Protein Family IF09686

Metagenome Isolate
114 Members
29 Samples
111 Scaffolds
614.64 Avg Length

🧬 Representative Sequence

ID
3300042648|Ga0466709_413399|Ga0466709_413399_415_2340
Length
641 aa
Sequence
LSSLEKEKERYMGKTIRLTMAQALVRFLDNQYIEADGEEIKFVTGVFGIFGHGVVVGLGEALAAGDHGLRFYQAKNEQGGAHAAMGYAKQQNRRRMMAVTSSIGPGALNMVTAAGTASVNRIPVLFLPGDVFACRQPDPVLQQVEIPQDYTNTASDAFRAVSRYWDRVNRPEQLMSAMINAFRVLTDPADTGAVTIALPQDVQGEAYDYPIEFFAKRVHHIERRIPTGGQIARAAAMIRAAKKPLVICGGGVRFSGAGEALAAFCETFRIPFGETQAGKGVIPWDNPCNLSGIGSTGSLAANRIAREADLIIAAGTRLGDFTTCSKWLFQNPGARILGINVASFDACKMNGEPIVADAKLTLEALTAVLSAEPPVYKSAWGERIEELRAEWKAEVDRLYSEELPPAPDGSPLLSQVRVLGELNERLLPRDAIVVSGSGSIPSDMQRVWRTRTPGTYHMEYGFSCMGYEIAAALGVKIGCPDREVAAIVGDGAYTMLHTELLTAVQEGKKIIVIVLDNAGFHCIDNLQRSQGIHKFGNEWNRRDEESGRLEGRAVRVDYAKNAESWGALGLRAETPEELRQAAAAALAAPGPVVIDVKVSPDSMTKGYDSWWRVGTAQVSANPEVVKAAEAMAAELARARQF

📊 Sample Types

Isolate 2.6%
Metagenome 97.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 48.3%
Termitidae 13.8%
Unclassified 13.8%
Rhinotermitidae 10.3%
Termopsidae 10.3%
Blaberidae 3.4%

