Protein Family IF09676

Metagenome Isolate
139 Members
52 Samples
123 Scaffolds
945.28 Avg Length

🧬 Representative Sequence

ID
3300042648|Ga0466709_383817|Ga0466709_383817_1005_3950
Length
981 aa
Sequence
MARKRKDAGIQPAEEKESPDWPESGCISVWGARVHNLKNIDVELPRNRLSVITGMSGSGKSSLAFDTIFAEGQRRYIETFSAYARHFLGAIERPDVDKITGLSPVISIEQKTTNRNPRSTVGTTTEIYDFFRLLYARAGEAYSYLSGERMVKYTEEQVLELILNEYGGRKIYLLAPLVQNRKGHYKELFEQVRRKGYLNVRVDGELRELVHGMKLDRYRMHSIEVVIDKLKVEATDERRLKKSLRVAMKQGDGLVLVLDVETNEIRYYSRRLMCPVTGLSYSEPAPHRFSFNSPQGACPHCKGLGQVHLPDMEKIVPDPSLSIYNGGIAALGKYRNTLLFWQIESLCGKYGVTLKTPIRDLPAEAMDEIMNGTNDRLPLRNESLGNSGYLFSYEGVAKYILMQQDNDAPAVAQRWAEQFIGTAECPECHGRRLNREALHYRIDGKNIAELSALDVSELVKWADTIENKLSPRQQQIAGEILKEIRSRLRFLLDVGLDYLTPDRASATLSGGESQRIRLATQIGSRLVNVLYILDEPSIGLHQRDNMRLIRSLKDLRDTGNSVVVVEHDREMMLNADYVIDMGPKAGRLGGEIVFAGTPDEMLDTDTLTSSYLNGTRTIPLPPVRRKGSGQWLTLKGATGHNLKKVDVAFPLGTLICVTGVSGSGKSTLVNHTLQPLLSRHFYHSLTMPLPYGSIEGVEYLDKIVNVNQSPIGRSPRSNPATYTGVFSDIRNLFVALPEAKIRGYKPGRFSFNISGGRCEVCKGNGYRVVEMNFLPDVLVPCEECRGKRYNRETLEVRFRGKSIADVLDMTVHMAVEFFEAVPSIFHKIKVLQDVGLGYIKLGQPSSTLSGGESQRVKLATELARRDTGRTLYVLDEPTTGLHFEDIRVLLGVLNQLVDKGNTMIVIEHNLDVIKCADYLIDMGPDGGQKGGHILFTGTPEEMAAAHIQSYTAPFLKKELEMYQSFQGSIIQENEPFESLND

📊 Sample Types

Isolate 11.5%
Metagenome 88.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 26.9%
Blattidae 21.2%
Termitidae 17.3%
Unclassified 13.5%
Rhinotermitidae 7.7%
Passalidae 5.8%
Termopsidae 5.8%
Tenebrionidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 135
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
2 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
3 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
4 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
5 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
6 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
7 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
8 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
9 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
10 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
11 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
12 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
13 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
14 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
15 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
16 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
17 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
18 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
19 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
20 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
21 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
22 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
23 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
24 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
25 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
26 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
27 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
28 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
29 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
