Protein Family IF09766
Metagenome
Isolate
609
Members
476
Samples
229
Scaffolds
521.31
Avg Length
Representative Sequence
- ID
- 3300042649|Ga0466724_38911|Ga0466724_38911_16594_18333
- Length
- 579 aa
- Sequence
- MPAQFEVRISHRAACSGAFAHHVVYENASSVCFFASHAPKIFRSRIRSRTILQEEHSMLDTNLKTQLKGYLERLVRPVEIIAYAGDDAKSLELLQLLEQIREQSDKITVKRGDVEGARIPSFALTSPGENIHLTFAGLPLGHEFTSLVLALLQVGGYPPKVEQALIDQIRGVKGTFRFETYYSLSCQNCPDVVQALNLMAVLNPGIEHVAIDGALFQDEVADRQVMSVPSIFLNGEVFGSGRMGAEEILAKIDTGAAARAADAVSAQAPFDVLVVGGGPAGAAAAIYAARKGIRTGIVADRFGGQVLDTMSIENFISVTHTEGPKLARAMETHVRDYDAEIMSGQQAVKLERTSKGFKVELASGATLTSTSIILSTGARWRKMGVPGEEQYINKGVAFCPHCDGPLFKGKRIAVIGGGNSGVEAAIDLAGLVSHVTLLEFDKTLRADEVLQRKLKSLPNVTILTSAKTTEVTGDGKRVNGLVYEDRVSGEKHNVALEGVFVQIGLVPNTEWLKGTLSLNDRGEIITDNHGATSVPGVFAAGDCTTAPYKQIVIAMGEGARSSLAAFDYLIRLPAEEQAA
Sample Types
Isolate
62.4%
Metagenome
37.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
18.2%
Coreidae
17.5%
Apidae
15.5%
Drosophilidae
8.1%
Formicidae
4.8%
Elmidae
3.3%
Termitidae
3.1%
Muscidae
2.8%
Curculionidae
2.8%
Culicidae
2.8%
Tenebrionidae
2.2%
Kalotermitidae
2.2%
Armadillidiidae
2.2%
Calliphoridae
2.0%
Anthocoridae
1.5%
Pteromalidae
0.7%
Talitridae
0.7%
Tephritidae
0.7%
Rhinotermitidae
0.7%
Palinuridae
0.7%
Plutellidae
0.4%
Berytidae
0.4%
Cerambycidae
0.4%
Passalidae
0.4%
Penaeidae
0.4%
Sarcophagidae
0.4%
Largidae
0.4%
Hydrophilidae
0.4%
Termopsidae
0.4%
Siricidae
0.2%
Crambidae
0.2%
Scarabaeidae
0.2%
Trigoniulidae
0.2%
Nephropidae
0.2%
Thripidae
0.2%
Anthomyiidae
0.2%
Pediculidae
0.2%
Cimicidae
0.2%
Artemiidae
0.2%
Lysianassidae
0.2%
Hodotermitidae
0.2%
Rhopalidae
0.2%
Pentatomidae
0.2%
Carabidae
0.2%
Noctuidae
0.2%
Alydidae
0.2%
Taxonomy
Archaea
0
Bacteria
570
Eukaryota
0
Viruses
0
Unclassified
39
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 2 | 2837563510 | Snodgrassella alvi N-S1 | Isolate | Apidae |
| 3 | 2839192570 | Gluconobacter sp. DsW_056 | Isolate | Drosophilidae |
| 4 | 2843299038 | Snodgrassella alvi N-S2 | Isolate | Apidae |
| 5 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 6 | 2846368606 | Snodgrassella alvi A-11-12 | Isolate | Apidae |
| 7 | 2849404451 | Snodgrassella alvi E1 | Isolate | Apidae |
| 8 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 9 | 2854088767 | Snodgrassella alvi MS1-3 | Isolate | Apidae |
| 10 | 2854104879 | Snodgrassella alvi Fer2-2 | Isolate | Apidae |
| 11 | 2857840086 | Snodgrassella alvi Aw-20 | Isolate | Apidae |
| 12 | 2868461634 | Snodgrassella alvi Gris2-3-4 | Isolate | Apidae |
| 13 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 14 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 15 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 16 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 17 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 18 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 19 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 20 | 2585427605 | Colwellia sp. MT2012 | Isolate | |
| 21 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 22 | 2636415586 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 23 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 24 | 2684622927 | Snodgrassella alvi Sa_196 | Isolate | Unclassified |
| 25 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 26 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 27 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 28 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 29 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 30 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 31 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 32 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 33 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 34 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 35 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 36 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 37 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 38 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 39 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 40 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 41 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 42 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 43 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 44 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 45 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 46 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 47 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 48 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 49 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 50 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 51 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 52 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 53 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 54 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 55 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 56 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 57 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 58 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 59 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 60 | 2846376288 | Snodgrassella alvi Fer4-2 | Isolate | Apidae |
| 61 | 2846379220 | Snodgrassella alvi wkB237 | Isolate | Apidae |
| 62 | 2849399727 | Snodgrassella alvi Fer1-2 | Isolate | Apidae |
| 63 | 2849402121 | Snodgrassella alvi A-10-12 | Isolate | Apidae |
| 64 | 2849409164 | Snodgrassella alvi wkB298 | Isolate | Apidae |
| 65 | 2849413536 | Snodgrassella alvi N-S4 | Isolate | Apidae |
| 66 | 2854091108 | Snodgrassella alvi wkB339 | Isolate | Apidae |
