Protein Family IF09661
Metagenome
Isolate
156
Members
76
Samples
140
Scaffolds
166.35
Avg Length
Representative Sequence
- ID
- 3300042648|Ga0466709_328921|Ga0466709_328921_9645_10217
- Length
- 190 aa
- Sequence
- VCSRRGRQTEWPGAISRDTGKKETAMNYKGKAHKVGDNIDTDAIIPARFLVTTDSAKLGENCFSGLEPGWVKRVKKGDILVAGRNFGCGSSREHAPIAILGAGIPVVVARSFARIFYRNAFNMGLLLMEAGDEAAKIQDGDELEIIPGEGRIRDLARNFDIVCPPLPEAMAAILDAGGLVGHVSRRLGKA
Sample Types
Isolate
10.3%
Metagenome
89.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
28.8%
Unclassified
20.5%
Kalotermitidae
16.4%
Formicidae
12.3%
Rhinotermitidae
5.5%
Termopsidae
4.1%
Coreidae
2.7%
Armadillidiidae
2.7%
Passalidae
2.7%
Culicidae
1.4%
Elmidae
1.4%
Hodotermitidae
1.4%
Taxonomy
Archaea
16
Bacteria
134
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2861449170 | Desulfovibrio intestinalis DSM 11275 | Isolate | Unclassified |
| 2 | 2820070515 | Unclassified Proteobacteria Nt197P3bin137 | Isolate | Unclassified |
| 3 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 4 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 5 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 6 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 7 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 8 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 9 | 2684622742 | Methanobrevibacter curvatus DSM11111 | Isolate | Unclassified |
| 10 | 2820046858 | Unclassified Proteobacteria Th196P3bin84 | Isolate | Unclassified |
| 11 | 2820072841 | Unclassified Proteobacteria Nt197P3bin127 | Isolate | Unclassified |
| 12 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 13 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 14 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 15 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 16 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 17 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 18 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 19 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 20 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 21 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 22 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 23 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 24 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 25 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 26 | 2684622743 | Methanobrevibacter cuticularis DSM11139 | Isolate | Unclassified |
| 27 | 2820492969 | Unclassified Firmicutes Lab288P1bin6 | Isolate | Unclassified |
| 28 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 29 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 30 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 31 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 32 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 33 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 34 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 35 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 36 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 37 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 38 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 39 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 40 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 41 | 2508501043 | Desulfovibrio termitidis HI1 | Isolate | Rhinotermitidae |
| 42 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 43 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 44 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 45 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 46 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 47 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 48 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 49 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 50 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 51 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 52 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 53 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 54 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 55 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 56 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 57 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 58 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 59 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 60 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 61 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 62 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 63 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 64 | 2820068815 | Unclassified Proteobacteria Nt197P3bin4 | Isolate | Unclassified |