30 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
31 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
32 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
33 2923982719 Parabacteroides sp. 52 Isolate Blattidae
34 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
35 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
36 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
37 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
38 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
39 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
40 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
41 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
42 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
43 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
44 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
45 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
46 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
47 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
48 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
49 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
50 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
51 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
52 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_030958 3300042659 Bacteria 11257
2 Ga0068302_10014307 3300005071 Bacteria 12890
3 Ga0068305_10010366 3300005083 Bacteria 14181
4 Ga0466705_498486 3300042612 Bacteria 9191
5 Ga0466723_342910 3300042618 Bacteria 13624
6 Ga0466690_073286 3300042590 Bacteria 5619
7 Ga0466691_087899 3300042593 Bacteria 15107
8 Ga0466700_376010 3300042600 Bacteria 38603
9 Ga0466700_381027 3300042600 Bacteria 12866
10 Ga0466713_020565 3300042602 Bacteria 47866
11 Ga0466709_362123 3300042648 Bacteria 19052
12 IMNBL1DRAFT_c0000101 3300000062 Bacteria 74878
13 IMNBL1DRAFT_c0011335 3300000062 Bacteria 4174
14 JGI24705J35276_12238234 3300002504 Bacteria 17623
15 Ga0466711_295610 3300042615 Bacteria 14335
16 Ga0466711_421713 3300042615 Bacteria 3461
17 Ga0466690_122651 3300042590 Bacteria 31212
18 Ga0466696_289044 3300042596 Bacteria 7047
19 Ga0466716_051604 3300042605 Bacteria 25140
20 Ga0466719_459978 3300042606 Bacteria 14509
21 Ga0466722_196218 3300042609 Bacteria 6535
22 Ga0466722_245435 3300042609 Bacteria 23596
23 Ga0466703_052468 3300042636 Bacteria 69521
24 Ga0466703_274572 3300042636 Bacteria 12534
25 Ga0466704_218016 3300042643 Bacteria 40184
26 Ga0466733_209232 3300042659 Bacteria 28030
27 Ga0123357_10013319 3300009784 Bacteria 10665
28 Ga0466711_081357 3300042615 Bacteria 4099
29 Ga0466715_601574 3300042616 Bacteria 17986
30 Ga0466723_011896 3300042618 Bacteria 13950
31 Ga0466726_155838 3300042619 Bacteria 18951
32 Ga0466728_203898 3300042620 Bacteria 9563
33 Ga0466656_237373 3300042550 Bacteria 15096
34 Ga0466692_038425 3300042591 Bacteria 7622
35 Ga0466696_284492 3300042596 Bacteria 3633
36 Ga0466713_008762 3300042602 Bacteria 34128
37 Ga0466722_137339 3300042609 Bacteria 3412
38 Ga0466703_291422 3300042636 Bacteria 15765
39 Ga0466704_246151 3300042643 Bacteria 6967
40 Ga0466708_224946 3300042652 Bacteria 22929