| 67 | 2854095577 | Snodgrassella alvi A12 | Isolate | Apidae |
| 68 | 2857837414 | Snodgrassella alvi App4-8 | Isolate | Apidae |
| 69 | 2864874997 | Acinetobacter lwoffii S00127 | Isolate | Elmidae |
| 70 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 71 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 72 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 73 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 74 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 75 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 76 | 2548876789 | Xanthomonas sacchari NCPPB 4393 | Isolate | |
| 77 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 78 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 79 | 2681813507 | Insolitispirillum peregrinum integrum DSM 11589 | Isolate | Unclassified |
| 80 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 81 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 82 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 83 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 84 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 85 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 86 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 87 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 88 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 89 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 90 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 91 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 92 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 93 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 94 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 95 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 96 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 97 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 98 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 99 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 100 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 101 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 102 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 103 | 8067591850 | Gluconobacter kondonii Dm-47 | Isolate | Drosophilidae |
| 104 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 105 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 106 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 107 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 108 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 109 | 8100528075 | Gluconobacter sp. Dm-44 | Isolate | Drosophilidae |
| 110 | 8101272231 | Snodgrassella sp. W8132 | Isolate | Apidae |
| 111 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 112 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 113 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 114 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 115 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 116 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 117 | 2837560943 | Snodgrassella alvi HK3 | Isolate | Apidae |
| 118 | 2840743474 | Snodgrassella alvi N-23 | Isolate | Apidae |
| 119 | 2846366200 | Snodgrassella alvi Gris3-4 | Isolate | Apidae |
| 120 | 2846370940 | Snodgrassella alvi Nev3CBA3 | Isolate | Apidae |
| 121 | 2857842411 | Snodgrassella alvi Ruf1-X | Isolate | Apidae |
| 122 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 123 | 2864761044 | Stenotrophomonas rhizophilia S00008 | Isolate | Elmidae |
| 124 | 2864863795 | Acinetobacter johnsonii S00116 | Isolate | Elmidae |
| 125 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 126 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 127 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 128 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 129 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 130 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 131 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 132 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 133 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 134 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 135 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 136 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 137 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 138 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 139 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 140 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 141 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 142 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 143 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 144 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 145 | 3002394112 | Gluconobacter sp. Gdi | Isolate | Drosophilidae |
| 146 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 147 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 148 | 3006156446 | Acinetobacter baretiae B10A | Isolate | Apidae |
| 149 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 150 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 151 | 3300000460 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O02 | Metagenome | Apidae |
