Protein Family IF09668

Metagenome Isolate
195 Members
59 Samples
190 Scaffolds
297.31 Avg Length

🧬 Representative Sequence

ID
3300042648|Ga0466709_346172|Ga0466709_346172_9337_10359
Length
340 aa
Sequence
MVLYTVDAGAQPAVVFLPHHHRHHAFRAGMTLFIQYATMLRSTIKPLFYLPIWFFRAKWFGAQRPLQTVLFVSDKCNLTCKHCSIYELRHPHVKTEDQIREELEYSYRLGSRFVDFEGGEPTLWRDGDRDLNSLIRLAKKIGFYSATLTTNAQNPFTGSQADSIWVSLDGLGDYHDRIRGKGAFDRLVKNIATANHPHLSVNMVINAQNDPSVEETIEFAKSNPHIESISLNFHSPYQGTESLFLDWERRARIIDLIIEKKKAGYPVMNSVSGLRLMKHNRFKKQCWVTNFIMPDGTRLTECQGKTAGLCDRCGLSMAGEMHSVFSLKLDTVFAGLKLRM

📊 Sample Types

Isolate 2.6%
Metagenome 97.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 43.9%
Kalotermitidae 24.6%
Unclassified 12.3%
Termopsidae 7.0%
Rhinotermitidae 5.3%
Passalidae 3.5%
Hodotermitidae 1.8%
Blattidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 178
Eukaryota 0
Viruses 0
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
2 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
3 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
4 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
5 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
8 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
9 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
10 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
11 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
12 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
13 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
14 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
15 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
16 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
17 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
18 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
19 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
20 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
21 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
22 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
23 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
24 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
25 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
26 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
27 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
28 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
29 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
30 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
31 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
32 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
33 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
34 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
35 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
36 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
37 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
38 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
39 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
40 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
41 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
42 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
