Protein Family IF09675
Metagenome
Isolate
134
Members
56
Samples
120
Scaffolds
108.16
Avg Length
Representative Sequence
- ID
- 3300042648|Ga0466709_377300|Ga0466709_377300_1820_2185
- Length
- 121 aa
- Sequence
- MEFPINKGIGKPAEFQGLKAQYLFIFAGGLLGLFVVFVIMYMVGVNQWVCIIFGITAALTLVYGTFHLNSKYGEHGLMKVQAKSNHPRYVISRRRFSRLFINKISNIINKIFSTSFYFSHN
Sample Types
Isolate
10.4%
Metagenome
89.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.3%
Kalotermitidae
23.2%
Blattidae
12.5%
Unclassified
7.1%
Termopsidae
5.4%
Rhinotermitidae
5.4%
Passalidae
3.6%
Tenebrionidae
1.8%
Hodotermitidae
1.8%
Taxonomy
Archaea
0
Bacteria
132
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 10 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 11 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 12 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 13 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 14 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 15 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 16 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 17 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 23 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 24 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 25 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 26 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 27 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 28 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 29 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 30 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 31 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 32 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 35 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 36 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 37 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 38 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 39 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 40 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 41 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 42 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 43 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 44 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 45 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 46 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 47 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 48 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 49 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 50 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 51 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 52 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 53 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 54 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 55 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 56 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466731_217166 | 3300042622 | Bacteria | 1287 |
| 2 | Ga0466734_075814 | 3300042623 | Bacteria | 1301 |
| 3 | Ga0466735_146182 | 3300042624 | Bacteria | 3239 |
| 4 | Ga0466725_309654 | 3300042654 | Bacteria | 13879 |
| 5 | Ga0466657_366858 | 3300042582 | Bacteria | 1496 |
| 6 | Ga0466696_044705 | 3300042596 | Bacteria | 8492 |
