Protein Family IF09695

Metagenome Isolate
187 Members
148 Samples
95 Scaffolds
219.64 Avg Length

🧬 Representative Sequence

ID
3300042649|Ga0466724_02653|Ga0466724_02653_3006_3719
Length
237 aa
Sequence
MKIDVCLLYRLRDNLLQMEQDMKSIAVILSGCGVFDGSEVHESVLTMLALSQNNAKVYFFAPDELQPTVINHINGNEKTEKRNQLEESARITRGEISPLSSADASKLDALIIPGGFGAAKNLCNFAVKGSDCEINKELLSLVRQMHQQKKPLGLMCIAPVMLPKMLNTSVKLTIGDDSETIIQIENMGGKHIKCSVDDIVVDEVNRVVTTPAYMLAQSISEANIGINKLVKKVLEMA

📊 Sample Types

Isolate 49.2%
Metagenome 50.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 14.5%
Muscidae 8.7%
Curculionidae 8.7%
Drosophilidae 7.2%
Tenebrionidae 7.2%
Culicidae 6.5%
Formicidae 6.5%
Calliphoridae 5.8%
Elmidae 5.1%
Termitidae 4.3%
Kalotermitidae 3.6%
Armadillidiidae 2.9%
Tephritidae 2.2%
Cerambycidae 1.4%
Passalidae 1.4%
Apidae 1.4%
Plutellidae 1.4%
Rhinotermitidae 1.4%
Sarcophagidae 1.4%
Siricidae 0.7%
Crambidae 0.7%
Anthomyiidae 0.7%
Rhopalidae 0.7%
Pentatomidae 0.7%
Carabidae 0.7%
Scarabaeidae 0.7%
Trigoniulidae 0.7%
Majidae 0.7%
Gryllidae 0.7%
Pteromalidae 0.7%

🌳 Taxonomy

Archaea 0
Bacteria 165
Eukaryota 0
Viruses 0
Unclassified 22

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2833053935 Buttiauxella sp. 3AFRM03 Isolate Cerambycidae
2 2841260384 Providencia alcalifaciens Dmel2 Isolate Drosophilidae
3 2864944480 Pseudomonas fluvialis S00202 Isolate Elmidae
4 2896187957 Providencia stuartii Crippen Isolate Calliphoridae
5 2970335472 Cronobacter muytjensii MOD1-Md1s Isolate Muscidae
6 2997878596 Pseudomonas bohemica IA9 Isolate Unclassified
7 3007994558 Escherichia alba B35 Isolate Tenebrionidae
8 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
9 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
10 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
11 2100351016 Sirex noctilio microbial communities from Pennsylvania, USA - adult community Metagenome Siricidae
12 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
13 2551306531 Enterobacter hormaechei YT2 Isolate Tenebrionidae
14 2731957969 Proteus mirabilis Wood Isolate Calliphoridae
15 2756170277 Enterobacillus tribolii DSM 103736 Isolate Unclassified
16 8021535516 Klebsiella sp. Kd70 TUC-EEAOC Isolate Crambidae
17 8035321120 Pseudomonas prosekii A2-NA12 Isolate Curculionidae
18 8100181737 Kosakonia sp. S58 Isolate Curculionidae
19 2864903489 Pseudomonas aeuginosa S00161 Isolate Elmidae
20 2870361953 Entomomonas moraniae QZS01 Isolate Apidae
21 2921816052 Cronobacter sakazakii MOD1-Anth48g Isolate Anthomyiidae
22 2937427229 Cronobacter malonaticus MOD1-Md99g Isolate Muscidae
23 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
24 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
25 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Curculionidae
26 2507262057 Enterobacteriaceae bacterium FGI 57 Isolate Unclassified
27 2551306516 Enterobacter hormaechei YT3 Isolate Tenebrionidae
28 2687453755 Pseudomonadales bacterium Cag27 Isolate Unclassified
29 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
30 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
31 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
32 8071338694 Escherichia coli PN87 Isolate Calliphoridae
33 2864739902 Pseudomonas viridiflavia S00001 Isolate Elmidae
34 2864853652 Pseudomonas rhodesiae S00114 Isolate Elmidae
35 2977691992 Cronobacter malonaticus MOD1-Md27g Isolate Muscidae
36 2977745872 Cronobacter sakazakii MOD1-Md1g Isolate Muscidae
37 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
38 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