| 152 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 153 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 154 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 155 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 156 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 157 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 158 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 159 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 160 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 161 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 162 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 163 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 164 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 165 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 166 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 167 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 168 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 169 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 170 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 171 | 8067588748 | Gluconobacter kondonii Dm-42 | Isolate | Drosophilidae |
| 172 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 173 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 174 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 175 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 176 | 8101255641 | Snodgrassella sp. M0110 | Isolate | Apidae |
| 177 | 8101260589 | Snodgrassella sp. M0118 | Isolate | Apidae |
| 178 | 8101267702 | Snodgrassella sp. W6238H14 | Isolate | Apidae |
| 179 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 180 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 181 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 182 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 183 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 184 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 185 | 2846361553 | Snodgrassella alvi PEB0171 | Isolate | Apidae |
| 186 | 2849417936 | Snodgrassella alvi N9 | Isolate | Apidae |
| 187 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 188 | 2852205774 | Snodgrassella alvi ESL0196 | Isolate | Apidae |
| 189 | 2854086477 | Snodgrassella alvi N-S3 | Isolate | Apidae |
| 190 | 2854097802 | Snodgrassella alvi Aw-18 | Isolate | Apidae |
| 191 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 192 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 193 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 194 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 195 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 196 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 197 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 198 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 199 | 2513237393 | Gluconobacter morbifer G707 | Isolate | Drosophilidae |
| 200 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 201 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 202 | 2585427850 | Snodgrassella alvi wkB12 | Isolate | Apidae |
| 203 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 204 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 205 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 206 | 2811994808 | Snodgrassella alvi Sa_196 v2 | Isolate | Unclassified |
| 207 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 208 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 209 | 2820132692 | Unclassified Proteobacteria Emb289P3bin76 | Isolate | Unclassified |
| 210 | 2820518089 | Unclassified Firmicutes Lab288P1bin27 | Isolate | Unclassified |
| 211 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 212 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 213 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 214 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 215 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 216 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 217 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 218 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 219 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 220 | 641522603 | Acinetobacter baumannii SDF | Isolate | Pediculidae |
| 221 | 646564587 | Tsukamurella paurometabola 33, DSM 20162 | Isolate | Cimicidae |
| 222 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 223 | 8022087107 | Vibrio sp. OULL4 | Isolate | Unclassified |
| 224 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 225 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 226 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 227 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 228 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 229 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 230 | 8100534375 | Gluconobacter sp. Dm-74 | Isolate | Drosophilidae |
| 231 | 8101265296 | Snodgrassella sp. W8158 | Isolate | Apidae |
| 232 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 233 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 234 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 235 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 236 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 237 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 238 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 239 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 240 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 241 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 242 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 243 | 8119099601 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 244 | 2854100132 | Snodgrassella alvi A-2-12 | Isolate | Apidae |
| 245 | 2857827427 | Snodgrassella alvi App6-4 | Isolate | Apidae |
| 246 | 2857832487 | Snodgrassella alvi HK9x | Isolate | Apidae |
| 247 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 248 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 249 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 250 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 251 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 252 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 253 | 2501651205 | Colwellia sp. MT41 | Isolate | Lysianassidae |