41 Ga0466725_318648 3300042654 Bacteria 13555
42 Ga0466727_020044 3300042655 Bacteria 42576
43 Ga0466727_042118 3300042655 Bacteria 16826
44 Ga0466733_217642 3300042659 Bacteria 4300
45 2227066904 2225789003 Unclassified 15156
46 IMNBL1DRAFT_c0000880 3300000062 Bacteria 23420
47 IMNBL1DRAFT_c0004652 3300000062 Bacteria 8145
48 JGI24702J35022_10000701 3300002462 Bacteria 20491
49 Ga0466715_079603 3300042616 Bacteria 222305
50 Ga0466715_161567 3300042616 Bacteria 22971
51 Ga0466723_072433 3300042618 Bacteria 28433
52 Ga0466728_053584 3300042620 Bacteria 26144
53 Ga0466691_118436 3300042593 Bacteria 14329
54 Ga0466707_036218 3300042601 Bacteria 12429
55 Ga0466722_071375 3300042609 Bacteria 22923
56 Ga0466729_223777 3300042621 Unclassified 7915
57 Ga0466703_193916 3300042636 Bacteria 18273
58 Ga0068305_10030644 3300005083 Unclassified 7333
59 Ga0466711_041677 3300042615 Bacteria 34708
60 Ga0466711_114165 3300042615 Bacteria 4207
61 Ga0466715_360218 3300042616 Bacteria 7203
62 Ga0466723_036926 3300042618 Bacteria 32420
63 Ga0466696_459672 3300042596 Bacteria 110905
64 Ga0466713_061789 3300042602 Bacteria 88378
65 Ga0466713_074190 3300042602 Bacteria 11761
66 Ga0466719_018270 3300042606 Bacteria 5864
67 Ga0466722_056814 3300042609 Bacteria 80468
68 Ga0466703_180144 3300042636 Bacteria 9697
69 Ga0466704_104989 3300042643 Bacteria 11862
70 Ga0466704_296240 3300042643 Bacteria 16716
71 Ga0466704_534273 3300042643 Bacteria 4957
72 Ga0466709_419438 3300042648 Bacteria 66983
73 Ga0466708_185879 3300042652 Bacteria 12139
74 Ga0466727_317540 3300042655 Bacteria 11618
75 2227549634 2225789004 Bacteria 15063
76 JGI24699J35502_11133458 3300002509 Bacteria 10767
77 Ga0123357_10037575 3300009784 Bacteria 6592
78 Ga0466711_045620 3300042615 Bacteria 22798
79 Ga0466711_321203 3300042615 Bacteria 8765
80 Ga0466715_164719 3300042616 Bacteria 18203
81 Ga0466723_055263 3300042618 Bacteria 32547
82 Ga0466726_443560 3300042619 Bacteria 18845
83 Ga0466728_122860 3300042620 Bacteria 67185
84 Ga0466696_074655 3300042596 Bacteria 12961
85 Ga0466696_108311 3300042596 Bacteria 8829
86 Ga0466707_107760 3300042601 Bacteria 9983
87 Ga0466713_033740 3300042602 Bacteria 18936
88 Ga0466713_043416 3300042602 Bacteria 6079
89 Ga0466713_133688 3300042602 Bacteria 5970
90 Ga0466716_339636 3300042605 Bacteria 18089
91 Ga0466719_060825 3300042606 Bacteria 8010
92 Ga0466719_423988 3300042606 Bacteria 5463
93 Ga0466722_096933 3300042609 Bacteria 11285
94 Ga0466705_104121 3300042612 Bacteria 8624
95 Ga0466705_191819 3300042612 Bacteria 7147
96 Ga0466705_361326 3300042612 Bacteria 13383
97 Ga0466733_027595 3300042659 Bacteria 96004
98 Ga0466733_144405 3300042659 Bacteria 17873
99 2227494071 2225789004 Bacteria 20234
100 2227504339 2225789004 Unclassified 3723
101 JGI24699J35502_11133955 3300002509 Bacteria 21167
102 Ga0123357_10000326 3300009784 Bacteria 45153
103 Ga0466705_418678 3300042612 Bacteria 18793
104 Ga0466711_069054 3300042615 Bacteria 7657
105 Ga0466715_046995 3300042616 Bacteria 9975
106 Ga0466707_184663 3300042601 Bacteria 9319
107 Ga0466704_450066 3300042643 Bacteria 15714