39 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
40 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
41 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
42 2597489903 Providencia sneebia DSM 19967 Isolate Drosophilidae
43 2765235945 Kosakonia cowanii Esp_Z Isolate Culicidae
44 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
45 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
46 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
47 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
48 8100176769 Kosakonia sp. S57 Isolate Curculionidae
49 2824588292 Yokenella regensburgei WCD67 Isolate Rhopalidae
50 2856068565 Cronobacter sakazakii MOD1-Md35s Isolate Muscidae
51 2864745180 Pseudomonas rhodesiae S00002 Isolate Elmidae
52 2864847319 Pseudomonas alcaligenes S00099 Isolate Elmidae
53 2967924226 Cronobacter malonaticus MOD1-Md25g Isolate Muscidae
54 2970322301 Cronobacter sakazakii MOD1-Md33g Isolate Muscidae
55 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
56 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
57 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
58 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
59 3300035363 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut Metagenome Plutellidae
60 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
61 2588253732 Klebsiella pneumoniae pneumoniae KP5-1 Isolate Pentatomidae
62 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
63 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
64 8004118532 Citrobacter amalonaticus ku-bf3 Isolate Carabidae
65 8052469819 Pseudomonas putida DZ-F23 Isolate
66 8071343737 Escherichia coli PN119 Isolate Calliphoridae
67 8101683685 Providencia sp. JGM181 Isolate Drosophilidae
68 2921842437 Cronobacter sakazakii MOD1-Lc10s Isolate Calliphoridae
69 2957730672 Cronobacter sakazakii MOD1-Md70g Isolate Muscidae
70 2967915117 Cronobacter sakazakii MOD1-Lc10g Isolate Calliphoridae
71 2979682021 Cronobacter turicensis MOD1-Sh41s Isolate Sarcophagidae
72 3007473699 Pseudomonas sp. S30 Isolate Curculionidae
73 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
74 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
75 2519899622 Pseudomonas sp. Ag1 Isolate Culicidae
76 2529292851 Providencia burhodogranariea DSM 19968 Isolate Drosophilidae
77 2687453754 Pseudomonadales bacterium Cag26 Isolate Unclassified
78 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
79 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
80 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
81 8001394582 Limnobaculum allomyrinae BWR-B9 Isolate Scarabaeidae
82 8011329375 Pseudomonas sp. S31 Isolate Curculionidae
83 8011357093 Pseudomonas schmalbachii Milli4 Isolate Trigoniulidae
84 8073124432 Escherichia coli MOD1-EC294 Isolate Unclassified
85 8101676404 Providencia sp. JGM172 Isolate Drosophilidae
86 2864926767 Pseudomonas nitritireducens S00179 Isolate Elmidae
87 2876334352 Cronobacter sakazakii MOD1-Md6g Isolate Muscidae
88 2889908211 Bowmanella denitrificans JL63 Isolate Unclassified
89 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
90 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
91 3300007103 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut Metagenome Drosophilidae
92 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
93 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
94 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
95 2519899623 Enterobacter sp. Ag1 Isolate Culicidae
96 2537561600 Salmonella enterica enterica sv. Newport CVM 19443 Isolate Unclassified