43 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
44 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
45 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
46 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
47 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
48 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
49 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
50 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
51 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
52 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
53 2820765201 Unclassified Bacteroidetes Lab288P3bin82 Isolate Unclassified
54 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
55 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
56 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
57 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
58 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
59 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466734_009710 3300042623 Bacteria 1583
2 Ga0466735_045498 3300042624 Bacteria 3744
3 Ga0466735_050026 3300042624 Unclassified 1670
4 Ga0466735_058173 3300042624 Bacteria 27904
5 Ga0466703_073948 3300042636 Bacteria 5212
6 Ga0466727_083717 3300042655 Bacteria 8189
7 Ga0466727_167278 3300042655 Bacteria 64897
8 Ga0466727_225284 3300042655 Bacteria 1258
9 Ga0466706_140986 3300042599 Bacteria 6831
10 Ga0466707_399872 3300042601 Bacteria 25092
11 Ga0466713_076790 3300042602 Bacteria 9968
12 Ga0466716_077005 3300042605 Bacteria 4285
13 Ga0466719_097940 3300042606 Bacteria 5952
14 Ga0466719_390036 3300042606 Bacteria 1344
15 Ga0466721_016798 3300042608 Bacteria 2193
16 Ga0466715_340747 3300042616 Bacteria 15029
17 Ga0466715_608206 3300042616 Bacteria 31747
18 Ga0466723_335450 3300042618 Bacteria 9017
19 Ga0264413_148675 3300024493 Bacteria 4009
20 Ga0466690_021309 3300042590 Bacteria 12778
21 Ga0466695_077786 3300042595 Bacteria 1103
22 IMNBL1DRAFT_c0000159 3300000062 Bacteria 59691
23 Ga0072941_1039885 3300005201 Bacteria 9460
24 Ga0466705_309528 3300042612 Bacteria 54836
25 Ga0466732_187528 3300042656 Bacteria 3737
26 Ga0466703_041467 3300042636 Bacteria 4955
27 Ga0466703_280441 3300042636 Bacteria 1270
28 Ga0466703_387280 3300042636 Bacteria 1199
29 Ga0466704_016556 3300042643 Bacteria 24571
30 Ga0466709_374153 3300042648 Bacteria 7444
31 Ga0466727_005771 3300042655 Bacteria 3104
32 Ga0466727_058007 3300042655 Bacteria 10793
33 Ga0466706_115523 3300042599 Bacteria 21375
34 Ga0466713_102487 3300042602 Bacteria 5153
35 Ga0466714_169350 3300042603 Bacteria 2123
36 Ga0466719_015962 3300042606 Bacteria 4192
37 Ga0466715_113262 3300042616 Bacteria 14729
38 Ga0466715_253223 3300042616 Bacteria 10623
39 Ga0466726_021927 3300042619 Bacteria 10677
40 Ga0466726_421046 3300042619 Bacteria 15138
41 Ga0466728_164254 3300042620 Bacteria 12853
42 Ga0466728_232064 3300042620 Unclassified 3141
43 Ga0466690_276223 3300042590 Bacteria 213056
44 Ga0466691_010908 3300042593 Bacteria 139266
45 JGI24702J35022_10007885 3300002462 Bacteria 6062
46 JGI24699J35502_11134139 3300002509 Bacteria 36268
47 JGI24696J40584_12958356 3300002834 Bacteria 4072
48 Ga0466733_018008 3300042659 Bacteria 16779
