Protein Family IF09673

Metagenome Isolate
149 Members
62 Samples
135 Scaffolds
535.3 Avg Length

🧬 Representative Sequence

ID
3300042648|Ga0466709_372748|Ga0466709_372748_18219_19940
Length
573 aa
Sequence
LKNSTGNGKQTAGKLRLSGFISEWIPIRKGTVVLMQLTLKEVQEHPSAFAQAGYQLPAFDYETVRRQTLAAPAWIHFGAGNIFRAFQANAVQKLLNSGAYGTGLIAAEGYDYEIIEKMYLPHDNLSILVTLKPDRSMEKTIVGSVLEALILDREQEAHFRRLNEIFSSPSLQMSSFTITEKGYALTDSEGKLLPGIELDFANGPEKASGYLGKVVSLLYGRYRSGRLPIAMVSMDNCSRNGDKLAAAVTAFASAWCGAGLAESGFLAYVKDPGRVSFPWSMIDKITPRPDAAVEEMLAQSGIEGLEPVVTSKNTYIAPFVNAEECEYLVIEDQFPNGRPPLEQAGILFADRETVDKVEKMKVCTCLNPLHTALAVYGCLLGYTLISEEMKNPLLKKMAETIGYLEGLPVVVHPGIIDPQKFIDEVVSSRIPNPFLPDTPQRIATDTSQKLSIRFGETIKAYGKRGGNAAAESLTGIPLVFAGWLRYLMGTDDGGQTFPLSSDPLLDTVVPYVAGFELTEAPKDLSGLDPLLRNEKIFGVDLFQAGLAERVKEYFRELSAGKGAVARTLGKYFG

📊 Sample Types

Isolate 9.4%
Metagenome 90.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 41.7%
Unclassified 26.7%
Kalotermitidae 20.0%
Rhinotermitidae 5.0%
Passalidae 3.3%
Hydrophilidae 1.7%
Hodotermitidae 1.7%

🌳 Taxonomy

Archaea 0
Bacteria 146
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
2 2820303403 Unclassified Firmicutes Th196P1bin2 Isolate Unclassified
3 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
4 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
7 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
8 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
9 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
10 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
11 2820431532 Unclassified Firmicutes Lab288P3bin230 Isolate Unclassified
12 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
13 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
14 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
15 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
16 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
17 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
18 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
19 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
20 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
21 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
22 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
23 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
24 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
25 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
26 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
27 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
28 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
29 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
30 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
31 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
32 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
33 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
34 2873595552 Erysipelothrix sp. HDW6C Isolate Hydrophilidae
35 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
36 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
37 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
38 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
39 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
40 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
41 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
42 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
43 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
