ga0466723_140042 Ga0466723_140042_1680_3041 434
63 3300042643 Ga0466704_149713 Ga0466704_149713_345_1727 434
64 3300042648 Ga0466709_151353 Ga0466709_151353_2961_4325 434
65 3300009784 Ga0123357_10033701 Ga0123357_100337017 435
66 3300042598 Ga0466701_061069 Ga0466701_061069_6764_8146 435
67 3300042593 Ga0466691_122560 Ga0466691_122560_3269_4630 437
68 3300042609 Ga0466722_034720 Ga0466722_034720_28_1389 437
69 3300042615 Ga0466711_163545 Ga0466711_163545_3759_5120 437
70 3300042616 Ga0466715_462653 Ga0466715_462653_298_1662 440
71 3300042643 Ga0466704_579195 Ga0466704_579195_1255_2628 441
72 3300042648 Ga0466709_105063 Ga0466709_105063_986_2356 441
73 3300042648 Ga0466709_005451 Ga0466709_005451_8535_9902 442
74 3300042597 Ga0466699_179323 Ga0466699_179323_4374_5783 443
75 3300042618 Ga0466723_010964 Ga0466723_010964_13967_15298 443
76 3300042643 Ga0466704_010101 Ga0466704_010101_4060_5421 443
77 3300042615 Ga0466711_099301 Ga0466711_099301_5376_6737 445
78 3300042643 Ga0466704_446954 Ga0466704_446954_2899_4236 445
79 3300000333 HBC_ctgsDRAFT_1001707 HBC_ctgsDRAFT_10017074 446
80 3300042602 Ga0466713_000418 Ga0466713_000418_301_1671 446
81 3300042612 Ga0466705_015540 Ga0466705_015540_9345_10715 447
82 3300042614 Ga0466712_050234 Ga0466712_050234_939_2300 447
83 3300042619 Ga0466726_172257 Ga0466726_172257_2906_4249 447
84 3300042643 Ga0466704_199097 Ga0466704_199097_953_2323 447
85 3300002509 JGI24699J35502_11100293 JGI24699J35502_111002932 448
86 3300042599 Ga0466706_065116 Ga0466706_065116_3332_4678 448
87 3300042620 Ga0466728_060707 Ga0466728_060707_8949_10319 448
88 3300042590 Ga0466690_015100 Ga0466690_015100_5240_6679 452
89 3300042605 Ga0466716_364727 Ga0466716_364727_300_1658 452
90 iso_pr_bacteria 2590828841 2593261424 452
91 iso_pr_bacteria 2636416028 2638992127 452
92 3300022820 Ga0255809_1003342 Ga0255809_10033421 453
93 3300042591 Ga0466692_101751 Ga0466692_101751_2930_4291 453
94 3300042591 Ga0466692_178935 Ga0466692_178935_12788_14149 453
95 3300042593 Ga0466691_151509 Ga0466691_151509_39116_40477 453
96 3300042609 Ga0466722_011667 Ga0466722_011667_561_1922 453
97 3300042616 Ga0466715_584264 Ga0466715_584264_10632_11993 453
98 3300042618 Ga0466723_012162 Ga0466723_012162_242_1603 453
99 3300042618 Ga0466723_356996 Ga0466723_356996_1295_2656 453
100 3300042619 Ga0466726_023497 Ga0466726_023497_1084_2445 453
101 3300042636 Ga0466703_110935 Ga0466703_110935_340_1701 453
102 3300042636 Ga0466703_132117 Ga0466703_132117_918_2279 453
103 3300042636 Ga0466703_136758 Ga0466703_136758_1026_2387 453
104 3300042655 Ga0466727_266265 Ga0466727_266265_3819_5180 453
105 iso_pr_bacteria 2524614537 2524833910 453
106 iso_pr_bacteria 8064531044 8064531485 453
107 3300002449 JGI24698J34947_10012101 JGI24698J34947_100121015 454
108 3300002449 JGI24698J34947_10029636 JGI24698J34947_100296363 454
109 3300009826 Ga0123355_10002977 Ga0123355_100029775 454