| 254 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 255 | 2585428136 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 256 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 257 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 258 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 259 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 260 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 261 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 262 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 263 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 264 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 265 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 266 | 3300000475 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-J21 | Metagenome | Apidae |
| 267 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 268 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 269 | 3300005309 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut | Metagenome | Drosophilidae |
| 270 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 271 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 272 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 273 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 274 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 275 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 276 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 277 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 278 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 279 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 280 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 281 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 282 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 283 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 284 | 8067579126 | Gluconobacter kondonii Dm-16 | Isolate | Drosophilidae |
| 285 | 8067581993 | Gluconobacter kondonii Dm-54 | Isolate | Drosophilidae |
| 286 | 8067598439 | Gluconobacter wancherniae Dm-17 | Isolate | Drosophilidae |
| 287 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 288 | 8101270055 | Snodgrassella sp. W8124 | Isolate | Apidae |
| 289 | 8101278866 | Snodgrassella sp. W6238H11 | Isolate | Apidae |
| 290 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 291 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 292 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 293 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 294 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 295 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 296 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 297 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 298 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 299 | 2834412944 | Snodgrassella alvi A-5-24 | Isolate | Apidae |
| 300 | 2834415282 | Snodgrassella alvi Occ4-2 | Isolate | Apidae |
| 301 | 2841175817 | Komagataeibacter saccharivorans JH1 | Isolate | Unclassified |
| 302 | 2846359427 | Snodgrassella alvi wkB273 | Isolate | Apidae |
| 303 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 304 | 2857825141 | Snodgrassella alvi wkB332 | Isolate | Apidae |
| 305 | 2857830159 | Snodgrassella alvi A-9-24 | Isolate | Apidae |
| 306 | 2864973726 | Acinetobacter schindleri S00243 | Isolate | Elmidae |
| 307 | 2864976888 | Novosphingobium chloroacetimidivorans S00245 | Isolate | Elmidae |
| 308 | 2868464004 | Snodgrassella alvi Pens2-2-5 | Isolate | Apidae |
| 309 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 310 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 311 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 312 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 313 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 314 | 2189573031 | Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. | Metagenome | Apidae |
| 315 | 2585428048 | Colwellia sp. NBT2012 | Isolate | |
| 316 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 317 | 2648501628 | Xanthomonas sp. Cag60 | Isolate | Unclassified |
| 318 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 319 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 320 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 321 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 322 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 323 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 324 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 325 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 326 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 327 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 328 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 329 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 330 | 3300005317 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 2 gut | Metagenome | Drosophilidae |