🌳 Taxonomy

Archaea 0
Bacteria 113
Eukaryota 0
Viruses 0
Unclassified 1

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
2 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
3 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
4 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
5 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
6 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
7 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
8 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
9 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
10 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
11 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
12 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
13 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
14 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
15 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
16 2772190975 Treponema sp. RmG30 Isolate Blaberidae
17 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
18 650716102 Treponema primitia ZAS-2 Isolate Unclassified
19 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
20 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
21 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
22 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
23 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
24 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
25 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
26 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
27 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
28 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
29 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_406953 3300042656 Bacteria 2682
2 Ga0466690_181360 3300042590 Bacteria 5875
3 Ga0466703_130402 3300042636 Bacteria 8224
4 Ga0466703_258371 3300042636 Bacteria 7853
5 Ga0466709_305197 3300042648 Bacteria 10392
6 Ga0466709_386244 3300042648 Bacteria 35005
7 Ga0466711_111716 3300042615 Bacteria 24512
8 Ga0466711_157042 3300042615 Bacteria 13212
9 Ga0466711_293849 3300042615 Bacteria 25662
10 Ga0466715_015885 3300042616 Bacteria 12645
11 Ga0466723_297302 3300042618 Bacteria 1926
12 Ga0466726_034143 3300042619 Bacteria 45757
13 Ga0466728_238987 3300042620 Bacteria 3633
14 Ga0456237_0002790 3300041968 Bacteria 2828
15 Ga0466692_196387 3300042591 Bacteria 11129
16 Ga0466694_046539 3300042594 Bacteria 3820
17 Ga0466696_069087 3300042596 Bacteria 25119
18 Ga0466696_466578 3300042596 Bacteria 4837
19 Ga0466703_292827 3300042636 Bacteria 2867
20 Ga0466705_451082 3300042612 Bacteria 13208
21 Ga0466711_167123 3300042615 Bacteria 17216
22 Ga0466715_014306 3300042616 Bacteria 17032
23 Ga0466723_265313 3300042618 Bacteria 10361
24 Ga0466728_338401 3300042620 Bacteria 5902
25 Ga0123356_10070517 3300010049 Bacteria 3278
26 Ga0466713_064366 3300042602 Bacteria 3405
27 Ga0466705_062309 3300042612 Bacteria 6400
28 Ga0466692_028197 3300042591 Bacteria 36639
29 Ga0466691_061523 3300042593 Bacteria 5371
30 Ga0466709_230844 3300042648 Bacteria 8587
31 Ga0466727_041651 3300042655 Bacteria 4873
32 Ga0466705_399756 3300042612 Bacteria 6728
33 Ga0466711_275454 3300042615 Bacteria 22441
34 Ga0466723_002099 3300042618 Bacteria 11340
35 Ga0466723_033439 3300042618 Bacteria 9848
36 Ga0466726_159582 3300042619 Bacteria 14093
37 Ga0466728_236150 3300042620 Bacteria 8347