49 Ga0466735_193071 3300042624 Unclassified 2753
50 Ga0466703_338570 3300042636 Bacteria 1361
51 Ga0466703_358940 3300042636 Bacteria 5652
52 Ga0466704_481091 3300042643 Bacteria 6992
53 Ga0466724_60099 3300042649 Bacteria 1952
54 Ga0466706_136069 3300042599 Bacteria 6593
55 Ga0466714_101534 3300042603 Bacteria 3667
56 Ga0466719_480872 3300042606 Bacteria 1842
57 Ga0123357_10011170 3300009784 Bacteria 11489
58 Ga0123353_10036193 3300010167 Unclassified 7731
59 Ga0123353_10156380 3300010167 Unclassified 3633
60 Ga0466710_227339 3300042613 Bacteria 4634
61 Ga0466711_261641 3300042615 Bacteria 27442
62 Ga0466715_596969 3300042616 Bacteria 24562
63 Ga0466723_002535 3300042618 Bacteria 12675
64 Ga0466723_261527 3300042618 Bacteria 3378
65 Ga0466726_313238 3300042619 Bacteria 7127
66 Ga0466690_384415 3300042590 Bacteria 23452
67 Ga0466696_357819 3300042596 Bacteria 1838
68 IMNBL1DRAFT_c0011719 3300000062 Bacteria 4074
69 JGI24702J35022_10098110 3300002462 Bacteria 1601
70 JGI24705J35276_12215245 3300002504 Bacteria 1995
71 Ga0466705_285826 3300042612 Bacteria 1611
72 Ga0466735_066922 3300042624 Bacteria 3800
73 Ga0466735_090469 3300042624 Bacteria 8619
74 Ga0466735_137983 3300042624 Bacteria 2995
75 Ga0466704_131738 3300042643 Bacteria 2399
76 Ga0466709_164981 3300042648 Bacteria 4786
77 Ga0466708_078638 3300042652 Bacteria 7362
78 Ga0466701_099440 3300042598 Bacteria 19482
79 Ga0466707_101212 3300042601 Bacteria 3512
80 Ga0466713_041894 3300042602 Bacteria 97930
81 Ga0466713_078122 3300042602 Unclassified 7587
82 Ga0466716_011158 3300042605 Bacteria 4328
83 Ga0466719_515711 3300042606 Bacteria 2783
84 Ga0466722_059100 3300042609 Bacteria 1933
85 Ga0466697_022554 3300042611 Bacteria 1053
86 Ga0123353_10163662 3300010167 Bacteria 3539
87 Ga0123354_10244360 3300010882 Bacteria 1837
88 Ga0466711_306020 3300042615 Bacteria 14460
89 Ga0466715_228336 3300042616 Bacteria 11049
90 Ga0466723_025239 3300042618 Bacteria 67003
91 Ga0466726_080715 3300042619 Bacteria 14865
92 Ga0466690_050217 3300042590 Bacteria 8633
93 Ga0466691_094072 3300042593 Bacteria 8732
94 Ga0466696_086569 3300042596 Bacteria 5963
95 JGI24702J35022_10064248 3300002462 Unclassified 1968
96 Ga0068305_10009920 3300005083 Bacteria 16501
97 Ga0068305_10176955 3300005083 Bacteria 3171
98 Ga0072940_1049695 3300005200 Bacteria 3723
99 Ga0466729_225783 3300042621 Bacteria 8940
100 Ga0466735_038409 3300042624 Bacteria 3845
101 Ga0466702_009067 3300042635 Bacteria 4172
102 Ga0466703_002530 3300042636 Bacteria 34046
103 Ga0466704_308810 3300042643 Bacteria 2837
104 Ga0466704_316954 3300042643 Bacteria 2218
105 Ga0466724_56530 3300042649 Bacteria 7278
106 Ga0466727_155859 3300042655 Unclassified 2499
107 Ga0466707_119545 3300042601 Bacteria 13850
108 Ga0466728_115651 3300042620 Bacteria 3234
109 Ga0466728_464354 3300042620 Bacteria 2083
110 Ga0466690_003078 3300042590 Bacteria 25930
111 Ga0466690_168758 3300042590 Bacteria 1698
112 Ga0466694_049088 3300042594 Bacteria 2821
113 Ga0466696_429416 3300042596 Bacteria 3696
114 IMNBL1DRAFT_c0000077 3300000062 Bacteria 88150
115 JGI24702J35022_10119742 3300002462 Bacteria 1454