| 7 | Ga0466696_265539 | 3300042596 | Bacteria | 7371 |
| 8 | Ga0466711_132699 | 3300042615 | Bacteria | 17238 |
| 9 | Ga0466726_158276 | 3300042619 | Bacteria | 5264 |
| 10 | Ga0123353_11454744 | 3300010167 | Bacteria | 876 |
| 11 | Ga0466700_383757 | 3300042600 | Bacteria | 2044 |
| 12 | Ga0466719_326134 | 3300042606 | Bacteria | 5854 |
| 13 | Ga0466698_322535 | 3300042610 | Bacteria | 1413 |
| 14 | 2227308582 | 2225789004 | Bacteria | 6530 |
| 15 | Ga0466709_239935 | 3300042648 | Bacteria | 6060 |
| 16 | Ga0466708_155311 | 3300042652 | Bacteria | 10754 |
| 17 | Ga0466725_256828 | 3300042654 | Bacteria | 1245 |
| 18 | Ga0466692_106924 | 3300042591 | Bacteria | 4215 |
| 19 | Ga0466696_427597 | 3300042596 | Bacteria | 7472 |
| 20 | Ga0466723_324695 | 3300042618 | Bacteria | 3888 |
| 21 | Ga0466726_244579 | 3300042619 | Bacteria | 2506 |
| 22 | Ga0466701_100107 | 3300042598 | Bacteria | 18629 |
| 23 | Ga0466700_006414 | 3300042600 | Bacteria | 4483 |
| 24 | Ga0466700_085941 | 3300042600 | Bacteria | 1042 |
| 25 | Ga0466717_006971 | 3300042604 | Bacteria | 1718 |
| 26 | Ga0466719_262735 | 3300042606 | Bacteria | 3955 |
| 27 | Ga0466697_047995 | 3300042611 | Bacteria | 1455 |
| 28 | Ga0466705_166262 | 3300042612 | Bacteria | 21815 |
| 29 | Ga0466705_345017 | 3300042612 | Bacteria | 1769 |
| 30 | Ga0466709_103775 | 3300042648 | Bacteria | 1055 |
| 31 | Ga0466727_015091 | 3300042655 | Bacteria | 11090 |
| 32 | Ga0466727_183800 | 3300042655 | Bacteria | 6561 |
| 33 | Ga0466692_034932 | 3300042591 | Bacteria | 8775 |
| 34 | Ga0466705_527020 | 3300042612 | Bacteria | 1666 |
| 35 | Ga0123353_10222977 | 3300010167 | Bacteria | 2946 |
| 36 | Ga0123353_10271201 | 3300010167 | Unclassified | 2614 |
| 37 | Ga0466700_158009 | 3300042600 | Bacteria | 7133 |
| 38 | Ga0466716_272898 | 3300042605 | Bacteria | 1494 |
| 39 | Ga0466722_013623 | 3300042609 | Bacteria | 7620 |
| 40 | JGI24702J35022_10096872 | 3300002462 | Bacteria | 1611 |
| 41 | Ga0072940_1436375 | 3300005200 | Bacteria | 719 |
| 42 | Ga0466705_161625 | 3300042612 | Bacteria | 2869 |
| 43 | Ga0466732_027416 | 3300042656 | Bacteria | 1231 |
| 44 | Ga0466734_063361 | 3300042623 | Bacteria | 1190 |
| 45 | Ga0466703_191892 | 3300042636 | Bacteria | 1213 |
| 46 | Ga0466704_204470 | 3300042643 | Bacteria | 4203 |
| 47 | Ga0466709_377300 | 3300042648 | Bacteria | 2908 |
| 48 | Ga0466691_047246 | 3300042593 | Bacteria | 1167 |
| 49 | Ga0466696_321315 | 3300042596 | Bacteria | 3056 |
| 50 | Ga0466711_003090 | 3300042615 | Bacteria | 1168 |
| 51 | Ga0466711_330164 | 3300042615 | Bacteria | 1001 |
| 52 | Ga0466711_342009 | 3300042615 | Bacteria | 1335 |
| 53 | Ga0123357_10177545 | 3300009784 | Bacteria | 2499 |
| 54 | Ga0123356_12002533 | 3300010049 | Bacteria | 722 |
| 55 | Ga0123354_10207255 | 3300010882 | Bacteria | 2132 |
| 56 | Ga0466700_020811 | 3300042600 | Bacteria | 3151 |
| 57 | Ga0466707_203571 | 3300042601 | Bacteria | 51511 |
| 58 | Ga0466707_323585 | 3300042601 | Bacteria | 9462 |
| 59 | Ga0466705_110688 | 3300042612 | Bacteria | 3625 |
| 60 | Ga0466705_239841 | 3300042612 | Bacteria | 3838 |
| 61 | Ga0466709_129848 | 3300042648 | Bacteria | 2109 |
| 62 | Ga0466657_369341 | 3300042582 | Bacteria | 12033 |
| 63 | Ga0466696_355066 | 3300042596 | Bacteria | 2735 |