97 2551306520 Aliivibrio logei ATCC 35077 Isolate Majidae
98 2588253791 Yokenella regensburgei F. Haas DC-1, ATCC 49455 Isolate Unclassified
99 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
100 8035422605 Pseudomonas monteilii CY06 Isolate
101 2876358570 Cronobacter sakazakii MOD1-Ls15g Isolate Calliphoridae
102 2937387794 Cronobacter turicensis MOD1-Sh41g Isolate Sarcophagidae
103 2938192669 Citrobacter sp. TSA-1 Isolate Unclassified
104 2972038244 Pseudomonas sp. DS1 Isolate Formicidae
105 3000478755 Entomomonas asaccharolytica F2A Isolate Gryllidae
106 3007478678 Pseudomonas sp. S37 Isolate Curculionidae
107 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
108 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
109 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
110 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
111 3300030930 Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 Metagenome Formicidae
112 2597489902 Providencia rettgeri Dmel1 Isolate Drosophilidae
113 2687453756 Pseudomonadales bacterium Cag32 Isolate Unclassified
114 2706794701 Opitutaceae bacterium TSB47 Isolate Rhinotermitidae
115 2820110010 Unclassified Proteobacteria Emb289P4bin35 Isolate Unclassified
116 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
117 637000219 Pseudomonas entomophila L48 Isolate Unclassified
118 8021546568 Klebsiella sp. Kps Isolate Tephritidae
119 8035326735 Pseudomonas prosekii A2-NA13 Isolate Curculionidae
120 8071322446 Escherichia coli PN122 Isolate Calliphoridae
121 8100171289 Kosakonia sp. S42 Isolate Curculionidae
122 8101680043 Providencia sp. JGM178 Isolate Drosophilidae
123 2822856742 Enterobacter cancerogenus CR-Eb1 Isolate Unclassified
124 2843904799 Shewanella khirikhana TH2012 Isolate Unclassified
125 2850131454 Providencia rettgeri NVIT03 Isolate Pteromalidae
126 2874880541 Enterobacter hormaechei E3442 Isolate Unclassified
127 2964846109 Cronobacter sakazakii MOD1-Md5g Isolate Muscidae
128 2964859436 Cronobacter sakazakii MOD1-Md40g Isolate Muscidae
129 3000861951 Budvicia diplopodorum D9 Isolate
130 3004364956 Cronobacter sakazakii MOD1-Md5s Isolate Muscidae
131 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
132 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
133 3300007078 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut Metagenome Drosophilidae
134 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
135 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
136 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
137 3300035364 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut Metagenome Plutellidae
138 2035918003 Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine Metagenome Curculionidae
139 2518285522 Photorhabdus khanii NC19 Isolate Unclassified
140 2547132185 Enterobacter cancerogenus YZ1 Isolate Tenebrionidae
141 2778261152 Escherichia coli MOD1-EC284 Isolate Unclassified
142 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
143 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
144 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
145 8018312681 Enterobacter sp. OLF Isolate Tephritidae
146 8021540981 Klebsiella sp. Kpp Isolate Tephritidae
147 8028002147 Enterobacter sp. 10-1 Isolate Cerambycidae
148 8110023836 Enterobacterales bacterium BIT-L3 Isolate Tenebrionidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0160444_100584 3300012841 Bacteria 13602
2 Ga0160444_116584 3300012841 Bacteria 839
3 Ga0265387_1000288 3300024582 Bacteria 8488
4 Ga0466707_077196 3300042601 Bacteria 48037