116 JGI24705J35276_12227486 3300002504 Bacteria 3012
117 Ga0466705_095318 3300042612 Bacteria 4657
118 Ga0466705_260368 3300042612 Bacteria 1268
119 Ga0466735_037337 3300042624 Bacteria 1596
120 Ga0466704_109164 3300042643 Bacteria 2418
121 Ga0466708_060683 3300042652 Bacteria 49198
122 Ga0466706_050887 3300042599 Bacteria 1545
123 Ga0466707_216551 3300042601 Bacteria 9453
124 Ga0466713_099930 3300042602 Bacteria 46952
125 Ga0466716_259355 3300042605 Bacteria 1573
126 Ga0466719_262963 3300042606 Bacteria 11116
127 Ga0123357_10393362 3300009784 Bacteria 1271
128 Ga0123353_10036352 3300010167 Bacteria 7713
129 Ga0123353_10440790 3300010167 Bacteria 1922
130 Ga0466715_246897 3300042616 Bacteria 37494
131 Ga0466715_517916 3300042616 Bacteria 6354
132 Ga0466726_460521 3300042619 Unclassified 5184
133 Ga0466692_094463 3300042591 Bacteria 8847
134 Ga0466693_114125 3300042592 Bacteria 3274
135 Ga0466699_433613 3300042597 Unclassified 1066
136 Ga0466705_155248 3300042612 Bacteria 33316
137 Ga0466732_074198 3300042656 Bacteria 1360
138 Ga0466733_195509 3300042659 Bacteria 83582
139 Ga0466704_078285 3300042643 Bacteria 2578
140 Ga0466724_38105 3300042649 Bacteria 4109
141 Ga0466701_088981 3300042598 Bacteria 16164
142 Ga0466706_136207 3300042599 Bacteria 30385
143 Ga0466707_223703 3300042601 Unclassified 4238
144 Ga0466707_329152 3300042601 Bacteria 7751
145 Ga0466716_161364 3300042605 Bacteria 12990
146 Ga0466719_051482 3300042606 Bacteria 11957
147 Ga0466719_077631 3300042606 Bacteria 4475
148 Ga0466722_036245 3300042609 Bacteria 21778
149 Ga0466722_249425 3300042609 Bacteria 3468
150 Ga0123353_10509389 3300010167 Bacteria 1750
151 Ga0466715_095522 3300042616 Bacteria 3852
152 Ga0466690_240196 3300042590 Bacteria 3677
153 Ga0466693_334041 3300042592 Bacteria 1024
154 Ga0466691_219407 3300042593 Unclassified 17502
155 Ga0466699_204804 3300042597 Bacteria 3434
156 2227255803 2225789004 Bacteria 7054
157 JGI24702J35022_10022287 3300002462 Unclassified 3430
158 JGI24702J35022_10088097 3300002462 Bacteria 1687
159 JGI24705J35276_12238403 3300002504 Bacteria 21135
160 JGI24696J40584_12956844 3300002834 Bacteria 3258
161 Ga0466733_211188 3300042659 Bacteria 10118
162 Ga0466731_048037 3300042622 Unclassified 1101
163 Ga0466735_042744 3300042624 Unclassified 3007
164 Ga0466735_227610 3300042624 Unclassified 2267
165 Ga0466730_100610 3300042625 Bacteria 1355
166 Ga0466704_029658 3300042643 Bacteria 5819
167 Ga0466709_039419 3300042648 Bacteria 67557
168 Ga0466709_346172 3300042648 Bacteria 19067
169 Ga0466708_461800 3300042652 Bacteria 46167
170 Ga0466727_048423 3300042655 Bacteria 3976
171 Ga0466727_067586 3300042655 Bacteria 2070
172 Ga0466701_043606 3300042598 Bacteria 24638
173 Ga0466706_214588 3300042599 Bacteria 7276
174 Ga0466707_104581 3300042601 Bacteria 5436
175 Ga0466707_129591 3300042601 Bacteria 7913
176 Ga0466707_171919 3300042601 Bacteria 1340
177 Ga0466713_009402 3300042602 Bacteria 2777
178 Ga0466719_015462 3300042606 Bacteria 9666
179 Ga0466722_056344 3300042609 Bacteria 10160
180 Ga0123357_10084476 3300009784 Bacteria 4160
181 Ga0466715_023570 3300042616 Bacteria 9664
182 Ga0466690_127833 3300042590 Bacteria 8393