108 Ga0466709_383817 3300042648 Bacteria 8094
109 Ga0466708_021896 3300042652 Bacteria 36089
110 Ga0466708_205257 3300042652 Bacteria 30810
111 Ga0466733_150744 3300042659 Bacteria 51643
112 Ga0562377_0004 3300056842 Bacteria 3525959
113 JGI24702J35022_10000687 3300002462 Bacteria 20622
114 JGI24702J35022_10006975 3300002462 Bacteria 6495
115 Ga0123354_10023938 3300010882 Bacteria 9633
116 Ga0466711_391154 3300042615 Bacteria 12882
117 Ga0466715_082422 3300042616 Bacteria 12463
118 Ga0466692_184435 3300042591 Bacteria 106081
119 Ga0466691_082219 3300042593 Bacteria 62191
120 Ga0466713_110965 3300042602 Bacteria 66281
121 Ga0466703_033800 3300042636 Bacteria 21250
122 Ga0466704_057310 3300042643 Bacteria 10748
123 Ga0466704_341055 3300042643 Bacteria 7175

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005083 Ga0068305_10030644 Ga0068305_100306444 814
2 iso_pr_bacteria 2820759988 2820760075 843
3 3300042620 Ga0466728_053584 Ga0466728_053584_645_3371 908
4 3300042601 Ga0466707_107760 Ga0466707_107760_37_2778 913
5 3300042602 Ga0466713_008762 Ga0466713_008762_19473_22310 921
6 3300042620 Ga0466728_122860 Ga0466728_122860_34055_36829 924
7 3300042659 Ga0466733_209232 Ga0466733_209232_16003_18843 925
8 3300002509 JGI24699J35502_11133955 JGI24699J35502_111339553 927
9 3300042609 Ga0466722_196218 Ga0466722_196218_1010_3826 927
10 3300042596 Ga0466696_074655 Ga0466696_074655_9635_12481 930
11 3300042596 Ga0466696_459672 Ga0466696_459672_64483_67323 933
12 3300042648 Ga0466709_419438 Ga0466709_419438_43484_46318 933
13 3300042659 Ga0466733_030958 Ga0466733_030958_756_3626 933
14 3300042618 Ga0466723_011896 Ga0466723_011896_38_2869 934
15 3300042636 Ga0466703_274572 Ga0466703_274572_8565_11399 934
16 3300042602 Ga0466713_043416 Ga0466713_043416_2679_5522 935
17 3300042618 Ga0466723_036926 Ga0466723_036926_23037_25910 935
18 3300042636 Ga0466703_180144 Ga0466703_180144_2870_5737 935
19 3300042643 Ga0466704_057310 Ga0466704_057310_5208_8015 935
20 3300042643 Ga0466704_450066 Ga0466704_450066_143_2983 935
21 3300042618 Ga0466723_342910 Ga0466723_342910_617_3466 936
22 iso_pr_bacteria 2820762746 2820763580 936
23 3300042621 Ga0466729_223777 Ga0466729_223777_4406_7255 937
24 3300042659 Ga0466733_027595 Ga0466733_027595_28594_31443 937
25 3300042596 Ga0466696_289044 Ga0466696_289044_2625_5471 938
26 3300042615 Ga0466711_041677 Ga0466711_041677_1259_4102 938
27 3300002462 JGI24702J35022_10000701 JGI24702J35022_100007017 939
28 3300042636 Ga0466703_052468 Ga0466703_052468_10438_13257 939
29 3300042593 Ga0466691_082219 Ga0466691_082219_50379_53201 940
30 3300042615 Ga0466711_114165 Ga0466711_114165_1086_3932 941
31 3300042616 Ga0466715_079603 Ga0466715_079603_105020_107872 941
32 3300042618 Ga0466723_072433 Ga0466723_072433_22989_25814 941
33 3300042609 Ga0466722_245435 Ga0466722_245435_14339_17203 942
34 3300042615 Ga0466711_081357 Ga0466711_081357_1081_3930 942
35 3300042616 Ga0466715_601574 Ga0466715_601574_7902_10763 942
36 3300042654 Ga0466725_318648 Ga0466725_318648_734_3580 942
37 3300042591 Ga0466692_184435 Ga0466692_184435_83578_86409 943
38 3300042600 Ga0466700_376010 Ga0466700_376010_30346_33177 943