110 3300009826 Ga0123355_10029319 Ga0123355_100293194 454
111 3300010049 Ga0123356_10008041 Ga0123356_1000804111 454
112 3300010167 Ga0123353_10073262 Ga0123353_100732622 454
113 3300042592 Ga0466693_361691 Ga0466693_361691_505_1869 454
114 3300042601 Ga0466707_287775 Ga0466707_287775_40364_41728 454
115 3300042606 Ga0466719_555053 Ga0466719_555053_1860_3224 454
116 3300042616 Ga0466715_314467 Ga0466715_314467_16203_17600 454
117 3300042659 Ga0466733_090314 Ga0466733_090314_14938_16302 454
118 3300042659 Ga0466733_180186 Ga0466733_180186_1558_2922 454
119 3300056564 Ga0530661_000056 Ga0530661_000056_22899_24263 454
120 3300056790 Ga0562379_0011 Ga0562379_0011_1261413_1262777 454
121 3300056790 Ga0562379_0083 Ga0562379_0083_92207_93571 454
122 3300056790 Ga0562379_0180 Ga0562379_0180_118778_120142 454
123 3300056790 Ga0562379_0882 Ga0562379_0882_1932_3296 454
124 3300056814 Ga0562378_0234 Ga0562378_0234_51280_52644 454
125 3300056842 Ga0562377_0264 Ga0562377_0264_99163_100527 454
126 3300056842 Ga0562377_2616 Ga0562377_2616_8095_9459 454
127 3300056856 Ga0562375_0096 Ga0562375_0096_202616_203980 454
128 3300056856 Ga0562375_0100 Ga0562375_0100_59349_60713 454
129 3300056857 Ga0562376_0273 Ga0562376_0273_59758_61122 454
130 iso_pr_bacteria 2523231078 2523494199 454
131 iso_pr_bacteria 2524614537 2524834158 454
132 iso_pr_bacteria 2585428141 2588053115 454
133 iso_pr_bacteria 2751185832 2753510697 454
134 iso_pr_bacteria 2808606958 2811758816 454
135 iso_pr_bacteria 2820290662 2820290723 454
136 iso_pr_bacteria 2827179085 2827184312 454
137 iso_pr_bacteria 2834951433 2834952904 454
138 iso_pr_bacteria 2836667214 2836670583 454
139 iso_pr_bacteria 2843246524 2843249619 454
140 iso_pr_bacteria 2849099867 2849100750 454
141 iso_pr_bacteria 2849104611 2849105819 454
142 iso_pr_bacteria 2850744690 2850745788 454
143 iso_pr_bacteria 2852123468 2852123911 454
144 iso_pr_bacteria 2852431164 2852432838 454
145 iso_pr_bacteria 2852431164 2852432983 454
146 iso_pr_bacteria 2855361764 2855361831 454
147 iso_pr_bacteria 2864981449 2864981637 454
148 iso_pr_bacteria 2940218408 2940218658 454
149 iso_pr_bacteria 2940261461 2940261766 454
150 iso_pr_bacteria 2971438493 2971439071 454
151 iso_pr_bacteria 641736255 641741059 454
152 iso_pr_bacteria 646311952 646428093 454
153 iso_pr_bacteria 647533136 647747942 454
154 iso_pr_bacteria 8038268975 8038271517 454
155 iso_pr_bacteria 8077780672 8077782096 454
156 iso_pr_bacteria 8108568626 8108568987 454
157 iso_pr_bacteria 8114555646 8114556007 454
158 3300002509 JGI24699J35502_11134017 JGI24699J35502_1113401728 455
159 3300002932 CVPL010L_1000205 CVPL010L_10002057 455
160 3300007767 Ga0105553_1019925 Ga0105553_10199253 455
161 3300042603 Ga0466714_020610 Ga0466714_020610_5665_7032 455
162 3300042603 Ga0466714_027164 Ga0466714_027164_2022_3389 455
163 3300042603 Ga0466714_100930 Ga0466714_100930_722_2089 455