44 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
45 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
46 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
47 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
48 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
49 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
50 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
51 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
52 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
53 2820512088 Unclassified Firmicutes Lab288P1bin4 Isolate Unclassified
54 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
55 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
56 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
57 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
58 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
59 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
60 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
61 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
62 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 IMNBL1DRAFT_c0000628 3300000062 Bacteria 28179
2 JGI24698J34947_10024201 3300002449 Bacteria 3243
3 JGI24695J34938_10008871 3300002450 Bacteria 5681
4 JGI24695J34938_10027506 3300002450 Bacteria 2687
5 Ga0072941_1001761 3300005201 Bacteria 7572
6 Ga0466714_067816 3300042603 Bacteria 3574
7 Ga0466712_182815 3300042614 Bacteria 1965
8 Ga0466715_119856 3300042616 Bacteria 27149
9 Ga0466718_060053 3300042617 Bacteria 16600
10 Ga0123356_10059828 3300010049 Bacteria 3554
11 Ga0456237_0002667 3300041968 Unclassified 2879
12 Ga0466709_200717 3300042648 Bacteria 7959
13 Ga0466709_211856 3300042648 Bacteria 5829
14 Ga0466709_372748 3300042648 Bacteria 71914
15 Ga0466733_150790 3300042659 Bacteria 9283
16 IMNBL1DRAFT_c0002648 3300000062 Bacteria 12258
17 IMNBL1DRAFT_c0004339 3300000062 Bacteria 8570
18 JGI24695J34938_10007548 3300002450 Bacteria 6346
19 JGI24695J34938_10039984 3300002450 Bacteria 2115
20 Ga0466713_153396 3300042602 Bacteria 11222
21 Ga0466722_132800 3300042609 Bacteria 3833
22 Ga0466698_215730 3300042610 Bacteria 24389
23 Ga0466712_237745 3300042614 Bacteria 17404
24 Ga0466718_022159 3300042617 Bacteria 13693
25 Ga0466718_024057 3300042617 Bacteria 2832
26 Ga0466723_072843 3300042618 Bacteria 31540
27 Ga0123356_10001400 3300010049 Bacteria 26708
28 Ga0123356_10077119 3300010049 Bacteria 3142
29 Ga0264413_112665 3300024493 Bacteria 3630
30 Ga0456237_0000350 3300041968 Bacteria 6854
31 Ga0466690_070083 3300042590 Bacteria 1871
32 Ga0466699_283554 3300042597 Bacteria 2526
33 Ga0466731_052474 3300042622 Bacteria 1606
34 AustNasuHG_c1002532 3300000089 Bacteria 6607
35 JGI24698J34947_10007911 3300002449 Bacteria 5839
36 JGI24695J34938_10000004 3300002450 Bacteria 163071
37 Ga0466713_065312 3300042602 Bacteria 73523
38 Ga0466717_075596 3300042604 Bacteria 1899
39 Ga0466720_078286 3300042607 Bacteria 6031
40 Ga0466712_062986 3300042614 Bacteria 38341
41 Ga0466711_038740 3300042615 Bacteria 7401
42 Ga0466718_015773 3300042617 Bacteria 16307
43 Ga0123355_10202122 3300009826 Bacteria 2899
44 Ga0123356_10000010 3300010049 Bacteria 220063
45 Ga0123356_10007744 3300010049 Bacteria 10696
46 Ga0466690_201727 3300042590 Bacteria 7166
47 Ga0466696_018814 3300042596 Bacteria 10656
48 Ga0466732_080996 3300042656 Bacteria 15116