5 Ga0466713_059695 3300042602 Bacteria 36243
6 Ga0102736_1000433 3300007052 Bacteria 8571
7 Ga0104051_1102262 3300007078 Bacteria 2178
8 Ga0466730_033110 3300042625 Unclassified 19425
9 Ga0466724_22279 3300042649 Bacteria 15116
10 Ga0160433_101662 3300012846 Bacteria 5761
11 Ga0466696_229350 3300042596 Bacteria 1500
12 Ga0466701_044033 3300042598 Bacteria 112210
13 DPO_contig08106 2032320009 Bacteria 25636
14 SPBB_contig09883 2044078006 Bacteria 31365
15 SWWA_contig00552__length_23778___numreads_1537 2100351016 Bacteria 23778
16 CVPL010L_1000259 3300002932 Bacteria 21876
17 Ga0105005_1090675 3300007505 Unclassified 11512
18 Ga0466705_301411 3300042612 Bacteria 2224
19 Ga0562374_0048 3300057007 Bacteria 546035
20 Ga0466730_028926 3300042625 Bacteria 34701
21 Ga0466724_02653 3300042649 Bacteria 9783
22 Ga0466724_40911 3300042649 Bacteria 49657
23 Ga0160441_101100 3300012825 Bacteria 10855
24 Ga0160443_113070 3300012848 Unclassified 920
25 Ga0160436_1033044 3300012861 Unclassified 868
26 Ga0316159_12821 3300030930 Unclassified 1728
27 Ga0247289_0044 3300035363 Bacteria 39742
28 Ga0160466_100338 3300012809 Bacteria 28195
29 FGTW_contig07297 2065487013 Unclassified 1381
30 HBC_ctgsDRAFT_1000018 3300000333 Bacteria 42985
31 Meta3P_1001818 3300002464 Unclassified 1298
32 CVPL010L_1001358 3300002932 Unclassified 3636
33 Ga0102739_1002388 3300007095 Bacteria 2897
34 Ga0466704_382798 3300042643 Unclassified 4144
35 Ga0466724_31511 3300042649 Bacteria 66518
36 Ga0160469_100576 3300012824 Unclassified 15210
37 Ga0160465_100996 3300012803 Unclassified 9481
38 Ga0466713_028799 3300042602 Bacteria 28373
39 Ga0466713_136085 3300042602 Unclassified 2899
40 Ga0063521_1000019 3300003973 Bacteria 139495
41 Ga0063521_1000396 3300003973 Bacteria 24085
42 Ga0105005_1186188 3300007505 Bacteria 1172
43 Ga0562379_0289 3300056790 Bacteria 128410
44 Ga0562377_0001 3300056842 Bacteria 5082480
45 Ga0466730_054465 3300042625 Bacteria 1136
46 Ga0466724_08012 3300042649 Bacteria 67064
47 Ga0247289_1213 3300035363 Bacteria 2591
48 Ga0466701_063657 3300042598 Bacteria 38295
49 Ga0466722_020309 3300042609 Bacteria 4420
50 SWWA_contig19608__length_3701___numreads_73 2100351016 Bacteria 3701
51 Meta3P_1000063 3300002464 Unclassified 16337
52 CVPL005W_1000938 3300002934 Bacteria 9200
53 Ga0123357_10000836 3300009784 Bacteria 31243
54 Ga0530661_001016 3300056564 Unclassified 16374
55 Ga0466730_034998 3300042625 Bacteria 1449
56 Ga0466730_042292 3300042625 Bacteria 7090
57 Ga0466724_22462 3300042649 Unclassified 22002
58 Ga0160432_101581 3300012818 Unclassified 6822
59 Ga0160470_100147 3300012813 Bacteria 70669
60 Ga0466707_051976 3300042601 Unclassified 2863
61 DPOL_contig02850 2035918003 Bacteria 36716
62 FGTW_contig30586 2065487013 Bacteria 10232
63 2227358540 2225789004 Bacteria 138171
64 HBC_ctgsDRAFT_1018181 3300000333 Bacteria 1713
65 JGI24705J35276_12235614 3300002504 Bacteria 6737
66 CVPL010L_1000092 3300002932 Bacteria 28025
67 Ga0063521_1000060 3300003973 Bacteria 95522
68 Ga0104049_1131138 3300007103 Unclassified 3955
69 Ga0562378_0105 3300056814 Bacteria 222310
70 Ga0466730_033232 3300042625 Unclassified 8483
71 Ga0466730_056657 3300042625 Bacteria 4551
72 Ga0466703_363411 3300042636 Bacteria 6746
73 Ga0160440_100645 3300012815 Unclassified 8219
74 Ga0160472_100581 3300012839 Bacteria 20992
75 Ga0316159_14725 3300030930 Bacteria 1881
76 Ga0247290_00438 3300035364 Bacteria 8036
77 Ga0466707_146868 3300042601 Bacteria 3218
78 Ga0466719_497213 3300042606 Bacteria 6549
79 Ga0466722_010429 3300042609 Bacteria 4402