| 64 | Ga0466701_007453 | 3300042598 | Bacteria | 1328 |
| 65 | Ga0466711_156097 | 3300042615 | Bacteria | 24351 |
| 66 | Ga0466711_324027 | 3300042615 | Bacteria | 17404 |
| 67 | Ga0466715_528982 | 3300042616 | Bacteria | 6055 |
| 68 | Ga0466723_080105 | 3300042618 | Bacteria | 2279 |
| 69 | Ga0466728_240460 | 3300042620 | Bacteria | 21580 |
| 70 | Ga0466701_076413 | 3300042598 | Bacteria | 1740 |
| 71 | Ga0466707_304139 | 3300042601 | Bacteria | 1007 |
| 72 | Ga0466713_154426 | 3300042602 | Bacteria | 1199 |
| 73 | Ga0466721_332085 | 3300042608 | Bacteria | 1109 |
| 74 | JGI24705J35276_12124039 | 3300002504 | Bacteria | 1081 |
| 75 | Ga0466703_291505 | 3300042636 | Bacteria | 1945 |
| 76 | Ga0466704_086312 | 3300042643 | Bacteria | 17632 |
| 77 | Ga0466727_216658 | 3300042655 | Bacteria | 47142 |
| 78 | Ga0466692_056206 | 3300042591 | Bacteria | 17712 |
| 79 | Ga0466691_075067 | 3300042593 | Bacteria | 3193 |
| 80 | Ga0466728_022464 | 3300042620 | Bacteria | 12031 |
| 81 | Ga0466701_030297 | 3300042598 | Bacteria | 1214 |
| 82 | Ga0466701_037367 | 3300042598 | Bacteria | 3542 |
| 83 | Ga0466701_092529 | 3300042598 | Bacteria | 1789 |
| 84 | Ga0466719_215571 | 3300042606 | Bacteria | 8576 |
| 85 | Ga0466722_007759 | 3300042609 | Bacteria | 4694 |
| 86 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 87 | Ga0466703_143150 | 3300042636 | Bacteria | 21440 |
| 88 | Ga0466703_339203 | 3300042636 | Bacteria | 7034 |
| 89 | Ga0466704_378831 | 3300042643 | Bacteria | 7228 |
| 90 | Ga0466727_347878 | 3300042655 | Bacteria | 3795 |
| 91 | Ga0466657_007359 | 3300042582 | Bacteria | 8532 |
| 92 | Ga0466691_055440 | 3300042593 | Unclassified | 5637 |
| 93 | Ga0466696_115374 | 3300042596 | Bacteria | 11820 |
| 94 | Ga0466711_229688 | 3300042615 | Bacteria | 2384 |
| 95 | Ga0466715_171837 | 3300042616 | Bacteria | 14658 |
| 96 | Ga0466715_368853 | 3300042616 | Bacteria | 1036 |
| 97 | Ga0466706_247151 | 3300042599 | Bacteria | 6772 |
| 98 | Ga0466707_080292 | 3300042601 | Bacteria | 18581 |
| 99 | Ga0466722_258541 | 3300042609 | Bacteria | 12058 |
| 100 | 2227078021 | 2225789003 | Bacteria | 2126 |
| 101 | JGI24699J35502_10505367 | 3300002509 | Bacteria | 619 |
| 102 | Ga0466705_161380 | 3300042612 | Bacteria | 8347 |
| 103 | Ga0466733_006897 | 3300042659 | Bacteria | 4520 |
| 104 | Ga0466733_038967 | 3300042659 | Bacteria | 1772 |
| 105 | Ga0466734_083710 | 3300042623 | Bacteria | 1037 |
| 106 | Ga0466735_058731 | 3300042624 | Bacteria | 6383 |
| 107 | Ga0466708_149359 | 3300042652 | Bacteria | 2006 |
| 108 | Ga0466657_207043 | 3300042582 | Bacteria | 3254 |
| 109 | Ga0466696_308617 | 3300042596 | Bacteria | 7634 |
| 110 | Ga0466711_137169 | 3300042615 | Bacteria | 2501 |
| 111 | Ga0466711_265088 | 3300042615 | Bacteria | 1410 |
| 112 | Ga0466715_176119 | 3300042616 | Bacteria | 3631 |
| 113 | Ga0466715_211362 | 3300042616 | Bacteria | 21735 |
| 114 | Ga0466728_103428 | 3300042620 | Bacteria | 2410 |
| 115 | Ga0123353_10006477 | 3300010167 | Bacteria | 15590 |
| 116 | Ga0123354_10000080 | 3300010882 | Bacteria | 72384 |
| 117 | Ga0123354_10167126 | 3300010882 | Bacteria | 2580 |
| 118 | Ga0466714_111665 | 3300042603 | Bacteria | 3970 |
| 119 | Ga0466722_154214 | 3300042609 | Bacteria | 1101 |