| 331 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 332 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 333 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 334 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 335 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 336 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 337 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 338 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 339 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 340 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 341 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 342 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 343 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 344 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 345 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 346 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 347 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 348 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 349 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 350 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 351 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 352 | 8067594896 | Gluconobacter kondonii Dm-18 | Isolate | Drosophilidae |
| 353 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 354 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 355 | 8100531325 | Gluconobacter sp. Dm-73 | Isolate | Drosophilidae |
| 356 | 8101258116 | Snodgrassella sp. M0112 | Isolate | Apidae |
| 357 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 358 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 359 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 360 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 361 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 362 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 363 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 364 | 2846373876 | Snodgrassella alvi Gris1-3 | Isolate | Apidae |
| 365 | 2848751009 | Snodgrassella alvi App2-2 | Isolate | Apidae |
| 366 | 2849411303 | Snodgrassella alvi A3 | Isolate | Apidae |
| 367 | 2854084220 | Snodgrassella alvi Snod2-1-5 | Isolate | Apidae |
| 368 | 2854093395 | Snodgrassella alvi N-S5 | Isolate | Apidae |
| 369 | 2854102457 | Snodgrassella alvi Gris1-6 | Isolate | Apidae |
| 370 | 2857835046 | Snodgrassella alvi wkB9 | Isolate | Apidae |
| 371 | 2857845033 | Snodgrassella alvi WF3-3 | Isolate | Apidae |
| 372 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 373 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 374 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 375 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 376 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 377 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 378 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 379 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 380 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 381 | 2531839311 | Acinetobacter sp. HA | Isolate | Noctuidae |
| 382 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 383 | 2585427851 | Snodgrassella alvi wkB29 | Isolate | Apidae |
| 384 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 385 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 386 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 387 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 388 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 389 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 390 | 2820309449 | Unclassified Firmicutes Th196P1bin10 | Isolate | Unclassified |
| 391 | 3002401049 | Gluconobacter sp. Dm-62 | Isolate | Drosophilidae |
| 392 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 393 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 394 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 395 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 396 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 397 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 398 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 399 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 400 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 401 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 402 | 3300026558 | Army ant gut microbial communities from Labidus praedator, Monteverde, Costa Rica - colony MVLprae1 | Metagenome | Formicidae |
| 403 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 404 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 405 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 406 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 407 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 408 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 409 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 410 | 8067585538 | Gluconobacter kondonii Dm-68 | Isolate | Drosophilidae |
| 411 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 412 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 413 | 8101274435 | Snodgrassella sp. W8134 | Isolate | Apidae |
| 414 | 8101276651 | Snodgrassella sp. W8135 | Isolate | Apidae |
| 415 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 416 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 417 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 418 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 419 | 2834038347 | Gluconobacter sp. DsW_058 | Isolate | Drosophilidae |
| 420 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 421 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 422 | 2840748007 | Snodgrassella alvi A-1-12 | Isolate | Apidae |
| 423 | 2843301220 | Snodgrassella alvi Nev4-2 | Isolate | Apidae |
| 424 | 2846363972 | Snodgrassella alvi N-W7 | Isolate | Apidae |
| 425 | 2849406737 | Snodgrassella alvi PEB0178 | Isolate | Apidae |
| 426 | 2849415715 | Snodgrassella alvi A2 | Isolate | Apidae |
| 427 | 2857822956 | Snodgrassella alvi N-W4 | Isolate | Apidae |
| 428 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 429 | 2864840607 | Acinetobacter johnsonii S00071 | Isolate | Elmidae |