80 Ga0466722_151693 3300042609 Bacteria 2308
81 DPO_contig08731 2032320009 Bacteria 25815
82 FGTW_contig02420 2065487013 Bacteria 5137
83 Ga0103266_1000625 3300007067 Bacteria 7629
84 Ga0102735_1004265 3300007080 Bacteria 3501
85 Ga0103264_1041263 3300007188 Unclassified 1958
86 Ga0466733_155817 3300042659 Bacteria 7824
87 Ga0562379_0001 3300056790 Bacteria 4904077
88 Ga0160433_100101 3300012846 Bacteria 86629
89 Ga0160447_101120 3300012849 Bacteria 10786
90 Ga0160448_119399 3300012854 Bacteria 1133
91 Ga0265387_1000169 3300024582 Bacteria 11837
92 SPBB_contig11585 2044078006 Bacteria 25836
93 FGTW_contig29716 2065487013 Unclassified 2961
94 IMNBL1DRAFT_c0000516 3300000062 Bacteria 31722
95 Ga0103266_1000120 3300007067 Bacteria 38540

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2896187957 2896191521 212
2 3300042609 Ga0466722_010429 Ga0466722_010429_3225_3872 215
3 3300042609 Ga0466722_020309 Ga0466722_020309_2808_3458 216
4 iso_pr_bacteria 2529292851 2530235176 216
5 iso_pr_bacteria 2597489902 2597922883 216
6 iso_pr_bacteria 2597489903 2597924206 216
7 iso_pr_bacteria 2841260384 2841263376 216
8 iso_pr_bacteria 2850131454 2850133797 216
9 iso_pr_bacteria 2864926767 2864927728 216
10 iso_pr_bacteria 3000861951 3000864026 216
11 iso_pr_bacteria 8101676404 8101679153 216
12 iso_pr_bacteria 8101680043 8101682367 216
13 iso_pr_bacteria 8101683685 8101685916 216
14 2065487013 FGTW_contig02420 FGTW_00192450 217
15 2065487013 FGTW_contig07297 FGTW_02311240 217
16 2065487013 FGTW_contig29716 FGTW_02747140 217
17 2225789004 2227358540 2227803098 217
18 3300003973 Ga0063521_1000019 Ga0063521_10000194 217
19 3300003973 Ga0063521_1000060 Ga0063521_100006062 217
20 3300024582 Ga0265387_1000169 Ga0265387_10001692 217
21 3300024582 Ga0265387_1000288 Ga0265387_10002882 217
22 3300030930 Ga0316159_12821 Ga0316159_128211 217
23 3300042601 Ga0466707_051976 Ga0466707_051976_1297_1950 217
24 3300042601 Ga0466707_077196 Ga0466707_077196_19880_20533 217
25 3300042601 Ga0466707_146868 Ga0466707_146868_1594_2247 217
26 3300042602 Ga0466713_028799 Ga0466713_028799_11984_12637 217
27 3300042602 Ga0466713_059695 Ga0466713_059695_16544_17197 217
28 3300042602 Ga0466713_136085 Ga0466713_136085_897_1550 217
29 3300042625 Ga0466730_028926 Ga0466730_028926_15557_16210 217
30 3300042625 Ga0466730_042292 Ga0466730_042292_296_949 217
31 3300042625 Ga0466730_056657 Ga0466730_056657_1683_2336 217
32 3300042649 Ga0466724_31511 Ga0466724_31511_50311_50964 217
33 3300056564 Ga0530661_001016 Ga0530661_001016_5913_6566 217
34 3300056790 Ga0562379_0001 Ga0562379_0001_916316_916969 217
35 3300056814 Ga0562378_0105 Ga0562378_0105_123652_124305 217
36 3300056842 Ga0562377_0001 Ga0562377_0001_4390317_4390970 217
37 iso_pr_bacteria 2507262057 2507515182 217
38 iso_pr_bacteria 2518285522 2518342219 217
39 iso_pr_bacteria 2519899623 2520393696 217
40 iso_pr_bacteria 2537561600 2537927588 217
41 iso_pr_bacteria 2547132185 2547711408 217
42 iso_pr_bacteria 2551306516 2553381121 217
43 iso_pr_bacteria 2551306531 2553452032 217
44 iso_pr_bacteria 2588253732 2588526443 217
45 iso_pr_bacteria 2588253791 2588730130 217
46 iso_pr_bacteria 2756170277 2756798621 217
47 iso_pr_bacteria 2765235945 2766085622 217
48 iso_pr_bacteria 2778261152 2779037084 217
49 iso_pr_bacteria 2822856742 2822857224 217
50 iso_pr_bacteria 2824588292 2824589750 217
51 iso_pr_bacteria 2833053935 2833057427 217
52 iso_pr_bacteria 2843904799 2843908606 217
53 iso_pr_bacteria 2856068565 2856071266 217
54 iso_pr_bacteria 2874880541 2874884267 217