| 120 | Nasutiter_FTJKGMZ01CJYBX | 2030936001 | Bacteria | 589 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042612 | Ga0466705_161625 | Ga0466705_161625_1965_2288 | 97 |
| 2 | 2030936001 | Nasutiter_FTJKGMZ01CJYBX | Nasutiterm_1172810 | 100 |
| 3 | 3300042648 | Ga0466709_103775 | Ga0466709_103775_292_600 | 102 |
| 4 | 3300042610 | Ga0466698_322535 | Ga0466698_322535_987_1298 | 103 |
| 5 | 3300042636 | Ga0466703_339203 | Ga0466703_339203_1292_1603 | 103 |
| 6 | 3300042655 | Ga0466727_015091 | Ga0466727_015091_9886_10197 | 103 |
| 7 | 3300042598 | Ga0466701_092529 | Ga0466701_092529_1338_1652 | 104 |
| 8 | 3300042655 | Ga0466727_183800 | Ga0466727_183800_1675_1989 | 104 |
| 9 | 3300042659 | Ga0466733_038967 | Ga0466733_038967_1269_1583 | 104 |
| 10 | 3300042600 | Ga0466700_383757 | Ga0466700_383757_1650_1967 | 105 |
| 11 | 3300042615 | Ga0466711_003090 | Ga0466711_003090_464_781 | 105 |
| 12 | 3300042636 | Ga0466703_291505 | Ga0466703_291505_287_604 | 105 |
| 13 | 3300042654 | Ga0466725_256828 | Ga0466725_256828_736_1053 | 105 |
| 14 | 3300002504 | JGI24705J35276_12124039 | JGI24705J35276_121240392 | 106 |
| 15 | 3300005200 | Ga0072940_1436375 | Ga0072940_14363752 | 106 |
| 16 | 3300042582 | Ga0466657_366858 | Ga0466657_366858_437_757 | 106 |
| 17 | 3300042596 | Ga0466696_044705 | Ga0466696_044705_4849_5169 | 106 |
| 18 | 3300042596 | Ga0466696_115374 | Ga0466696_115374_2541_2861 | 106 |
| 19 | 3300042596 | Ga0466696_427597 | Ga0466696_427597_4234_4554 | 106 |
| 20 | 3300042598 | Ga0466701_076413 | Ga0466701_076413_1242_1562 | 106 |
| 21 | 3300042604 | Ga0466717_006971 | Ga0466717_006971_328_648 | 106 |
| 22 | 3300042608 | Ga0466721_332085 | Ga0466721_332085_83_403 | 106 |
| 23 | 3300042612 | Ga0466705_527020 | Ga0466705_527020_268_588 | 106 |
| 24 | 3300042623 | Ga0466734_063361 | Ga0466734_063361_483_803 | 106 |
| 25 | 3300042656 | Ga0466732_027416 | Ga0466732_027416_744_1064 | 106 |
| 26 | 2225789004 | 2227308582 | 2227758442 | 107 |
| 27 | 3300010049 | Ga0123356_12002533 | Ga0123356_120025332 | 107 |
| 28 | 3300010167 | Ga0123353_11454744 | Ga0123353_114547442 | 107 |
| 29 | 3300042582 | Ga0466657_007359 | Ga0466657_007359_4605_4928 | 107 |
| 30 | 3300042582 | Ga0466657_207043 | Ga0466657_207043_117_440 | 107 |
| 31 | 3300042591 | Ga0466692_034932 | Ga0466692_034932_353_676 | 107 |
| 32 | 3300042591 | Ga0466692_056206 | Ga0466692_056206_8126_8449 | 107 |
| 33 | 3300042591 | Ga0466692_106924 | Ga0466692_106924_433_756 | 107 |
| 34 | 3300042593 | Ga0466691_047246 | Ga0466691_047246_351_674 | 107 |
| 35 | 3300042593 | Ga0466691_055440 | Ga0466691_055440_5259_5582 | 107 |
| 36 | 3300042593 | Ga0466691_075067 | Ga0466691_075067_2401_2724 | 107 |
| 37 | 3300042596 | Ga0466696_308617 | Ga0466696_308617_6265_6588 | 107 |
| 38 | 3300042598 | Ga0466701_100107 | Ga0466701_100107_10234_10557 | 107 |
| 39 | 3300042599 | Ga0466706_247151 | Ga0466706_247151_105_428 | 107 |
| 40 | 3300042601 | Ga0466707_203571 | Ga0466707_203571_8216_8539 | 107 |
| 41 | 3300042601 | Ga0466707_323585 | Ga0466707_323585_2189_2512 | 107 |
| 42 | 3300042602 | Ga0466713_154426 | Ga0466713_154426_593_916 | 107 |
| 43 | 3300042603 | Ga0466714_111665 | Ga0466714_111665_2428_2751 | 107 |
| 44 | 3300042606 | Ga0466719_215571 | Ga0466719_215571_7152_7475 | 107 |
| 45 | 3300042606 | Ga0466719_262735 | Ga0466719_262735_377_700 | 107 |