49 2227510469 2225789004 Bacteria 3573
50 IMNBL1DRAFT_c0002759 3300000062 Bacteria 11940
51 AustNasuHG_c1002769 3300000089 Bacteria 6325
52 JGI24698J34947_10002959 3300002449 Bacteria 9212
53 JGI24698J34947_10004418 3300002449 Bacteria 7653
54 JGI24695J34938_10000239 3300002450 Bacteria 52549
55 JGI24700J35501_10929850 3300002508 Bacteria 10387
56 Ga0068305_10043708 3300005083 Unclassified 12185
57 Ga0072941_1003982 3300005201 Unclassified 31079
58 Ga0466707_187727 3300042601 Bacteria 1672
59 Ga0466720_113854 3300042607 Bacteria 8150
60 Ga0466722_153642 3300042609 Bacteria 9464
61 Ga0466712_139946 3300042614 Bacteria 3727
62 Ga0466712_269434 3300042614 Bacteria 17480
63 Ga0466718_110803 3300042617 Bacteria 5442
64 Ga0123355_10219229 3300009826 Bacteria 2740
65 Ga0123356_10004159 3300010049 Bacteria 15019
66 Ga0123356_10104508 3300010049 Bacteria 2723
67 Ga0264413_119960 3300024493 Bacteria 11644
68 Ga0264413_124401 3300024493 Bacteria 15449
69 Ga0415639_018949 3300038395 Bacteria 37088
70 Ga0466690_321011 3300042590 Bacteria 2986
71 Ga0466699_128513 3300042597 Bacteria 3590
72 Ga0466708_027263 3300042652 Bacteria 15744
73 Ga0466705_163521 3300042612 Bacteria 8623
74 JGI24698J34947_10000492 3300002449 Bacteria 18562
75 Ga0466712_199919 3300042614 Bacteria 8418
76 Ga0466723_095828 3300042618 Bacteria 7612
77 Ga0466728_199764 3300042620 Bacteria 3639
78 Ga0123355_10184468 3300009826 Bacteria 3089
79 Ga0123356_10000651 3300010049 Bacteria 38307
80 Ga0123356_10028607 3300010049 Bacteria 5221
81 Ga0123353_10089800 3300010167 Bacteria 4948
82 Ga0123354_10130153 3300010882 Bacteria 3184
83 Ga0466691_097944 3300042593 Bacteria 5063
84 Ga0466694_009216 3300042594 Bacteria 16208
85 Ga0466696_413559 3300042596 Bacteria 27260
86 JGI24698J34947_10001105 3300002449 Bacteria 13901
87 JGI24698J34947_10001127 3300002449 Bacteria 13825
88 JGI24695J34938_10000008 3300002450 Bacteria 136681
89 JGI24695J34938_10001031 3300002450 Bacteria 25228
90 JGI24695J34938_10004551 3300002450 Bacteria 9040
91 JGI24695J34938_10007083 3300002450 Bacteria 6629
92 JGI24695J34938_10018505 3300002450 Bacteria 3477
93 JGI24695J34938_10026447 3300002450 Bacteria 2757
94 Ga0072940_1020119 3300005200 Bacteria 5802
95 Ga0466719_187902 3300042606 Bacteria 3793
96 Ga0466720_006450 3300042607 Bacteria 22815
97 Ga0466711_219369 3300042615 Bacteria 6144
98 Ga0466711_351895 3300042615 Bacteria 12352
99 Ga0123355_10004850 3300009826 Bacteria 19580
100 Ga0123356_10016633 3300010049 Bacteria 7016
101 Ga0123356_10026789 3300010049 Bacteria 5408
102 Ga0123356_10037289 3300010049 Bacteria 4536
103 Ga0123356_10048604 3300010049 Bacteria 3948
104 Ga0123356_10089582 3300010049 Bacteria 2927
105 Ga0123353_10048746 3300010167 Bacteria 6746
106 Ga0466693_135525 3300042592 Bacteria 26238
107 Ga0466732_098331 3300042656 Bacteria 3259
108 2227466306 2225789004 Bacteria 24511
109 AustNasuHG_c1000882 3300000089 Bacteria 10805
110 AustNasuHG_c1005673 3300000089 Bacteria 4466
111 JGI24698J34947_10001466 3300002449 Bacteria 12429
112 JGI24695J34938_10001536 3300002450 Bacteria 19468
113 Ga0072941_1015656 3300005201 Bacteria 6284
114 Ga0466706_206567 3300042599 Bacteria 30363
115 Ga0466722_061628 3300042609 Bacteria 14264
116 Ga0466712_013036 3300042614 Bacteria 41630
117 Ga0466712_069673 3300042614 Bacteria 20471
118 Ga0466723_352688 3300042618 Bacteria 8345