164 3300042619 Ga0466726_459986 Ga0466726_459986_709_2076 455
165 3300042621 Ga0466729_106339 Ga0466729_106339_34534_35901 455
166 iso_pr_bacteria 2820007728 2820008720 455
167 iso_pr_bacteria 2820223845 2820224335 455
168 iso_pr_bacteria 2820899690 2820900523 455
169 iso_pr_bacteria 2820901319 2820903419 455
170 iso_pr_bacteria 8108576847 8108577529 455
171 iso_pr_bacteria 8114541043 8114542059 455
172 3300002462 JGI24702J35022_10000197 JGI24702J35022_1000019724 456
173 3300009784 Ga0123357_10000620 Ga0123357_100006209 456
174 3300009826 Ga0123355_10044320 Ga0123355_100443204 456
175 3300010049 Ga0123356_10003912 Ga0123356_100039129 456
176 3300010049 Ga0123356_10011537 Ga0123356_100115373 456
177 3300010049 Ga0123356_10021227 Ga0123356_100212277 456
178 3300010049 Ga0123356_10059720 Ga0123356_100597202 456
179 3300010049 Ga0123356_10274498 Ga0123356_102744982 456
180 3300010167 Ga0123353_10046059 Ga0123353_100460597 456
181 3300010167 Ga0123353_10321404 Ga0123353_103214042 456
182 3300010167 Ga0123353_10322165 Ga0123353_103221652 456
183 3300010882 Ga0123354_10303682 Ga0123354_103036821 456
184 3300042601 Ga0466707_379533 Ga0466707_379533_28201_29571 456
185 3300042620 Ga0466728_468774 Ga0466728_468774_6166_7536 456
186 3300042624 Ga0466735_046857 Ga0466735_046857_3310_4680 456
187 3300000062 IMNBL1DRAFT_c0000349 IMNBL1DRAFT_000034919 457
188 3300042605 Ga0466716_153284 Ga0466716_153284_2057_3430 457
189 3300042616 Ga0466715_399815 Ga0466715_399815_3507_4880 457
190 3300042648 Ga0466709_103879 Ga0466709_103879_21320_22693 457
191 3300042649 Ga0466724_00717 Ga0466724_00717_166_1539 457
192 3300042602 Ga0466713_030932 Ga0466713_030932_69256_70632 458
193 3300042610 Ga0466698_011111 Ga0466698_011111_143_1519 458
194 3300042615 Ga0466711_483506 Ga0466711_483506_2031_3407 458
195 3300042618 Ga0466723_156113 Ga0466723_156113_6710_8086 458
196 3300042652 Ga0466708_212877 Ga0466708_212877_57963_59339 458
197 3300042602 Ga0466713_040578 Ga0466713_040578_145_1524 459
198 3300042602 Ga0466713_123130 Ga0466713_123130_11912_13291 459
199 3300042649 Ga0466724_43483 Ga0466724_43483_3683_5062 459
200 3300042659 Ga0466733_138033 Ga0466733_138033_11872_13251 459
201 iso_pr_bacteria 2820504582 2820504746 459
202 3300042605 Ga0466716_190094 Ga0466716_190094_758_2167 460
203 iso_pr_bacteria 2820944107 2820944440 461
204 3300042655 Ga0466727_198980 Ga0466727_198980_39191_40579 462
205 3300042619 Ga0466726_064508 Ga0466726_064508_12814_14205 463
206 iso_pr_bacteria 2820027804 2820029720 464
207 3300010167 Ga0123353_10233159 Ga0123353_102331592 465
208 3300005071 Ga0068302_10199719 Ga0068302_101997192 479
209 3300042619 Ga0466726_099444 Ga0466726_099444_443_1888 481

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF06751 EutB Ethanolamine ammonia lyase large subunit (EutB) 15 447 0.99

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.94 0.94 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.