38 Ga0466713_144521 3300042602 Bacteria 6195
39 Ga0466722_120145 3300042609 Bacteria 4948
40 Ga0466691_117719 3300042593 Bacteria 7867
41 Ga0466696_456845 3300042596 Bacteria 4224
42 Ga0466703_065218 3300042636 Bacteria 7982
43 Ga0466704_086639 3300042643 Bacteria 26667
44 Ga0466704_111402 3300042643 Bacteria 4513
45 Ga0466704_235144 3300042643 Bacteria 29659
46 Ga0466709_064232 3300042648 Bacteria 10094
47 Ga0466709_376275 3300042648 Bacteria 10366
48 Ga0466711_145007 3300042615 Bacteria 4414
49 Ga0466715_106713 3300042616 Bacteria 2583
50 Ga0466715_445420 3300042616 Bacteria 16343
51 Ga0466723_007309 3300042618 Bacteria 5359
52 Ga0466723_024654 3300042618 Bacteria 62216
53 Ga0466726_108273 3300042619 Bacteria 13843
54 Ga0466726_491473 3300042619 Bacteria 1766
55 Ga0466719_028049 3300042606 Bacteria 40680
56 Ga0466722_186664 3300042609 Bacteria 6448
57 Ga0466705_029748 3300042612 Bacteria 29924
58 Ga0466690_412882 3300042590 Bacteria 2129
59 Ga0466692_077672 3300042591 Bacteria 18482
60 Ga0466696_183466 3300042596 Bacteria 2422
61 Ga0466704_395306 3300042643 Bacteria 11867
62 Ga0466709_413399 3300042648 Bacteria 2504
63 Ga0466708_217021 3300042652 Bacteria 11084
64 Ga0466708_367899 3300042652 Bacteria 11069
65 Ga0466711_407108 3300042615 Bacteria 25352
66 Ga0466723_345586 3300042618 Bacteria 28546
67 Ga0466728_100155 3300042620 Bacteria 13880
68 Ga0466728_188247 3300042620 Bacteria 7163
69 Ga0466691_110483 3300042593 Bacteria 9774
70 Ga0466696_112350 3300042596 Bacteria 9006
71 Ga0466703_025134 3300042636 Bacteria 9771
72 Ga0466703_092831 3300042636 Bacteria 29083
73 Ga0466704_165838 3300042643 Bacteria 4721
74 Ga0466708_049912 3300042652 Bacteria 10244
75 Ga0466711_344932 3300042615 Bacteria 3773
76 Ga0466715_209207 3300042616 Bacteria 7550
77 Ga0466726_417794 3300042619 Bacteria 15594
78 Ga0466716_205626 3300042605 Bacteria 5746
79 Ga0466719_065600 3300042606 Bacteria 2869
80 Ga0466722_138276 3300042609 Bacteria 8457
81 Ga0466705_076829 3300042612 Bacteria 7799
82 Ga0466692_097992 3300042591 Bacteria 1921
83 Ga0466692_125830 3300042591 Bacteria 7652
84 Ga0466703_056878 3300042636 Bacteria 11031
85 Ga0466704_218273 3300042643 Bacteria 27455
86 Ga0466704_508064 3300042643 Bacteria 7280
87 Ga0466708_071796 3300042652 Bacteria 29991
88 Ga0466715_121745 3300042616 Bacteria 9708
89 Ga0466723_071185 3300042618 Bacteria 53854
90 Ga0466723_102684 3300042618 Bacteria 1669
91 Ga0123353_10065748 3300010167 Bacteria 5821
92 Ga0466716_309999 3300042605 Bacteria 8808
93 Ga0466719_337836 3300042606 Unclassified 2894
94 Ga0466722_101044 3300042609 Bacteria 26620
95 Ga0466705_360862 3300042612 Bacteria 6529
96 Ga0466690_002266 3300042590 Bacteria 8722
97 Ga0466690_320527 3300042590 Bacteria 5497
98 Ga0466691_040073 3300042593 Bacteria 10793
99 Ga0466696_418265 3300042596 Bacteria 3854
100 Ga0466735_003452 3300042624 Bacteria 7499
101 Ga0466735_091913 3300042624 Bacteria 3762
102 Ga0466709_130934 3300042648 Bacteria 9596
103 Ga0466708_100581 3300042652 Bacteria 3391
104 Ga0466715_127815 3300042616 Bacteria 21986
105 Ga0466715_145706 3300042616 Bacteria 4958
106 Ga0466726_012027 3300042619 Bacteria 8992
107 Ga0466728_075597 3300042620 Bacteria 10227
108 Ga0123353_10367222 3300010167 Bacteria 2159
109 Ga0466707_200475 3300042601 Bacteria 1707
110 Ga0466716_074438 3300042605 Bacteria 33435
111 Ga0466719_138171 3300042606 Bacteria 15082