119 Ga0466728_417430 3300042620 Bacteria 9499
120 Ga0466729_094922 3300042621 Bacteria 21461
121 Ga0466695_091046 3300042595 Bacteria 29831
122 Ga0466699_268323 3300042597 Bacteria 30824
123 Ga0466733_073512 3300042659 Bacteria 4492
124 AustNasuHG_c1005107 3300000089 Bacteria 4692
125 JGI24698J34947_10011928 3300002449 Bacteria 4772
126 Ga0466713_071195 3300042602 Bacteria 4244
127 Ga0466712_027275 3300042614 Bacteria 35623
128 Ga0466718_025894 3300042617 Bacteria 2259
129 Ga0466723_071252 3300042618 Bacteria 58514
130 Ga0123356_10000612 3300010049 Bacteria 39404
131 Ga0415639_055595 3300038395 Bacteria 4115
132 Ga0466690_348676 3300042590 Bacteria 2783
133 Ga0466702_037390 3300042635 Bacteria 11627
134 Ga0466704_264505 3300042643 Bacteria 12373
135 Ga0466724_10183 3300042649 Bacteria 3265

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042609 Ga0466722_132800 Ga0466722_132800_950_2401 483
2 3300042590 Ga0466690_348676 Ga0466690_348676_77_1546 489
3 3300042622 Ga0466731_052474 Ga0466731_052474_112_1581 489
4 3300005201 Ga0072941_1015656 Ga0072941_10156566 493
5 3300042614 Ga0466712_182815 Ga0466712_182815_365_1909 514
6 3300042618 Ga0466723_072843 Ga0466723_072843_8630_10228 518
7 3300010049 Ga0123356_10000010 Ga0123356_1000001012 519
8 3300005083 Ga0068305_10043708 Ga0068305_100437083 520
9 iso_pr_bacteria 2820303403 2820304791 521
10 3300002508 JGI24700J35501_10929850 JGI24700J35501_109298503 522
11 2225789004 2227510469 2228004016 527
12 2225789004 2227466306 2227905730 528
13 3300000062 IMNBL1DRAFT_c0000628 IMNBL1DRAFT_000062820 528
14 iso_pr_bacteria 2820512088 2820512528 528
15 3300000062 IMNBL1DRAFT_c0004339 IMNBL1DRAFT_00043395 529
16 3300010049 Ga0123356_10048604 Ga0123356_100486042 529
17 3300010049 Ga0123356_10089582 Ga0123356_100895822 529
18 3300000062 IMNBL1DRAFT_c0002759 IMNBL1DRAFT_00027595 530
19 3300002449 JGI24698J34947_10007911 JGI24698J34947_100079115 531
20 3300002450 JGI24695J34938_10000008 JGI24695J34938_10000008132 531
21 3300010049 Ga0123356_10028607 Ga0123356_100286073 531
22 3300010049 Ga0123356_10037289 Ga0123356_100372893 531
23 3300042597 Ga0466699_283554 Ga0466699_283554_768_2363 531
24 3300042603 Ga0466714_067816 Ga0466714_067816_1628_3223 531
25 iso_pr_bacteria 2781125650 2781308843 531
26 3300002450 JGI24695J34938_10001031 JGI24695J34938_100010316 532
27 3300002450 JGI24695J34938_10018505 JGI24695J34938_100185053 532
28 3300042590 Ga0466690_070083 Ga0466690_070083_218_1816 532
29 3300042592 Ga0466693_135525 Ga0466693_135525_8521_10119 532
30 3300042593 Ga0466691_097944 Ga0466691_097944_748_2346 532
31 3300042606 Ga0466719_187902 Ga0466719_187902_1292_2890 532
32 3300042610 Ga0466698_215730 Ga0466698_215730_15436_17034 532
33 3300042617 Ga0466718_015773 Ga0466718_015773_10622_12220 532
34 3300042617 Ga0466718_022159 Ga0466718_022159_11606_13204 532
35 3300042617 Ga0466718_025894 Ga0466718_025894_559_2157 532
36 3300042617 Ga0466718_110803 Ga0466718_110803_3492_5090 532
37 3300042635 Ga0466702_037390 Ga0466702_037390_7022_8620 532
38 3300042643 Ga0466704_264505 Ga0466704_264505_10096_11694 532
39 3300042656 Ga0466732_098331 Ga0466732_098331_1493_3091 532
40 iso_pr_bacteria 2781125662 2781336681 532
41 3300000089 AustNasuHG_c1005107 AustNasuHG_10051073 533
42 3300010049 Ga0123356_10000651 Ga0123356_1000065118 533
43 3300010049 Ga0123356_10026789 Ga0123356_100267892 533