39 3300042616 Ga0466715_164719 Ga0466715_164719_14864_17695 943
40 3300042655 Ga0466727_042118 Ga0466727_042118_9883_12714 943
41 iso_pr_bacteria 2695420314 2695471213 943
42 iso_pr_bacteria 2940244548 2940247266 943
43 iso_pr_bacteria 2940248789 2940251040 943
44 iso_pr_bacteria 2940253009 2940255288 943
45 iso_pr_bacteria 2940257232 2940259285 943
46 iso_pr_bacteria 643348524 643423290 943
47 3300042601 Ga0466707_184663 Ga0466707_184663_3377_6211 944
48 iso_pr_bacteria 8100166142 8100170756 944
49 3300009784 Ga0123357_10037575 Ga0123357_100375753 945
50 3300042602 Ga0466713_110965 Ga0466713_110965_40693_43530 945
51 3300042602 Ga0466713_133688 Ga0466713_133688_285_3122 945
52 3300042643 Ga0466704_218016 Ga0466704_218016_17979_20816 945
53 iso_pr_bacteria 2910942425 2910943898 945
54 iso_pr_bacteria 2940209341 2940211569 945
55 3300010882 Ga0123354_10023938 Ga0123354_100239382 946
56 3300042550 Ga0466656_237373 Ga0466656_237373_601_3441 946
57 3300042606 Ga0466719_459978 Ga0466719_459978_4741_7581 946
58 3300042619 Ga0466726_155838 Ga0466726_155838_4222_7062 946
59 3300042636 Ga0466703_291422 Ga0466703_291422_11819_14692 946
60 iso_pr_bacteria 2940199050 2940199879 946
61 iso_pr_bacteria 2940346213 2940346841 946
62 2225789003 2227066904 2227425198 947
63 2225789004 2227549634 2228078159 947
64 3300002509 JGI24699J35502_11133458 JGI24699J35502_111334587 947
65 3300005071 Ga0068302_10014307 Ga0068302_1001430710 947
66 3300042615 Ga0466711_045620 Ga0466711_045620_928_3771 947
67 3300042616 Ga0466715_161567 Ga0466715_161567_15122_17965 947
68 3300042616 Ga0466715_360218 Ga0466715_360218_1053_3896 947
69 3300056842 Ga0562377_0004 Ga0562377_0004_1649447_1652290 947
70 2225789004 2227494071 2227969257 948
71 2225789004 2227504339 2227990275 948
72 3300000062 IMNBL1DRAFT_c0000880 IMNBL1DRAFT_00008804 948
73 3300000062 IMNBL1DRAFT_c0004652 IMNBL1DRAFT_00046527 948
74 3300009784 Ga0123357_10013319 Ga0123357_100133199 948
75 3300042596 Ga0466696_284492 Ga0466696_284492_525_3371 948
76 3300042602 Ga0466713_074190 Ga0466713_074190_6570_9416 948
77 3300042609 Ga0466722_056814 Ga0466722_056814_76386_79232 948
78 3300042615 Ga0466711_069054 Ga0466711_069054_2886_5732 948
79 3300042615 Ga0466711_391154 Ga0466711_391154_1920_4766 948
80 3300042616 Ga0466715_082422 Ga0466715_082422_9424_12270 948
81 3300042643 Ga0466704_246151 Ga0466704_246151_1485_4331 948
82 3300042652 Ga0466708_021896 Ga0466708_021896_29623_32469 948
83 3300042659 Ga0466733_217642 Ga0466733_217642_1241_4087 948
84 3300000062 IMNBL1DRAFT_c0011335 IMNBL1DRAFT_00113353 949
85 3300042600 Ga0466700_381027 Ga0466700_381027_8219_11068 949
86 3300042609 Ga0466722_071375 Ga0466722_071375_15290_18139 949
87 3300042612 Ga0466705_361326 Ga0466705_361326_3599_6448 949
88 iso_pr_bacteria 2923982719 2923983058 949
89 iso_pr_bacteria 2940371297 2940373277 949
90 3300009784 Ga0123357_10000326 Ga0123357_100003266 950
91 3300042590 Ga0466690_073286 Ga0466690_073286_620_3493 950
92 3300042590 Ga0466690_122651 Ga0466690_122651_4847_7699 950
93 3300042605 Ga0466716_339636 Ga0466716_339636_11888_14740 950