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042605 Ga0466716_074438 Ga0466716_074438_19696_21282 519
2 3300042652 Ga0466708_100581 Ga0466708_100581_1808_3376 522
3 3300042616 Ga0466715_106713 Ga0466715_106713_40_1626 523
4 3300042590 Ga0466690_412882 Ga0466690_412882_40_1626 528
5 3300042618 Ga0466723_102684 Ga0466723_102684_14_1600 528
6 3300042618 Ga0466723_297302 Ga0466723_297302_13_1599 528
7 3300042619 Ga0466726_491473 Ga0466726_491473_121_1749 542
8 3300042601 Ga0466707_200475 Ga0466707_200475_34_1680 548
9 3300042591 Ga0466692_097992 Ga0466692_097992_36_1796 586
10 3300042615 Ga0466711_344932 Ga0466711_344932_24_1838 604
11 3300042643 Ga0466704_086639 Ga0466704_086639_15330_17210 606
12 3300042612 Ga0466705_399756 Ga0466705_399756_471_2342 609
13 3300042643 Ga0466704_218273 Ga0466704_218273_5236_7113 609
14 3300042616 Ga0466715_121745 Ga0466715_121745_2938_4815 610
15 3300042593 Ga0466691_061523 Ga0466691_061523_2292_4130 612
16 3300042609 Ga0466722_101044 Ga0466722_101044_9743_11581 612
17 3300042615 Ga0466711_293849 Ga0466711_293849_18625_20463 612
18 3300042643 Ga0466704_165838 Ga0466704_165838_1469_3307 612
19 3300042596 Ga0466696_069087 Ga0466696_069087_14194_16071 613
20 3300042619 Ga0466726_012027 Ga0466726_012027_4502_6343 613
21 3300042590 Ga0466690_002266 Ga0466690_002266_2682_4532 616
22 3300042618 Ga0466723_265313 Ga0466723_265313_3604_5454 616
23 3300042620 Ga0466728_338401 Ga0466728_338401_235_2085 616
24 3300042636 Ga0466703_025134 Ga0466703_025134_2431_4281 616
25 3300042648 Ga0466709_386244 Ga0466709_386244_2255_4105 616
26 3300042593 Ga0466691_110483 Ga0466691_110483_2975_4828 617
27 3300042596 Ga0466696_418265 Ga0466696_418265_1186_3039 617
28 3300042605 Ga0466716_205626 Ga0466716_205626_58_1911 617
29 3300042606 Ga0466719_028049 Ga0466719_028049_10381_12234 617
30 3300042612 Ga0466705_062309 Ga0466705_062309_2362_4215 617
31 3300042616 Ga0466715_014306 Ga0466715_014306_14952_16805 617
32 3300042619 Ga0466726_034143 Ga0466726_034143_21093_22946 617
33 3300042620 Ga0466728_188247 Ga0466728_188247_2152_4005 617
34 3300042636 Ga0466703_092831 Ga0466703_092831_18415_20268 617
35 3300042636 Ga0466703_292827 Ga0466703_292827_682_2535 617
36 3300042648 Ga0466709_230844 Ga0466709_230844_496_2376 617
37 3300042590 Ga0466690_181360 Ga0466690_181360_2604_4460 618
38 3300042590 Ga0466690_320527 Ga0466690_320527_3500_5356 618
39 3300042591 Ga0466692_028197 Ga0466692_028197_11349_13205 618
40 3300042591 Ga0466692_196387 Ga0466692_196387_3034_4890 618
41 3300042596 Ga0466696_456845 Ga0466696_456845_1623_3479 618
42 3300042602 Ga0466713_064366 Ga0466713_064366_537_2393 618
43 3300042606 Ga0466719_337836 Ga0466719_337836_398_2254 618
44 3300042609 Ga0466722_138276 Ga0466722_138276_2901_4757 618
45 3300042615 Ga0466711_111716 Ga0466711_111716_17032_18888 618
46 3300042615 Ga0466711_145007 Ga0466711_145007_867_2723 618
47 3300042616 Ga0466715_145706 Ga0466715_145706_592_2448 618
48 3300042618 Ga0466723_024654 Ga0466723_024654_22045_23901 618
49 3300042618 Ga0466723_071185 Ga0466723_071185_42170_44026 618
50 3300042619 Ga0466726_108273 Ga0466726_108273_3114_4970 618
51 3300042620 Ga0466728_100155 Ga0466728_100155_1502_3358 618
52 3300042620 Ga0466728_236150 Ga0466728_236150_2452_4308 618
53 3300042620 Ga0466728_238987 Ga0466728_238987_141_1997 618
54 3300042624 Ga0466735_003452 Ga0466735_003452_3498_5354 618
55 3300042624 Ga0466735_091913 Ga0466735_091913_242_2098 618
56 3300042652 Ga0466708_217021 Ga0466708_217021_1805_3661 618
57 3300042652 Ga0466708_367899 Ga0466708_367899_926_2782 618
58 iso_pr_bacteria 2772190975 2773721851 618
59 3300042616 Ga0466715_015885 Ga0466715_015885_7956_9815 619
60 3300042636 Ga0466703_258371 Ga0466703_258371_3592_5451 619