| 430 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 431 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 432 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 433 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 434 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 435 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 436 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 437 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 438 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 439 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 440 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 441 | 2671180705 | Pseudoalteromonas piscicida S2040 | Isolate | Unclassified |
| 442 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 443 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 444 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 445 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 446 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 447 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 448 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 449 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 450 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 451 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 452 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 453 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 454 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 455 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 456 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 457 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 458 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 459 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 460 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 461 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 462 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 463 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 464 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 465 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 466 | 8067604290 | Gluconobacter wancherniae Dm-19 | Isolate | Drosophilidae |
| 467 | 8067607133 | Gluconobacter wancherniae Dm-15 | Isolate | Drosophilidae |
| 468 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 469 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 470 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 471 | 8101263066 | Snodgrassella sp. M0351 | Isolate | Apidae |
| 472 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 473 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 474 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 475 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 476 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466701_103106 | 3300042598 | Bacteria | 35693 |
| 2 | Ga0466706_218405 | 3300042599 | Bacteria | 3689 |
| 3 | Ga0466713_014081 | 3300042602 | Bacteria | 234884 |
| 4 | Ga0466703_188833 | 3300042636 | Bacteria | 4589 |
| 5 | Ga0466703_264222 | 3300042636 | Bacteria | 3132 |
| 6 | Ga0466727_063339 | 3300042655 | Bacteria | 3741 |
| 7 | Ga0160432_100889 | 3300012818 | Bacteria | 12960 |
| 8 | Ga0160472_100339 | 3300012839 | Bacteria | 43504 |
| 9 | Ga0160444_100011 | 3300012841 | Bacteria | 469738 |
| 10 | Ga0160434_100316 | 3300012850 | Bacteria | 16644 |
| 11 | Ga0160457_1002544 | 3300012858 | Unclassified | 3693 |
| 12 | Ga0247290_00747 | 3300035364 | Unclassified | 4993 |
| 13 | FGTW_contig31000 | 2065487013 | Unclassified | 6971 |
| 14 | IMNBGM34_c001137 | 3300000036 | Bacteria | 5101 |
| 15 | CVPL010W_10003096 | 3300002931 | Unclassified | 19491 |
| 16 | Ga0102739_1000018 | 3300007095 | Bacteria | 56949 |
| 17 | Ga0102734_1003099 | 3300007129 | Bacteria | 3801 |
| 18 | Ga0103264_1001941 | 3300007188 | Bacteria | 9205 |
| 19 | Ga0103268_1000090 | 3300007192 | Bacteria | 32877 |
| 20 | Ga0105005_1039878 | 3300007505 | Bacteria | 3718 |
| 21 | Ga0562375_0382 | 3300056856 | Bacteria | 99772 |
| 22 | Ga0562374_0001 | 3300057007 | Bacteria | 4762007 |
| 23 | Ga0466719_268978 | 3300042606 | Bacteria | 7949 |
| 24 | Ga0466722_115427 | 3300042609 | Bacteria | 2644 |
| 25 | Ga0466730_063200 | 3300042625 | Unclassified | 4955 |
| 26 | Ga0466730_082030 | 3300042625 | Unclassified | 27589 |
| 27 | Ga0466703_219311 | 3300042636 | Bacteria | 22299 |
| 28 | Ga0466703_284345 | 3300042636 | Bacteria | 3877 |
| 29 | Ga0466704_277882 | 3300042643 | Bacteria | 22219 |
| 30 | Ga0466724_20908 | 3300042649 | Bacteria | 57239 |
| 31 | Ga0466724_52101 | 3300042649 | Bacteria | 52387 |
| 32 | Ga0466727_079427 | 3300042655 | Bacteria | 46012 |
| 33 | Ga0466726_021299 | 3300042619 | Bacteria | 1860 |
| 34 | Ga0160472_100032 | 3300012839 | Bacteria | 274326 |
| 35 | Ga0160472_100305 | 3300012839 | Bacteria | 50196 |
| 36 | Ga0160445_102781 | 3300012847 | Unclassified | 3838 |
| 37 | Ga0255572_1003062 | 3300026175 | Bacteria | 13299 |
| 38 | Ga0123357_10253677 | 3300009784 | Unclassified | 1876 |
| 39 | Ga0123355_10011817 | 3300009826 | Bacteria | 13489 |
| 40 | Ga0123356_10039913 | 3300010049 | Bacteria | 4373 |
| 41 | FGTW_contig30601 | 2065487013 | Unclassified | 14533 |
| 42 | SCG598J21_12987 | 3300000475 | Bacteria | 122566 |
| 43 | Ga0074278_154690 | 3300005721 | Bacteria | 7719 |
| 44 | Ga0103263_103274 | 3300007042 | Bacteria | 1943 |
| 45 | Ga0102736_1000831 | 3300007052 | Bacteria | 6101 |
| 46 | Ga0103265_1002045 | 3300007068 | Bacteria | 4051 |
| 47 | Ga0103261_1000075 | 3300007083 | Unclassified | 25209 |
| 48 | Ga0102734_1000116 | 3300007129 | Bacteria | 25619 |
| 49 | Ga0103260_1001091 | 3300007139 | Bacteria | 5174 |
| 50 | Ga0103260_1001891 | 3300007139 | Unclassified | 3642 |
| 51 | Ga0466701_029585 | 3300042598 | Bacteria | 129201 |