44 3300010049 Ga0123356_10077119 Ga0123356_100771192 533
45 3300024493 Ga0264413_119960 Ga0264413_1199607 533
46 3300024493 Ga0264413_124401 Ga0264413_12440119 533
47 3300042597 Ga0466699_128513 Ga0466699_128513_601_2202 533
48 3300042614 Ga0466712_269434 Ga0466712_269434_12808_14409 533
49 iso_pr_bacteria 2781125647 2781302766 533
50 3300002449 JGI24698J34947_10004418 JGI24698J34947_100044183 534
51 3300002450 JGI24695J34938_10000239 JGI24695J34938_1000023942 534
52 3300010167 Ga0123353_10089800 Ga0123353_100898004 534
53 3300024493 Ga0264413_112665 Ga0264413_1126653 534
54 3300041968 Ga0456237_0002667 Ga0456237_0002667_854_2458 534
55 3300042590 Ga0466690_321011 Ga0466690_321011_618_2222 534
56 3300042601 Ga0466707_187727 Ga0466707_187727_32_1636 534
57 3300042607 Ga0466720_113854 Ga0466720_113854_2263_3867 534
58 3300042618 Ga0466723_352688 Ga0466723_352688_6406_8010 534
59 3300042620 Ga0466728_199764 Ga0466728_199764_844_2448 534
60 3300042648 Ga0466709_211856 Ga0466709_211856_4161_5765 534
61 3300042652 Ga0466708_027263 Ga0466708_027263_11985_13589 534
62 3300042656 Ga0466732_080996 Ga0466732_080996_5009_6613 534
63 3300042659 Ga0466733_073512 Ga0466733_073512_1193_2797 534
64 iso_pr_bacteria 2781125656 2781322038 534
65 3300000062 IMNBL1DRAFT_c0002648 IMNBL1DRAFT_00026487 535
66 3300009826 Ga0123355_10184468 Ga0123355_101844683 535
67 3300042590 Ga0466690_201727 Ga0466690_201727_1799_3406 535
68 3300042596 Ga0466696_018814 Ga0466696_018814_4422_6029 535
69 3300042604 Ga0466717_075596 Ga0466717_075596_24_1631 535
70 3300042614 Ga0466712_027275 Ga0466712_027275_26858_28465 535
71 3300042620 Ga0466728_417430 Ga0466728_417430_243_1850 535
72 3300002450 JGI24695J34938_10001536 JGI24695J34938_1000153614 536
73 3300002450 JGI24695J34938_10004551 JGI24695J34938_1000455111 536
74 3300010049 Ga0123356_10016633 Ga0123356_100166331 536
75 3300010882 Ga0123354_10130153 Ga0123354_101301532 536
76 3300042594 Ga0466694_009216 Ga0466694_009216_1044_2654 536
77 3300042602 Ga0466713_065312 Ga0466713_065312_41131_42741 536
78 3300042602 Ga0466713_071195 Ga0466713_071195_891_2501 536
79 3300042609 Ga0466722_153642 Ga0466722_153642_6150_7760 536
80 3300042618 Ga0466723_095828 Ga0466723_095828_5657_7267 536
81 3300042659 Ga0466733_150790 Ga0466733_150790_4825_6435 536
82 3300002449 JGI24698J34947_10002959 JGI24698J34947_1000295910 537
83 3300002450 JGI24695J34938_10007548 JGI24695J34938_100075483 537
84 3300002450 JGI24695J34938_10026447 JGI24695J34938_100264472 537
85 3300038395 Ga0415639_055595 Ga0415639_055595_1990_3603 537
86 3300042596 Ga0466696_413559 Ga0466696_413559_18421_20034 537
87 3300042614 Ga0466712_013036 Ga0466712_013036_16022_17635 537
88 3300042614 Ga0466712_062986 Ga0466712_062986_18565_20178 537
89 3300042614 Ga0466712_069673 Ga0466712_069673_17934_19547 537
90 3300042614 Ga0466712_139946 Ga0466712_139946_1761_3374 537
91 3300042616 Ga0466715_119856 Ga0466715_119856_14635_16248 537
92 iso_pr_bacteria 2781125644 2781294773 537
93 3300002449 JGI24698J34947_10000492 JGI24698J34947_100004928 538
94 3300002449 JGI24698J34947_10001127 JGI24698J34947_1000112713 538
95 3300002449 JGI24698J34947_10001466 JGI24698J34947_1000146613 538
96 3300002450 JGI24695J34938_10000004 JGI24695J34938_100000042 538
97 3300002450 JGI24695J34938_10008871 JGI24695J34938_100088711 538
98 3300002450 JGI24695J34938_10027506 JGI24695J34938_100275063 538