183 Ga0466691_020704 3300042593 Bacteria 3265
184 Ga0466694_108239 3300042594 Bacteria 3286
185 2227552970 2225789004 Bacteria 2825
186 JGI24698J34947_10034869 3300002449 Bacteria 2630
187 JGI24702J35022_10000341 3300002462 Bacteria 27641
188 JGI24702J35022_10041880 3300002462 Bacteria 2440
189 Ga0068302_10193390 3300005071 Unclassified 2310
190 Ga0068305_10755418 3300005083 Bacteria 1294

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042593 Ga0466691_094072 Ga0466691_094072_1447_2199 250
2 3300042620 Ga0466728_232064 Ga0466728_232064_203_955 250
3 3300042615 Ga0466711_306020 Ga0466711_306020_7228_7998 256
4 3300042649 Ga0466724_38105 Ga0466724_38105_789_1559 256
5 3300042601 Ga0466707_223703 Ga0466707_223703_15_842 275
6 3300042598 Ga0466701_088981 Ga0466701_088981_4967_5806 279
7 3300042611 Ga0466697_022554 Ga0466697_022554_194_1033 279
8 3300042652 Ga0466708_060683 Ga0466708_060683_27956_28801 281
9 3300042655 Ga0466727_067586 Ga0466727_067586_1207_2052 281
10 3300042609 Ga0466722_036245 Ga0466722_036245_11188_12078 285
11 3300042592 Ga0466693_334041 Ga0466693_334041_57_923 288
12 3300042590 Ga0466690_050217 Ga0466690_050217_4263_5147 294
13 3300042596 Ga0466696_429416 Ga0466696_429416_314_1201 295
14 3300042612 Ga0466705_260368 Ga0466705_260368_146_1033 295
15 3300042636 Ga0466703_358940 Ga0466703_358940_4607_5494 295
16 3300042643 Ga0466704_016556 Ga0466704_016556_15265_16152 295
17 iso_pr_bacteria 2820776227 2820777963 295
18 3300002504 JGI24705J35276_12215245 JGI24705J35276_122152452 296
19 3300002834 JGI24696J40584_12958356 JGI24696J40584_129583562 296
20 3300042596 Ga0466696_357819 Ga0466696_357819_666_1556 296
21 3300042605 Ga0466716_259355 Ga0466716_259355_621_1511 296
22 3300042613 Ga0466710_227339 Ga0466710_227339_806_1696 296
23 3300042616 Ga0466715_596969 Ga0466715_596969_2852_3742 296
24 3300042621 Ga0466729_225783 Ga0466729_225783_7824_8714 296
25 3300042649 Ga0466724_56530 Ga0466724_56530_3008_3898 296
26 2225789004 2227255803 2227700405 297
27 3300009784 Ga0123357_10084476 Ga0123357_100844765 297
28 3300042590 Ga0466690_003078 Ga0466690_003078_14475_15368 297
29 3300042590 Ga0466690_021309 Ga0466690_021309_3159_4052 297
30 3300042590 Ga0466690_168758 Ga0466690_168758_461_1354 297
31 3300042590 Ga0466690_240196 Ga0466690_240196_2421_3314 297
32 3300042590 Ga0466690_276223 Ga0466690_276223_194569_195462 297
33 3300042590 Ga0466690_384415 Ga0466690_384415_8732_9625 297
34 3300042593 Ga0466691_020704 Ga0466691_020704_1080_1973 297
35 3300042593 Ga0466691_219407 Ga0466691_219407_4660_5553 297
36 3300042594 Ga0466694_108239 Ga0466694_108239_166_1059 297
37 3300042595 Ga0466695_077786 Ga0466695_077786_184_1077 297
38 3300042597 Ga0466699_204804 Ga0466699_204804_100_993 297
39 3300042597 Ga0466699_433613 Ga0466699_433613_74_967 297
40 3300042598 Ga0466701_043606 Ga0466701_043606_4429_5322 297
41 3300042598 Ga0466701_099440 Ga0466701_099440_7020_7913 297
42 3300042599 Ga0466706_050887 Ga0466706_050887_40_933 297
43 3300042601 Ga0466707_101212 Ga0466707_101212_2393_3286 297
44 3300042601 Ga0466707_104581 Ga0466707_104581_539_1432 297
45 3300042601 Ga0466707_119545 Ga0466707_119545_3595_4488 297