| 52 | Ga0466701_041012 | 3300042598 | Bacteria | 318638 |
| 53 | Ga0466701_042248 | 3300042598 | Bacteria | 8270 |
| 54 | Ga0466701_095998 | 3300042598 | Bacteria | 74399 |
| 55 | Ga0466706_043023 | 3300042599 | Bacteria | 6682 |
| 56 | Ga0466706_075537 | 3300042599 | Bacteria | 9307 |
| 57 | Ga0466713_095465 | 3300042602 | Bacteria | 5147 |
| 58 | Ga0466713_148277 | 3300042602 | Bacteria | 181035 |
| 59 | Ga0466719_197986 | 3300042606 | Bacteria | 32213 |
| 60 | Ga0466730_005028 | 3300042625 | Bacteria | 26317 |
| 61 | Ga0466730_040756 | 3300042625 | Unclassified | 11313 |
| 62 | Ga0466730_051692 | 3300042625 | Unclassified | 12210 |
| 63 | Ga0160470_100314 | 3300012813 | Bacteria | 28102 |
| 64 | Ga0160431_100263 | 3300012828 | Bacteria | 33598 |
| 65 | Ga0160435_1000086 | 3300012857 | Bacteria | 54466 |
| 66 | Ga0265387_1000047 | 3300024582 | Unclassified | 40475 |
| 67 | Ga0255576_1000001 | 3300026558 | Bacteria | 687723 |
| 68 | Ga0466657_102857 | 3300042582 | Bacteria | 60730 |
| 69 | Ga0466691_038707 | 3300042593 | Bacteria | 2678 |
| 70 | Ga0123355_10005106 | 3300009826 | Bacteria | 19143 |
| 71 | gam1t_NODE_584920_length=7719_GC=34_8_Contigs=1 | 2189573031 | Bacteria | 7719 |
| 72 | JGI24702J35022_10057502 | 3300002462 | Bacteria | 2076 |
| 73 | JGI24700J35501_10930819 | 3300002508 | Bacteria | 25533 |
| 74 | Ga0063521_1000288 | 3300003973 | Bacteria | 30889 |
| 75 | Ga0102736_1000051 | 3300007052 | Bacteria | 111370 |
| 76 | Ga0102735_1000027 | 3300007080 | Bacteria | 37306 |
| 77 | Ga0102740_1001890 | 3300007140 | Bacteria | 5051 |
| 78 | Ga0102738_1000020 | 3300007141 | Bacteria | 131526 |
| 79 | Ga0102737_1000019 | 3300007142 | Bacteria | 94188 |
| 80 | Ga0562375_3565 | 3300056856 | Unclassified | 14222 |
| 81 | Ga0466701_018115 | 3300042598 | Bacteria | 84655 |
| 82 | Ga0466701_060014 | 3300042598 | Bacteria | 83443 |
| 83 | Ga0466707_065039 | 3300042601 | Bacteria | 48167 |
| 84 | Ga0466722_018027 | 3300042609 | Bacteria | 2166 |
| 85 | Ga0466729_230562 | 3300042621 | Bacteria | 12156 |
| 86 | Ga0466734_117381 | 3300042623 | Bacteria | 2499 |
| 87 | Ga0466730_029404 | 3300042625 | Bacteria | 69048 |
| 88 | Ga0466730_078531 | 3300042625 | Bacteria | 132731 |
| 89 | Ga0466704_348587 | 3300042643 | Bacteria | 13808 |
| 90 | Ga0466724_24965 | 3300042649 | Bacteria | 130915 |
| 91 | Ga0466724_38911 | 3300042649 | Bacteria | 256254 |
| 92 | Ga0466715_143205 | 3300042616 | Bacteria | 113538 |
| 93 | Ga0466723_029788 | 3300042618 | Bacteria | 11741 |
| 94 | Ga0160468_100452 | 3300012819 | Bacteria | 16803 |
| 95 | Ga0160456_100133 | 3300012820 | Bacteria | 70892 |
| 96 | Ga0160455_101224 | 3300012837 | Bacteria | 8484 |
| 97 | Ga0160444_100352 | 3300012841 | Bacteria | 26856 |
| 98 | Ga0160433_100160 | 3300012846 | Unclassified | 56688 |
| 99 | Ga0160448_100010 | 3300012854 | Bacteria | 283932 |
| 100 | Ga0160436_1005172 | 3300012861 | Unclassified | 3079 |
| 101 | Ga0466693_439873 | 3300042592 | Bacteria | 186295 |
| 102 | FGTW_contig15116 | 2065487013 | Unclassified | 2584 |
| 103 | CVPL010W_10014957 | 3300002931 | Bacteria | 5556 |
| 104 | CVPL010L_1000128 | 3300002932 | Bacteria | 70257 |
| 105 | CVPL005L_10007491 | 3300002938 | Unclassified | 10259 |
| 106 | Ga0074306_1117997 | 3300005309 | Bacteria | 2123 |
| 107 | Ga0103266_1001006 | 3300007067 | Unclassified | 5027 |
| 108 | Ga0102737_1001330 | 3300007142 | Bacteria | 6995 |
| 109 | Ga0104019_1002865 | 3300007150 | Bacteria | 9619 |
| 110 | Ga0103264_1052623 | 3300007188 | Bacteria | 2473 |
| 111 | Ga0103267_1000001 | 3300007190 | Bacteria | 112220 |
| 112 | Ga0466705_353242 | 3300042612 | Bacteria | 39923 |
| 113 | Ga0562377_0241 | 3300056842 | Bacteria | 129113 |
| 114 | Ga0466734_112661 | 3300042623 | Bacteria | 48375 |
| 115 | Ga0466730_102642 | 3300042625 | Unclassified | 2238 |
| 116 | Ga0466704_568644 | 3300042643 | Bacteria | 41942 |
| 117 | Ga0466715_637599 | 3300042616 | Bacteria | 14095 |
| 118 | Ga0160444_100091 | 3300012841 | Bacteria | 113908 |
| 119 | Ga0160434_108025 | 3300012850 | Unclassified | 1739 |
| 120 | Ga0160435_1001654 | 3300012857 | Bacteria | 5594 |
| 121 | Ga0160436_1001053 | 3300012861 | Bacteria | 8175 |
| 122 | Ga0466657_032714 | 3300042582 | Bacteria | 5093 |
| 123 | Ga0466690_005832 | 3300042590 | Bacteria | 3678 |
| 124 | Ga0160454_100182 | 3300012798 | Bacteria | 70340 |
| 125 | Ga0160465_100186 | 3300012803 | Bacteria | 51073 |
| 126 | SWWA_contig20265__length_2518___numreads_149 | 2100351016 | Bacteria | 2518 |
| 127 | HBC_ctgsDRAFT_1002712 | 3300000333 | Bacteria | 4019 |
| 128 | CVPL010W_10005111 | 3300002931 | Bacteria | 14199 |
| 129 | CVPL010W_10034324 | 3300002931 | Unclassified | 3079 |
| 130 | CVPL005W_1000726 | 3300002934 | Bacteria | 12005 |
| 131 | CVPL005L_10000002 | 3300002938 | Bacteria | 360643 |
| 132 | Ga0063521_1000082 | 3300003973 | Bacteria | 78761 |
| 133 | Ga0063521_1000092 | 3300003973 | Bacteria | 71579 |
| 134 | Ga0103264_1000195 | 3300007188 | Bacteria | 65205 |
| 135 | Ga0103264_1000223 | 3300007188 | Bacteria | 42304 |
| 136 | Ga0103264_1000574 | 3300007188 | Unclassified | 18127 |
| 137 | Ga0466733_025382 | 3300042659 | Bacteria | 46044 |
| 138 | Ga0466701_061678 | 3300042598 | Bacteria | 207542 |
| 139 | Ga0466719_414646 | 3300042606 | Bacteria | 3486 |
| 140 | Ga0466730_012040 | 3300042625 | Unclassified | 26725 |
| 141 | Ga0466730_023003 | 3300042625 | Bacteria | 6154 |
| 142 | Ga0466730_041141 | 3300042625 | Bacteria | 266815 |
| 143 | Ga0466709_005143 | 3300042648 | Unclassified | 10533 |
| 144 | Ga0466724_17605 | 3300042649 | Bacteria | 124775 |
| 145 | Ga0466724_36135 | 3300042649 | Bacteria | 5015 |