99 3300042595 Ga0466695_091046 Ga0466695_091046_9778_11394 538
100 3300042609 Ga0466722_061628 Ga0466722_061628_4498_6114 538
101 3300042614 Ga0466712_237745 Ga0466712_237745_5469_7085 538
102 3300042615 Ga0466711_038740 Ga0466711_038740_5626_7242 538
103 3300042615 Ga0466711_219369 Ga0466711_219369_3593_5209 538
104 3300042648 Ga0466709_200717 Ga0466709_200717_5146_6762 538
105 iso_pr_bacteria 2781125693 2781433854 538
106 iso_pr_bacteria 2820431532 2820431946 538
107 iso_pr_bacteria 2873595552 2873596145 538
108 3300002450 JGI24695J34938_10039984 JGI24695J34938_100399841 539
109 3300005201 Ga0072941_1001761 Ga0072941_10017615 539
110 3300009826 Ga0123355_10004850 Ga0123355_1000485012 539
111 3300009826 Ga0123355_10202122 Ga0123355_102021222 539
112 3300010167 Ga0123353_10048746 Ga0123353_100487463 539
113 3300042649 Ga0466724_10183 Ga0466724_10183_1095_2714 539
114 3300000089 AustNasuHG_c1000882 AustNasuHG_10008826 540
115 3300038395 Ga0415639_018949 Ga0415639_018949_23273_24895 540
116 3300042599 Ga0466706_206567 Ga0466706_206567_568_2190 540
117 3300042621 Ga0466729_094922 Ga0466729_094922_18275_19897 540
118 3300000089 AustNasuHG_c1002769 AustNasuHG_10027693 541
119 3300010049 Ga0123356_10059828 Ga0123356_100598282 541
120 3300010049 Ga0123356_10104508 Ga0123356_101045082 541
121 3300005200 Ga0072940_1020119 Ga0072940_10201192 542
122 3300009826 Ga0123355_10219229 Ga0123355_102192291 542
123 3300002449 JGI24698J34947_10001105 JGI24698J34947_100011058 543
124 3300002449 JGI24698J34947_10011928 JGI24698J34947_100119285 543
125 3300042607 Ga0466720_078286 Ga0466720_078286_1051_2682 543
126 3300042614 Ga0466712_199919 Ga0466712_199919_5019_6650 543
127 iso_pr_bacteria 2781125659 2781327138 543
128 3300010049 Ga0123356_10000612 Ga0123356_1000061212 544
129 3300010049 Ga0123356_10001400 Ga0123356_100014009 544
130 3300010049 Ga0123356_10004159 Ga0123356_100041597 544
131 3300041968 Ga0456237_0000350 Ga0456237_0000350_2541_4175 544
132 3300042607 Ga0466720_006450 Ga0466720_006450_2862_4496 544
133 3300042617 Ga0466718_060053 Ga0466718_060053_7175_8809 544
134 iso_pr_bacteria 2781125663 2781338408 544
135 3300000089 AustNasuHG_c1005673 AustNasuHG_10056733 545
136 3300002450 JGI24695J34938_10007083 JGI24695J34938_100070836 545
137 3300005201 Ga0072941_1003982 Ga0072941_100398223 545
138 3300010049 Ga0123356_10007744 Ga0123356_100077446 545
139 3300042618 Ga0466723_071252 Ga0466723_071252_47431_49068 545
140 iso_pr_bacteria 2820020240 2820020895 545
141 3300042612 Ga0466705_163521 Ga0466705_163521_6229_7869 546
142 3300002449 JGI24698J34947_10024201 JGI24698J34947_100242013 550
143 3300042597 Ga0466699_268323 Ga0466699_268323_3668_5362 550
144 3300042615 Ga0466711_351895 Ga0466711_351895_2560_4212 550
145 3300042617 Ga0466718_024057 Ga0466718_024057_480_2132 550
146 3300000089 AustNasuHG_c1002532 AustNasuHG_10025327 554
147 iso_pr_bacteria 2781125634 2781274063 555
148 3300042602 Ga0466713_153396 Ga0466713_153396_2859_4529 556
149 3300042648 Ga0466709_372748 Ga0466709_372748_18219_19940 573

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF08125 Mannitol_dh_C Mannitol dehydrogenase C-terminal domain 354 555 0.85
PF01232 Mannitol_dh Mannitol dehydrogenase Rossmann domain 75 342 0.84

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF08125 GO:0016491 oxidoreductase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.