61 3300042591 Ga0466692_077672 Ga0466692_077672_4251_6113 620
62 3300042615 Ga0466711_157042 Ga0466711_157042_8022_9884 620
63 3300042615 Ga0466711_275454 Ga0466711_275454_17342_19255 621
64 3300042612 Ga0466705_076829 Ga0466705_076829_4444_6312 622
65 3300042618 Ga0466723_345586 Ga0466723_345586_3843_5711 622
66 3300042643 Ga0466704_395306 Ga0466704_395306_4845_6713 622
67 3300042605 Ga0466716_309999 Ga0466716_309999_4890_6764 624
68 3300042615 Ga0466711_407108 Ga0466711_407108_11295_13169 624
69 3300042643 Ga0466704_235144 Ga0466704_235144_9236_11110 624
70 3300042593 Ga0466691_040073 Ga0466691_040073_2703_4580 625
71 3300042593 Ga0466691_117719 Ga0466691_117719_1106_2983 625
72 3300042596 Ga0466696_466578 Ga0466696_466578_732_2609 625
73 3300042602 Ga0466713_144521 Ga0466713_144521_2088_3965 625
74 3300042606 Ga0466719_138171 Ga0466719_138171_7802_9679 625
75 3300042612 Ga0466705_360862 Ga0466705_360862_3454_5331 625
76 3300042615 Ga0466711_167123 Ga0466711_167123_5366_7243 625
77 3300042618 Ga0466723_007309 Ga0466723_007309_15_1892 625
78 3300042618 Ga0466723_033439 Ga0466723_033439_1175_3052 625
79 3300042643 Ga0466704_508064 Ga0466704_508064_257_2134 625
80 3300042648 Ga0466709_305197 Ga0466709_305197_5054_6931 625
81 3300042655 Ga0466727_041651 Ga0466727_041651_1436_3313 625
82 iso_pr_bacteria 650716102 650884217 625
83 3300010049 Ga0123356_10070517 Ga0123356_100705172 626
84 3300041968 Ga0456237_0002790 Ga0456237_0002790_715_2595 626
85 3300042591 Ga0466692_125830 Ga0466692_125830_3647_5527 626
86 3300042596 Ga0466696_112350 Ga0466696_112350_1992_3872 626
87 3300042596 Ga0466696_183466 Ga0466696_183466_391_2271 626
88 3300042606 Ga0466719_065600 Ga0466719_065600_595_2475 626
89 3300042609 Ga0466722_120145 Ga0466722_120145_1817_3697 626
90 3300042609 Ga0466722_186664 Ga0466722_186664_2099_3979 626
91 3300042612 Ga0466705_029748 Ga0466705_029748_14216_16096 626
92 3300042612 Ga0466705_451082 Ga0466705_451082_11210_13090 626
93 3300042616 Ga0466715_127815 Ga0466715_127815_16556_18436 626
94 3300042616 Ga0466715_209207 Ga0466715_209207_2127_4007 626
95 3300042616 Ga0466715_445420 Ga0466715_445420_2336_4216 626
96 3300042618 Ga0466723_002099 Ga0466723_002099_7113_8993 626
97 3300042619 Ga0466726_159582 Ga0466726_159582_3434_5314 626
98 3300042619 Ga0466726_417794 Ga0466726_417794_3947_5827 626
99 3300042636 Ga0466703_065218 Ga0466703_065218_4361_6241 626
100 3300042636 Ga0466703_130402 Ga0466703_130402_6216_8096 626
101 3300042643 Ga0466704_111402 Ga0466704_111402_2475_4355 626
102 3300042648 Ga0466709_064232 Ga0466709_064232_46_1926 626
103 3300042656 Ga0466732_406953 Ga0466732_406953_762_2642 626
104 iso_pr_bacteria 650716099 650879246 626
105 3300042620 Ga0466728_075597 Ga0466728_075597_4722_6608 628
106 3300042652 Ga0466708_049912 Ga0466708_049912_4881_6770 629
107 3300010167 Ga0123353_10065748 Ga0123353_100657485 630
108 3300010167 Ga0123353_10367222 Ga0123353_103672222 633
109 3300042648 Ga0466709_376275 Ga0466709_376275_6200_8101 633
110 3300042652 Ga0466708_071796 Ga0466708_071796_25666_27567 633
111 3300042648 Ga0466709_130934 Ga0466709_130934_1472_3394 635
112 3300042636 Ga0466703_056878 Ga0466703_056878_3775_5685 636
113 3300042594 Ga0466694_046539 Ga0466694_046539_1620_3563 638
114 3300042648 Ga0466709_413399 Ga0466709_413399_415_2340 641

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain 231 365 0.96
PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain 437 596 0.94
PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain 43 137 0.87

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02776 GO:0030976 thiamine pyrophosphate binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.91 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.