94 3300042615 Ga0466711_421713 Ga0466711_421713_518_3370 950
95 3300042618 Ga0466723_055263 Ga0466723_055263_26148_29027 950
96 3300042619 Ga0466726_443560 Ga0466726_443560_9154_12006 950
97 3300042620 Ga0466728_203898 Ga0466728_203898_3398_6250 950
98 3300042648 Ga0466709_362123 Ga0466709_362123_3677_6529 950
99 3300042655 Ga0466727_020044 Ga0466727_020044_20675_23527 950
100 3300002504 JGI24705J35276_12238234 JGI24705J35276_122382348 951
101 3300042596 Ga0466696_108311 Ga0466696_108311_3374_6229 951
102 3300042601 Ga0466707_036218 Ga0466707_036218_6324_9179 951
103 3300042602 Ga0466713_033740 Ga0466713_033740_7537_10392 951
104 3300042602 Ga0466713_061789 Ga0466713_061789_46531_49386 951
105 3300042615 Ga0466711_321203 Ga0466711_321203_5312_8167 951
106 3300042643 Ga0466704_534273 Ga0466704_534273_1823_4678 951
107 3300005083 Ga0068305_10010366 Ga0068305_1001036612 952
108 3300042606 Ga0466719_018270 Ga0466719_018270_2194_5079 952
109 3300042606 Ga0466719_423988 Ga0466719_423988_1517_4393 952
110 3300042612 Ga0466705_104121 Ga0466705_104121_2318_5176 952
111 3300042612 Ga0466705_498486 Ga0466705_498486_3634_6513 952
112 3300042659 Ga0466733_150744 Ga0466733_150744_29754_32612 952
113 iso_pr_bacteria 2940195863 2940196622 952
114 3300042615 Ga0466711_295610 Ga0466711_295610_5724_8585 953
115 3300042609 Ga0466722_137339 Ga0466722_137339_424_3288 954
116 3300042609 Ga0466722_096933 Ga0466722_096933_2386_5274 955
117 3300042612 Ga0466705_418678 Ga0466705_418678_15333_18200 955
118 3300042643 Ga0466704_104989 Ga0466704_104989_8617_11484 955
119 3300002462 JGI24702J35022_10006975 JGI24702J35022_100069753 957
120 3300042616 Ga0466715_046995 Ga0466715_046995_6338_9214 958
121 3300000062 IMNBL1DRAFT_c0000101 IMNBL1DRAFT_000010142 959
122 3300002462 JGI24702J35022_10000687 JGI24702J35022_1000068716 959
123 3300042643 Ga0466704_296240 Ga0466704_296240_13073_15952 959
124 3300042606 Ga0466719_060825 Ga0466719_060825_1180_4062 960
125 3300042636 Ga0466703_033800 Ga0466703_033800_15061_17943 960
126 3300042652 Ga0466708_185879 Ga0466708_185879_5752_8634 960
127 3300042591 Ga0466692_038425 Ga0466692_038425_382_3294 961
128 3300042593 Ga0466691_087899 Ga0466691_087899_9261_12146 961
129 3300042659 Ga0466733_144405 Ga0466733_144405_8609_11494 961
130 3300042605 Ga0466716_051604 Ga0466716_051604_3564_6452 962
131 3300042643 Ga0466704_341055 Ga0466704_341055_2968_5862 964
132 3300042652 Ga0466708_224946 Ga0466708_224946_7367_10261 964
133 3300042612 Ga0466705_191819 Ga0466705_191819_92_2989 965
134 3300042593 Ga0466691_118436 Ga0466691_118436_1378_4281 967
135 3300042655 Ga0466727_317540 Ga0466727_317540_3583_6504 968
136 3300042652 Ga0466708_205257 Ga0466708_205257_24499_27408 969
137 3300042602 Ga0466713_020565 Ga0466713_020565_24947_27862 971
138 3300042636 Ga0466703_193916 Ga0466703_193916_11448_14384 978
139 3300042648 Ga0466709_383817 Ga0466709_383817_1005_3950 981

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF17760 UvrA_inter UvrA interaction domain 154 259 0.97
PF17755 UvrA_DNA-bind UvrA DNA-binding domain 311 417 0.88

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.