| 46 | 3300042609 | Ga0466722_154214 | Ga0466722_154214_178_501 | 107 |
| 47 | 3300042609 | Ga0466722_258541 | Ga0466722_258541_3099_3422 | 107 |
| 48 | 3300042611 | Ga0466697_047995 | Ga0466697_047995_318_641 | 107 |
| 49 | 3300042612 | Ga0466705_239841 | Ga0466705_239841_3490_3813 | 107 |
| 50 | 3300042615 | Ga0466711_265088 | Ga0466711_265088_800_1123 | 107 |
| 51 | 3300042615 | Ga0466711_330164 | Ga0466711_330164_653_976 | 107 |
| 52 | 3300042615 | Ga0466711_342009 | Ga0466711_342009_983_1306 | 107 |
| 53 | 3300042616 | Ga0466715_528982 | Ga0466715_528982_363_686 | 107 |
| 54 | 3300042618 | Ga0466723_080105 | Ga0466723_080105_937_1260 | 107 |
| 55 | 3300042618 | Ga0466723_324695 | Ga0466723_324695_1764_2087 | 107 |
| 56 | 3300042619 | Ga0466726_244579 | Ga0466726_244579_2153_2476 | 107 |
| 57 | 3300042623 | Ga0466734_083710 | Ga0466734_083710_693_1016 | 107 |
| 58 | 3300042636 | Ga0466703_143150 | Ga0466703_143150_15648_15971 | 107 |
| 59 | 3300042636 | Ga0466703_191892 | Ga0466703_191892_619_942 | 107 |
| 60 | 3300042648 | Ga0466709_129848 | Ga0466709_129848_431_754 | 107 |
| 61 | 3300042652 | Ga0466708_149359 | Ga0466708_149359_12_335 | 107 |
| 62 | 3300042652 | Ga0466708_155311 | Ga0466708_155311_727_1050 | 107 |
| 63 | 3300042655 | Ga0466727_216658 | Ga0466727_216658_7692_8015 | 107 |
| 64 | 3300042655 | Ga0466727_347878 | Ga0466727_347878_1856_2179 | 107 |
| 65 | iso_pr_bacteria | 2820772500 | 2820773064 | 107 |
| 66 | iso_pr_bacteria | 8100166142 | 8100167555 | 107 |
| 67 | 3300002509 | JGI24699J35502_10505367 | JGI24699J35502_105053672 | 108 |
| 68 | 3300010167 | Ga0123353_10006477 | Ga0123353_1000647711 | 108 |
| 69 | 3300010167 | Ga0123353_10271201 | Ga0123353_102712014 | 108 |
| 70 | 3300010882 | Ga0123354_10000080 | Ga0123354_1000008014 | 108 |
| 71 | 3300010882 | Ga0123354_10167126 | Ga0123354_101671262 | 108 |
| 72 | 3300010882 | Ga0123354_10207255 | Ga0123354_102072552 | 108 |
| 73 | 3300042596 | Ga0466696_265539 | Ga0466696_265539_2129_2455 | 108 |
| 74 | 3300042601 | Ga0466707_080292 | Ga0466707_080292_6991_7317 | 108 |
| 75 | 3300042601 | Ga0466707_304139 | Ga0466707_304139_542_868 | 108 |
| 76 | 3300042609 | Ga0466722_007759 | Ga0466722_007759_383_709 | 108 |
| 77 | 3300042612 | Ga0466705_161380 | Ga0466705_161380_7878_8204 | 108 |
| 78 | 3300042612 | Ga0466705_345017 | Ga0466705_345017_1263_1589 | 108 |
| 79 | 3300042616 | Ga0466715_171837 | Ga0466715_171837_12584_12910 | 108 |
| 80 | 3300042616 | Ga0466715_211362 | Ga0466715_211362_4469_4795 | 108 |
| 81 | 3300042619 | Ga0466726_158276 | Ga0466726_158276_1900_2226 | 108 |
| 82 | 3300042620 | Ga0466728_240460 | Ga0466728_240460_8175_8501 | 108 |
| 83 | 3300042622 | Ga0466731_217166 | Ga0466731_217166_435_761 | 108 |
| 84 | 3300042624 | Ga0466735_058731 | Ga0466735_058731_439_765 | 108 |
| 85 | 3300042643 | Ga0466704_086312 | Ga0466704_086312_7448_7774 | 108 |
| 86 | 3300042643 | Ga0466704_204470 | Ga0466704_204470_474_800 | 108 |
| 87 | 3300042643 | Ga0466704_378831 | Ga0466704_378831_5199_5525 | 108 |
| 88 | 3300042648 | Ga0466709_239935 | Ga0466709_239935_2583_2909 | 108 |
| 89 | iso_pr_bacteria | 2940244548 | 2940248478 | 108 |
| 90 | iso_pr_bacteria | 2940248789 | 2940252660 | 108 |
| 91 | iso_pr_bacteria | 2940253009 | 2940256925 | 108 |