46 3300042601 Ga0466707_129591 Ga0466707_129591_4970_5863 297
47 3300042601 Ga0466707_399872 Ga0466707_399872_12955_13848 297
48 3300042602 Ga0466713_041894 Ga0466713_041894_95904_96797 297
49 3300042602 Ga0466713_102487 Ga0466713_102487_2225_3118 297
50 3300042605 Ga0466716_077005 Ga0466716_077005_2301_3194 297
51 3300042606 Ga0466719_015462 Ga0466719_015462_6199_7092 297
52 3300042606 Ga0466719_015962 Ga0466719_015962_429_1322 297
53 3300042606 Ga0466719_262963 Ga0466719_262963_8205_9098 297
54 3300042606 Ga0466719_480872 Ga0466719_480872_179_1072 297
55 3300042606 Ga0466719_515711 Ga0466719_515711_1284_2177 297
56 3300042608 Ga0466721_016798 Ga0466721_016798_1140_2033 297
57 3300042609 Ga0466722_056344 Ga0466722_056344_627_1520 297
58 3300042609 Ga0466722_059100 Ga0466722_059100_551_1444 297
59 3300042612 Ga0466705_095318 Ga0466705_095318_3033_3926 297
60 3300042612 Ga0466705_285826 Ga0466705_285826_516_1409 297
61 3300042615 Ga0466711_261641 Ga0466711_261641_24172_25065 297
62 3300042616 Ga0466715_023570 Ga0466715_023570_1023_1916 297
63 3300042616 Ga0466715_113262 Ga0466715_113262_12756_13649 297
64 3300042616 Ga0466715_228336 Ga0466715_228336_8938_9831 297
65 3300042616 Ga0466715_253223 Ga0466715_253223_8128_9021 297
66 3300042616 Ga0466715_517916 Ga0466715_517916_30_923 297
67 3300042616 Ga0466715_608206 Ga0466715_608206_25196_26089 297
68 3300042618 Ga0466723_025239 Ga0466723_025239_11873_12766 297
69 3300042618 Ga0466723_261527 Ga0466723_261527_938_1831 297
70 3300042618 Ga0466723_335450 Ga0466723_335450_8037_8930 297
71 3300042619 Ga0466726_080715 Ga0466726_080715_590_1483 297
72 3300042619 Ga0466726_460521 Ga0466726_460521_4033_4926 297
73 3300042620 Ga0466728_115651 Ga0466728_115651_1829_2722 297
74 3300042620 Ga0466728_164254 Ga0466728_164254_10056_10949 297
75 3300042620 Ga0466728_464354 Ga0466728_464354_1009_1902 297
76 3300042622 Ga0466731_048037 Ga0466731_048037_140_1033 297
77 3300042624 Ga0466735_045498 Ga0466735_045498_1915_2808 297
78 3300042624 Ga0466735_050026 Ga0466735_050026_618_1511 297
79 3300042624 Ga0466735_066922 Ga0466735_066922_1674_2567 297
80 3300042624 Ga0466735_090469 Ga0466735_090469_853_1746 297
81 3300042624 Ga0466735_137983 Ga0466735_137983_689_1582 297
82 3300042624 Ga0466735_193071 Ga0466735_193071_1283_2176 297
83 3300042624 Ga0466735_227610 Ga0466735_227610_148_1041 297
84 3300042643 Ga0466704_029658 Ga0466704_029658_3207_4100 297
85 3300042643 Ga0466704_078285 Ga0466704_078285_816_1709 297
86 3300042643 Ga0466704_109164 Ga0466704_109164_565_1458 297
87 3300042643 Ga0466704_308810 Ga0466704_308810_978_1871 297
88 3300042648 Ga0466709_039419 Ga0466709_039419_47275_48168 297
89 3300042648 Ga0466709_164981 Ga0466709_164981_1455_2348 297
90 3300042648 Ga0466709_374153 Ga0466709_374153_4437_5330 297
91 3300042649 Ga0466724_60099 Ga0466724_60099_824_1717 297
92 3300042652 Ga0466708_078638 Ga0466708_078638_2295_3188 297
93 3300042652 Ga0466708_461800 Ga0466708_461800_8787_9680 297
94 3300042655 Ga0466727_048423 Ga0466727_048423_2041_2934 297
95 3300042655 Ga0466727_058007 Ga0466727_058007_6117_7010 297
96 3300042655 Ga0466727_083717 Ga0466727_083717_686_1579 297