| 146 | Ga0466724_63919 | 3300042649 | Bacteria | 27006 |
| 147 | Ga0466725_029742 | 3300042654 | Bacteria | 29477 |
| 148 | Ga0466723_113926 | 3300042618 | Bacteria | 26979 |
| 149 | Ga0160447_102659 | 3300012849 | Bacteria | 6122 |
| 150 | Ga0247289_0006 | 3300035363 | Bacteria | 79281 |
| 151 | Ga0123355_10085270 | 3300009826 | Bacteria | 5027 |
| 152 | 2227080769 | 2225789004 | Bacteria | 257506 |
| 153 | CVPL010W_10000096 | 3300002931 | Bacteria | 62459 |
| 154 | CVPL005L_10000178 | 3300002938 | Bacteria | 114224 |
| 155 | Ga0102739_1000750 | 3300007095 | Unclassified | 5924 |
| 156 | Ga0102737_1000027 | 3300007142 | Bacteria | 41224 |
| 157 | Ga0102737_1000389 | 3300007142 | Unclassified | 14801 |
| 158 | Ga0103267_1000044 | 3300007190 | Bacteria | 93277 |
| 159 | Ga0103268_1000912 | 3300007192 | Bacteria | 15887 |
| 160 | Ga0123357_10000003 | 3300009784 | Bacteria | 349727 |
| 161 | Ga0466705_184895 | 3300042612 | Bacteria | 3363 |
| 162 | Ga0466705_387403 | 3300042612 | Bacteria | 23547 |
| 163 | Ga0562377_0002 | 3300056842 | Bacteria | 4351833 |
| 164 | Ga0466713_018886 | 3300042602 | Bacteria | 29657 |
| 165 | Ga0466713_081615 | 3300042602 | Bacteria | 2265 |
| 166 | Ga0466722_058209 | 3300042609 | Bacteria | 3513 |
| 167 | Ga0466722_166010 | 3300042609 | Bacteria | 2359 |
| 168 | Ga0466730_006500 | 3300042625 | Bacteria | 44343 |
| 169 | Ga0466730_080882 | 3300042625 | Bacteria | 22171 |
| 170 | Ga0466709_019498 | 3300042648 | Bacteria | 11048 |
| 171 | Ga0466727_298678 | 3300042655 | Bacteria | 2014 |
| 172 | Ga0466715_252312 | 3300042616 | Bacteria | 6369 |
| 173 | Ga0466723_083405 | 3300042618 | Bacteria | 10383 |
| 174 | Ga0466726_298305 | 3300042619 | Bacteria | 2068 |
| 175 | Ga0160469_100016 | 3300012824 | Bacteria | 368306 |
| 176 | Ga0160459_100030 | 3300012831 | Bacteria | 297483 |
| 177 | Ga0160458_100048 | 3300012832 | Bacteria | 159398 |
| 178 | Ga0160433_100014 | 3300012846 | Bacteria | 237201 |
| 179 | Ga0160433_100370 | 3300012846 | Unclassified | 26157 |
| 180 | Ga0160443_102540 | 3300012848 | Bacteria | 3935 |
| 181 | Ga0160448_100038 | 3300012854 | Bacteria | 124546 |
| 182 | Ga0247290_00029 | 3300035364 | Unclassified | 56602 |
| 183 | Ga0466657_231738 | 3300042582 | Bacteria | 3499 |
| 184 | Ga0466692_057808 | 3300042591 | Bacteria | 98348 |
| 185 | Ga0466701_003070 | 3300042598 | Bacteria | 7872 |
| 186 | Ga0160454_100402 | 3300012798 | Bacteria | 21277 |
| 187 | DPOL_contig12611 | 2035918003 | Unclassified | 4349 |
| 188 | Ga0102734_1000147 | 3300007129 | Bacteria | 28432 |
| 189 | Ga0102740_1002254 | 3300007140 | Unclassified | 4489 |
| 190 | Ga0102738_1000722 | 3300007141 | Unclassified | 5321 |
| 191 | Ga0103264_1000266 | 3300007188 | Bacteria | 29657 |
| 192 | Ga0466705_272784 | 3300042612 | Bacteria | 31153 |
| 193 | Ga0466733_018672 | 3300042659 | Bacteria | 11655 |
| 194 | Ga0562378_0034 | 3300056814 | Bacteria | 488617 |
| 195 | Ga0466701_035885 | 3300042598 | Bacteria | 250285 |
| 196 | Ga0466701_069257 | 3300042598 | Bacteria | 3841 |
| 197 | Ga0466713_008347 | 3300042602 | Bacteria | 126123 |
| 198 | Ga0466704_443962 | 3300042643 | Bacteria | 37836 |
| 199 | Ga0466724_16812 | 3300042649 | Bacteria | 126976 |
| 200 | Ga0466724_17582 | 3300042649 | Bacteria | 122637 |
| 201 | Ga0466724_36022 | 3300042649 | Bacteria | 5189 |
| 202 | Ga0466724_64244 | 3300042649 | Bacteria | 18331 |
| 203 | Ga0466708_394550 | 3300042652 | Bacteria | 3568 |
| 204 | Ga0466715_038044 | 3300042616 | Bacteria | 2878 |
| 205 | Ga0466715_403366 | 3300042616 | Bacteria | 28580 |
| 206 | Ga0160469_100076 | 3300012824 | Bacteria | 158417 |
| 207 | Ga0160467_102738 | 3300012829 | Bacteria | 3547 |
| 208 | Ga0160459_100137 | 3300012831 | Unclassified | 49237 |
| 209 | Ga0160446_100005 | 3300012835 | Bacteria | 449944 |
| 210 | Ga0160444_100891 | 3300012841 | Bacteria | 8025 |
| 211 | Ga0160434_100070 | 3300012850 | Bacteria | 71817 |
| 212 | Ga0160448_102375 | 3300012854 | Unclassified | 5802 |
| 213 | Ga0247289_0604 | 3300035363 | Unclassified | 4834 |
| 214 | Ga0466691_126281 | 3300042593 | Bacteria | 8364 |
| 215 | Ga0123355_10006701 | 3300009826 | Bacteria | 17125 |
| 216 | Ga0123353_10000141 | 3300010167 | Bacteria | 88150 |
| 217 | Ga0160464_100230 | 3300012805 | Unclassified | 54758 |
| 218 | SCG598O02_12464 | 3300000460 | Bacteria | 37190 |
| 219 | CVPL010W_10017553 | 3300002931 | Bacteria | 4635 |
| 220 | CVPL005L_10000052 | 3300002938 | Bacteria | 73764 |
| 221 | Ga0063521_1000029 | 3300003973 | Bacteria | 122497 |
| 222 | Ga0068305_10070669 | 3300005083 | Bacteria | 22554 |
| 223 | Ga0074311_1142121 | 3300005317 | Unclassified | 2075 |
| 224 | Ga0103263_100355 | 3300007042 | Bacteria | 6327 |
| 225 | Ga0103266_1000007 | 3300007067 | Bacteria | 130661 |
| 226 | Ga0103266_1000083 | 3300007067 | Unclassified | 34459 |
| 227 | Ga0103264_1000737 | 3300007188 | Bacteria | 15353 |
| 228 | Ga0105553_1042369 | 3300007767 | Bacteria | 22586 |
| 229 | Ga0123357_10000853 | 3300009784 | Bacteria | 31026 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00070 | Pyr_redox | Pyridine nucleotide-disulphide oxidoreductase | 411 | 485 | 0.95 |
| PF07992 | Pyr_redox_2 | Pyridine nucleotide-disulphide oxidoreductase | 270 | 558 | 0.89 |
| PF13192 | Thioredoxin_3 | Thioredoxin domain | 183 | 252 | 0.88 |
| PF12831 | FAD_oxidored | FAD dependent oxidoreductase | 271 | 305 | 0.84 |
| PF13738 | Pyr_redox_3 | Pyridine nucleotide-disulphide oxidoreductase | 315 | 541 | 0.79 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF07992 | GO:0016491 | oxidoreductase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.