| 92 | iso_pr_bacteria | 2940257232 | 2940261072 | 108 |
| 93 | 3300002462 | JGI24702J35022_10096872 | JGI24702J35022_100968722 | 109 |
| 94 | 3300042598 | Ga0466701_030297 | Ga0466701_030297_611_940 | 109 |
| 95 | 3300042615 | Ga0466711_132699 | Ga0466711_132699_13034_13363 | 109 |
| 96 | 3300042615 | Ga0466711_137169 | Ga0466711_137169_2124_2453 | 109 |
| 97 | 3300042615 | Ga0466711_156097 | Ga0466711_156097_7127_7456 | 109 |
| 98 | 3300042615 | Ga0466711_229688 | Ga0466711_229688_1707_2036 | 109 |
| 99 | 3300042615 | Ga0466711_324027 | Ga0466711_324027_3891_4220 | 109 |
| 100 | iso_pr_bacteria | 2910926975 | 2910930277 | 109 |
| 101 | iso_pr_bacteria | 2910949487 | 2910950231 | 109 |
| 102 | 2225789003 | 2227078021 | 2227444747 | 110 |
| 103 | 3300010167 | Ga0123353_10222977 | Ga0123353_102229772 | 110 |
| 104 | 3300042596 | Ga0466696_355066 | Ga0466696_355066_869_1201 | 110 |
| 105 | 3300042598 | Ga0466701_037367 | Ga0466701_037367_114_446 | 110 |
| 106 | 3300042600 | Ga0466700_006414 | Ga0466700_006414_1865_2197 | 110 |
| 107 | 3300042609 | Ga0466722_013623 | Ga0466722_013623_575_907 | 110 |
| 108 | 3300042616 | Ga0466715_368853 | Ga0466715_368853_597_929 | 110 |
| 109 | 3300042620 | Ga0466728_022464 | Ga0466728_022464_7313_7645 | 110 |
| 110 | iso_pr_bacteria | 2910942425 | 2910946304 | 110 |
| 111 | iso_pr_bacteria | 2910949487 | 2910951893 | 110 |
| 112 | 3300042598 | Ga0466701_007453 | Ga0466701_007453_965_1300 | 111 |
| 113 | 3300042600 | Ga0466700_085941 | Ga0466700_085941_324_659 | 111 |
| 114 | 3300042600 | Ga0466700_158009 | Ga0466700_158009_912_1247 | 111 |
| 115 | 3300042612 | Ga0466705_166262 | Ga0466705_166262_13179_13514 | 111 |
| 116 | 3300042620 | Ga0466728_103428 | Ga0466728_103428_1937_2272 | 111 |
| 117 | 3300042623 | Ga0466734_075814 | Ga0466734_075814_782_1117 | 111 |
| 118 | 3300056842 | Ga0562377_0004 | Ga0562377_0004_923018_923353 | 111 |
| 119 | 3300042600 | Ga0466700_020811 | Ga0466700_020811_2414_2752 | 112 |
| 120 | 3300042654 | Ga0466725_309654 | Ga0466725_309654_10002_10340 | 112 |
| 121 | 3300042659 | Ga0466733_006897 | Ga0466733_006897_161_499 | 112 |
| 122 | 3300042596 | Ga0466696_321315 | Ga0466696_321315_1124_1465 | 113 |
| 123 | 3300042605 | Ga0466716_272898 | Ga0466716_272898_326_667 | 113 |
| 124 | 3300042612 | Ga0466705_110688 | Ga0466705_110688_1566_1907 | 113 |
| 125 | 3300042624 | Ga0466735_146182 | Ga0466735_146182_321_662 | 113 |
| 126 | iso_pr_bacteria | 8100166142 | 8100166169 | 113 |
| 127 | iso_pr_bacteria | 8100166142 | 8100170676 | 113 |
| 128 | iso_pr_bacteria | 8100166142 | 8100170710 | 113 |
| 129 | 3300009784 | Ga0123357_10177545 | Ga0123357_101775456 | 114 |
| 130 | 3300042616 | Ga0466715_176119 | Ga0466715_176119_3062_3406 | 114 |
| 131 | 3300042606 | Ga0466719_326134 | Ga0466719_326134_444_791 | 115 |
| 132 | iso_pr_bacteria | 2820797595 | 2820799665 | 118 |
| 133 | 3300042582 | Ga0466657_369341 | Ga0466657_369341_7343_7705 | 120 |
| 134 | 3300042648 | Ga0466709_377300 | Ga0466709_377300_1820_2185 | 121 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13571 | DUF4133 | Domain of unknown function (DUF4133) | 5 | 95 | 0.99 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.4 | 0.67 | Medium |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.