97 3300042655 Ga0466727_155859 Ga0466727_155859_960_1853 297
98 3300042655 Ga0466727_225284 Ga0466727_225284_199_1092 297
99 3300042656 Ga0466732_074198 Ga0466732_074198_200_1093 297
100 iso_pr_bacteria 2820765201 2820766087 297
101 3300002462 JGI24702J35022_10007885 JGI24702J35022_100078853 298
102 3300002462 JGI24702J35022_10022287 JGI24702J35022_100222873 298
103 3300002462 JGI24702J35022_10064248 JGI24702J35022_100642482 298
104 3300002462 JGI24702J35022_10088097 JGI24702J35022_100880972 298
105 3300002462 JGI24702J35022_10098110 JGI24702J35022_100981102 298
106 3300002462 JGI24702J35022_10119742 JGI24702J35022_101197422 298
107 3300005083 Ga0068305_10009920 Ga0068305_1000992011 298
108 3300009784 Ga0123357_10393362 Ga0123357_103933622 298
109 3300010167 Ga0123353_10036352 Ga0123353_100363524 298
110 3300010167 Ga0123353_10156380 Ga0123353_101563805 298
111 3300010167 Ga0123353_10440790 Ga0123353_104407903 298
112 3300010882 Ga0123354_10244360 Ga0123354_102443602 298
113 3300024493 Ga0264413_148675 Ga0264413_1486754 298
114 3300042590 Ga0466690_127833 Ga0466690_127833_6104_7000 298
115 3300042593 Ga0466691_010908 Ga0466691_010908_46018_46914 298
116 3300042594 Ga0466694_049088 Ga0466694_049088_443_1339 298
117 3300042599 Ga0466706_115523 Ga0466706_115523_7163_8059 298
118 3300042605 Ga0466716_011158 Ga0466716_011158_221_1117 298
119 3300042606 Ga0466719_097940 Ga0466719_097940_2963_3859 298
120 3300042606 Ga0466719_390036 Ga0466719_390036_209_1105 298
121 3300042616 Ga0466715_340747 Ga0466715_340747_3647_4543 298
122 3300042618 Ga0466723_002535 Ga0466723_002535_555_1451 298
123 3300042619 Ga0466726_421046 Ga0466726_421046_10602_11498 298
124 3300042623 Ga0466734_009710 Ga0466734_009710_426_1322 298
125 3300042624 Ga0466735_042744 Ga0466735_042744_178_1074 298
126 3300042636 Ga0466703_002530 Ga0466703_002530_10285_11181 298
127 3300042636 Ga0466703_041467 Ga0466703_041467_3907_4803 298
128 3300042636 Ga0466703_338570 Ga0466703_338570_184_1080 298
129 3300042636 Ga0466703_387280 Ga0466703_387280_167_1063 298
130 3300042655 Ga0466727_167278 Ga0466727_167278_8745_9641 298
131 3300042659 Ga0466733_018008 Ga0466733_018008_4864_5760 298
132 3300042659 Ga0466733_195509 Ga0466733_195509_68111_69007 298
133 iso_pr_bacteria 2820762746 2820764221 298
134 3300002449 JGI24698J34947_10034869 JGI24698J34947_100348693 299
135 3300002462 JGI24702J35022_10000341 JGI24702J35022_1000034121 299
136 3300002509 JGI24699J35502_11134139 JGI24699J35502_1113413920 299
137 3300005083 Ga0068305_10755418 Ga0068305_107554182 299
138 3300005200 Ga0072940_1049695 Ga0072940_10496952 299
139 3300042592 Ga0466693_114125 Ga0466693_114125_1437_2336 299
140 3300042596 Ga0466696_086569 Ga0466696_086569_4197_5096 299
141 3300042599 Ga0466706_136207 Ga0466706_136207_27559_28458 299
142 3300042599 Ga0466706_140986 Ga0466706_140986_3347_4246 299
143 3300042599 Ga0466706_214588 Ga0466706_214588_5451_6350 299
144 3300042601 Ga0466707_171919 Ga0466707_171919_299_1198 299
145 3300042601 Ga0466707_329152 Ga0466707_329152_4776_5675 299
146 3300042612 Ga0466705_309528 Ga0466705_309528_37631_38530 299