55 iso_pr_bacteria 2876334352 2876335573 217
56 iso_pr_bacteria 2876358570 2876360508 217
57 iso_pr_bacteria 2889908211 2889908901 217
58 iso_pr_bacteria 2921816052 2921818793 217
59 iso_pr_bacteria 2921842437 2921846809 217
60 iso_pr_bacteria 2937387794 2937388206 217
61 iso_pr_bacteria 2937427229 2937429852 217
62 iso_pr_bacteria 2938192669 2938197080 217
63 iso_pr_bacteria 2957730672 2957731942 217
64 iso_pr_bacteria 2964846109 2964846792 217
65 iso_pr_bacteria 2964859436 2964862702 217
66 iso_pr_bacteria 2967915117 2967915625 217
67 iso_pr_bacteria 2967924226 2967925342 217
68 iso_pr_bacteria 2970322301 2970325645 217
69 iso_pr_bacteria 2970335472 2970336830 217
70 iso_pr_bacteria 2977691992 2977694061 217
71 iso_pr_bacteria 2977745872 2977748884 217
72 iso_pr_bacteria 2979682021 2979685207 217
73 iso_pr_bacteria 3004364956 3004367057 217
74 iso_pr_bacteria 3007994558 3007998196 217
75 iso_pr_bacteria 8001394582 8001398780 217
76 iso_pr_bacteria 8004118532 8004121160 217
77 iso_pr_bacteria 8011357093 8011357168 217
78 iso_pr_bacteria 8018312681 8018315895 217
79 iso_pr_bacteria 8021535516 8021540204 217
80 iso_pr_bacteria 8021540981 8021544927 217
81 iso_pr_bacteria 8021546568 8021547592 217
82 iso_pr_bacteria 8028002147 8028005252 217
83 iso_pr_bacteria 8071322446 8071327257 217
84 iso_pr_bacteria 8071338694 8071343710 217
85 iso_pr_bacteria 8071343737 8071345066 217
86 iso_pr_bacteria 8073124432 8073125573 217
87 iso_pr_bacteria 8100171289 8100174149 217
88 iso_pr_bacteria 8100176769 8100177428 217
89 iso_pr_bacteria 8100181737 8100182438 217
90 3300000062 IMNBL1DRAFT_c0000516 IMNBL1DRAFT_000051624 218
91 3300002932 CVPL010L_1000092 CVPL010L_10000925 218
92 3300002932 CVPL010L_1000259 CVPL010L_10002595 218
93 3300002932 CVPL010L_1001358 CVPL010L_10013582 218
94 3300003973 Ga0063521_1000396 Ga0063521_10003968 218
95 3300012846 Ga0160433_101662 Ga0160433_1016622 218
96 3300035363 Ga0247289_0044 Ga0247289_0044_22529_23185 218
97 3300035364 Ga0247290_00438 Ga0247290_00438_2397_3053 218
98 3300042596 Ga0466696_229350 Ga0466696_229350_249_905 218
99 3300042606 Ga0466719_497213 Ga0466719_497213_4318_4974 218
100 3300042609 Ga0466722_151693 Ga0466722_151693_711_1367 218
101 3300042625 Ga0466730_033232 Ga0466730_033232_2590_3246 218
102 3300042636 Ga0466703_363411 Ga0466703_363411_258_953 218
103 3300042643 Ga0466704_382798 Ga0466704_382798_3192_3848 218
104 3300042649 Ga0466724_22462 Ga0466724_22462_5743_6399 218
105 iso_pr_bacteria 2551306520 2553398415 218
106 iso_pr_bacteria 2551306520 2553399110 218
107 iso_pr_bacteria 2706794701 2708045780 218
108 3300000333 HBC_ctgsDRAFT_1018181 HBC_ctgsDRAFT_10181812 219
109 3300002464 Meta3P_1001818 Meta3P_10018181 219
110 3300002504 JGI24705J35276_12235614 JGI24705J35276_122356143 219
111 3300042649 Ga0466724_22279 Ga0466724_22279_10068_10727 219
112 3300056790 Ga0562379_0289 Ga0562379_0289_68253_68912 219
113 3300057007 Ga0562374_0048 Ga0562374_0048_276484_277143 219
114 iso_pr_bacteria 2820110010 2820110237 219
115 iso_pr_bacteria 3007478678 3007480247 219
116 iso_pr_bacteria 8035422605 8035425639 219
117 iso_pr_bacteria 8052469819 8052473558 219
118 iso_pr_bacteria 8110023836 8110024866 219
119 3300009784 Ga0123357_10000836 Ga0123357_1000083623 220
120 iso_pr_bacteria 2687453754 2690040295 220
121 iso_pr_bacteria 2687453755 2690044771 220
122 iso_pr_bacteria 2687453756 2690046011 220
123 iso_pr_bacteria 2870361953 2870361968 220
124 2032320009 DPO_contig08731 DPOB_436340 221
125 2044078006 SPBB_contig09883 SPBB_987820 221
126 2044078006 SPBB_contig11585 SPBB_512940 221