147 3300042619 Ga0466726_021927 Ga0466726_021927_2021_2920 299
148 3300042635 Ga0466702_009067 Ga0466702_009067_13_912 299
149 3300042636 Ga0466703_280441 Ga0466703_280441_349_1248 299
150 3300042643 Ga0466704_481091 Ga0466704_481091_2749_3648 299
151 iso_pr_bacteria 2940216256 2940217666 299
152 3300000062 IMNBL1DRAFT_c0000159 IMNBL1DRAFT_000015949 300
153 3300002504 JGI24705J35276_12238403 JGI24705J35276_122384037 300
154 3300002834 JGI24696J40584_12956844 JGI24696J40584_129568442 300
155 3300005071 Ga0068302_10193390 Ga0068302_101933901 300
156 3300010167 Ga0123353_10509389 Ga0123353_105093891 300
157 3300042602 Ga0466713_076790 Ga0466713_076790_3233_4135 300
158 3300042602 Ga0466713_078122 Ga0466713_078122_3341_4243 300
159 3300042602 Ga0466713_099930 Ga0466713_099930_18879_19781 300
160 3300042609 Ga0466722_249425 Ga0466722_249425_787_1689 300
161 3300042616 Ga0466715_095522 Ga0466715_095522_2036_2938 300
162 3300042616 Ga0466715_246897 Ga0466715_246897_32279_33181 300
163 3300042624 Ga0466735_037337 Ga0466735_037337_234_1136 300
164 3300042625 Ga0466730_100610 Ga0466730_100610_223_1125 300
165 3300042636 Ga0466703_073948 Ga0466703_073948_1077_1979 300
166 3300042643 Ga0466704_131738 Ga0466704_131738_200_1102 300
167 2225789004 2227552970 2228083985 301
168 3300002504 JGI24705J35276_12227486 JGI24705J35276_122274863 301
169 3300005083 Ga0068305_10176955 Ga0068305_101769552 301
170 3300005201 Ga0072941_1039885 Ga0072941_10398859 301
171 3300042619 Ga0466726_313238 Ga0466726_313238_77_982 301
172 3300042624 Ga0466735_038409 Ga0466735_038409_1988_2893 301
173 3300042624 Ga0466735_058173 Ga0466735_058173_23743_24648 301
174 3300042659 Ga0466733_211188 Ga0466733_211188_4701_5606 301
175 iso_pr_bacteria 2967483437 2967483839 301
176 3300000062 IMNBL1DRAFT_c0000077 IMNBL1DRAFT_00000773 302
177 3300002462 JGI24702J35022_10041880 JGI24702J35022_100418803 302
178 3300010167 Ga0123353_10036193 Ga0123353_100361934 302
179 3300042605 Ga0466716_161364 Ga0466716_161364_2246_3154 302
180 3300042591 Ga0466692_094463 Ga0466692_094463_7260_8171 303
181 3300042603 Ga0466714_101534 Ga0466714_101534_2378_3289 303
182 3300042612 Ga0466705_155248 Ga0466705_155248_5060_5971 303
183 3300042643 Ga0466704_316954 Ga0466704_316954_72_983 303
184 3300042599 Ga0466706_136069 Ga0466706_136069_3881_4795 304
185 3300042603 Ga0466714_169350 Ga0466714_169350_1105_2022 305
186 3300042602 Ga0466713_009402 Ga0466713_009402_873_1793 306
187 3300042601 Ga0466707_216551 Ga0466707_216551_7562_8485 307
188 3300042606 Ga0466719_077631 Ga0466719_077631_2099_3025 308
189 3300000062 IMNBL1DRAFT_c0011719 IMNBL1DRAFT_00117193 309
190 3300042655 Ga0466727_005771 Ga0466727_005771_657_1586 309
191 3300010167 Ga0123353_10163662 Ga0123353_101636624 310
192 3300042656 Ga0466732_187528 Ga0466732_187528_1701_2636 311
193 3300042606 Ga0466719_051482 Ga0466719_051482_2781_3821 312
194 3300009784 Ga0123357_10011170 Ga0123357_1001117011 317
195 3300042648 Ga0466709_346172 Ga0466709_346172_9337_10359 340

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04055 Radical_SAM Radical SAM superfamily 72 220 0.91

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.