127 2100351016 SWWA_contig00552__length_23778___numreads_1537 SWWA_01592370 221
128 3300007067 Ga0103266_1000120 Ga0103266_100012013 221
129 3300007080 Ga0102735_1004265 Ga0102735_10042652 221
130 3300007095 Ga0102739_1002388 Ga0102739_10023882 221
131 3300007188 Ga0103264_1041263 Ga0103264_10412634 221
132 3300030930 Ga0316159_14725 Ga0316159_147252 221
133 3300042598 Ga0466701_044033 Ga0466701_044033_48546_49211 221
134 3300042649 Ga0466724_40911 Ga0466724_40911_44620_45285 221
135 iso_pr_bacteria 2519899622 2520392531 221
136 iso_pr_bacteria 2864847319 2864848846 221
137 iso_pr_bacteria 2864944480 2864945099 221
138 iso_pr_bacteria 3000478755 3000481416 221
139 iso_pr_bacteria 8011329375 8011334903 221
140 3300000333 HBC_ctgsDRAFT_1000018 HBC_ctgsDRAFT_10000185 222
141 3300002464 Meta3P_1000063 Meta3P_100006314 222
142 3300002934 CVPL005W_1000938 CVPL005W_10009386 222
143 3300007052 Ga0102736_1000433 Ga0102736_10004337 222
144 3300007067 Ga0103266_1000625 Ga0103266_10006257 222
145 3300007078 Ga0104051_1102262 Ga0104051_11022622 222
146 3300007103 Ga0104049_1131138 Ga0104049_11311383 222
147 3300007505 Ga0105005_1090675 Ga0105005_10906758 222
148 3300012815 Ga0160440_100645 Ga0160440_1006456 222
149 3300012846 Ga0160433_100101 Ga0160433_10010114 222
150 3300012848 Ga0160443_113070 Ga0160443_1130702 222
151 3300042649 Ga0466724_08012 Ga0466724_08012_24811_25479 222
152 3300042659 Ga0466733_155817 Ga0466733_155817_4878_5546 222
153 iso_pr_bacteria 2864739902 2864743051 222
154 iso_pr_bacteria 2864745180 2864747024 222
155 iso_pr_bacteria 2864853652 2864855751 222
156 iso_pr_bacteria 2864903489 2864909021 222
157 iso_pr_bacteria 2972038244 2972038664 222
158 iso_pr_bacteria 3007473699 3007476634 222
159 iso_pr_bacteria 637000219 638004181 222
160 iso_pr_bacteria 8035321120 8035321795 222
161 iso_pr_bacteria 8035326735 8035327260 222
162 2032320009 DPO_contig08106 DPOB_371020 223
163 3300012809 Ga0160466_100338 Ga0160466_10033812 223
164 3300012813 Ga0160470_100147 Ga0160470_1001477 223
165 3300012824 Ga0160469_100576 Ga0160469_10057613 223
166 3300012839 Ga0160472_100581 Ga0160472_10058117 223
167 3300012841 Ga0160444_100584 Ga0160444_1005845 223
168 3300042598 Ga0466701_063657 Ga0466701_063657_697_1368 223
169 3300012803 Ga0160465_100996 Ga0160465_1009963 224
170 3300012818 Ga0160432_101581 Ga0160432_1015812 224
171 3300012825 Ga0160441_101100 Ga0160441_1011003 224
172 3300042625 Ga0466730_054465 Ga0466730_054465_191_865 224
173 2035918003 DPOL_contig02850 DPOLB_1489150 225
174 3300007505 Ga0105005_1186188 Ga0105005_11861881 225
175 iso_pr_bacteria 2997878596 2997883742 225
176 2065487013 FGTW_contig30586 FGTW_01742330 226
177 3300012841 Ga0160444_116584 Ga0160444_1165841 227
178 3300012849 Ga0160447_101120 Ga0160447_1011205 227
179 3300012861 Ga0160436_1033044 Ga0160436_10330441 227
180 3300042612 Ga0466705_301411 Ga0466705_301411_646_1329 227
181 3300035363 Ga0247289_1213 Ga0247289_1213_1860_2549 229
182 3300042625 Ga0466730_033110 Ga0466730_033110_2597_3286 229
183 3300042625 Ga0466730_034998 Ga0466730_034998_83_781 232
184 3300042649 Ga0466724_02653 Ga0466724_02653_3006_3719 237
185 iso_pr_bacteria 2731957969 2734004342 237
186 2100351016 SWWA_contig19608__length_3701___numreads_73 SWWA_01787980 239
187 3300012854 Ga0160448_119399 Ga0160448_1193992 256

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01965 DJ-1_PfpI DJ-1/PfpI family 35 174 0.6

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.92 0.94 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.