| 65 | 2773857693 | Methanobrevibacter sp. Th196P3bin91 | Isolate | Unclassified |
| 66 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 67 | 2684622740 | Methanobrevibacter filiformis DSM11501 | Isolate | Unclassified |
| 68 | 2820058318 | Unclassified Proteobacteria Nt197P4bin33 | Isolate | Unclassified |
| 69 | 2773857683 | Methanobrevibacter sp. Lab288P3bin120 | Isolate | Unclassified |
| 70 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 71 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 72 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 73 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 74 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 75 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 76 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466729_315795 | 3300042621 | Bacteria | 1872 |
| 2 | Ga0466734_089338 | 3300042623 | Bacteria | 36324 |
| 3 | Ga0466709_064956 | 3300042648 | Unclassified | 4481 |
| 4 | Ga0466708_110330 | 3300042652 | Bacteria | 7871 |
| 5 | Ga0466708_335299 | 3300042652 | Bacteria | 16396 |
| 6 | Ga0466711_280982 | 3300042615 | Bacteria | 2321 |
| 7 | Ga0466715_272472 | 3300042616 | Bacteria | 15652 |
| 8 | Ga0466718_026332 | 3300042617 | Bacteria | 1509 |
| 9 | Ga0123357_10417312 | 3300009784 | Bacteria | 1202 |
| 10 | Ga0123357_10761755 | 3300009784 | Bacteria | 669 |
| 11 | Ga0123356_10302800 | 3300010049 | Bacteria | 1704 |
| 12 | Ga0123353_10011742 | 3300010167 | Bacteria | 12369 |
| 13 | Ga0123353_11458787 | 3300010167 | Bacteria | 875 |
| 14 | Ga0466707_214851 | 3300042601 | Bacteria | 31156 |
| 15 | Ga0466722_065535 | 3300042609 | Bacteria | 38294 |
| 16 | Ga0466722_209032 | 3300042609 | Bacteria | 43008 |
| 17 | JGI24705J35276_12236180 | 3300002504 | Archaea | 7606 |
| 18 | Ga0466705_234490 | 3300042612 | Bacteria | 3101 |
| 19 | Ga0466709_130801 | 3300042648 | Bacteria | 11118 |
| 20 | Ga0466727_067534 | 3300042655 | Bacteria | 1359 |
| 21 | Ga0466705_487876 | 3300042612 | Bacteria | 2516 |
| 22 | Ga0415639_000212 | 3300038395 | Unclassified | 7523 |
| 23 | Ga0466656_035168 | 3300042550 | Bacteria | 1082 |
| 24 | Ga0123356_10112458 | 3300010049 | Bacteria | 2633 |
| 25 | Ga0123353_10838638 | 3300010167 | Bacteria | 1262 |
| 26 | Ga0123353_11900296 | 3300010167 | Bacteria | 734 |
| 27 | Ga0123354_10001722 | 3300010882 | Bacteria | 27449 |
| 28 | Ga0466701_082277 | 3300042598 | Bacteria | 2455 |
| 29 | Ga0466722_140081 | 3300042609 | Bacteria | 1109 |
| 30 | Ga0466698_433151 | 3300042610 | Bacteria | 1052 |
| 31 | 2227499224 | 2225789004 | Archaea | 750 |
| 32 | Ga0072941_1350793 | 3300005201 | Bacteria | 1238 |
| 33 | Ga0103267_1112230 | 3300007190 | Bacteria | 718 |
| 34 | Ga0466729_242998 | 3300042621 | Bacteria | 187282 |
| 35 | Ga0466703_230998 | 3300042636 | Bacteria | 7831 |
| 36 | Ga0466703_347053 | 3300042636 | Bacteria | 9715 |
| 37 | Ga0466710_077736 | 3300042613 | Bacteria | 91078 |
| 38 | Ga0466715_239851 | 3300042616 | Bacteria | 13886 |
| 39 | Ga0466726_380598 | 3300042619 | Bacteria | 1060 |
| 40 | Ga0160446_107351 | 3300012835 | Bacteria | 1484 |
| 41 | Ga0466690_060733 | 3300042590 | Bacteria | 1252 |
| 42 | Ga0466693_075770 | 3300042592 | Archaea | 1424 |
| 43 | Ga0466695_403775 | 3300042595 | Bacteria | 1182 |
| 44 | Ga0123357_10260703 | 3300009784 | Bacteria | 1833 |
| 45 | Ga0123356_10010207 | 3300010049 | Unclassified | 9237 |
| 46 | Ga0123353_10007838 | 3300010167 | Archaea | 14502 |
| 47 | Ga0466706_050734 | 3300042599 | Bacteria | 49644 |
| 48 | Ga0466706_286688 | 3300042599 | Bacteria | 1446 |
| 49 | Ga0466713_080847 | 3300042602 | Bacteria | 80758 |
| 50 | Ga0466713_136558 | 3300042602 | Archaea | 15585 |
| 51 | 2227103050 | 2225789004 | Bacteria | 1782 |
| 52 | Ga0466697_230735 | 3300042611 | Archaea | 1021 |
| 53 | Ga0466734_099799 | 3300042623 | Bacteria | 6712 |
| 54 | Ga0466735_126624 | 3300042624 | Archaea | 32243 |
| 55 | Ga0466703_047974 | 3300042636 | Bacteria | 5108 |
| 56 | Ga0466704_115088 | 3300042643 | Unclassified | 2166 |
| 57 | Ga0466709_328921 | 3300042648 | Bacteria | 14889 |
| 58 | Ga0466711_144071 | 3300042615 | Bacteria | 1004 |
| 59 | Ga0466692_020117 | 3300042591 | Bacteria | 1861 |
| 60 | Ga0123353_10516360 | 3300010167 | Bacteria | 1735 |
| 61 | Ga0466713_119043 | 3300042602 | Bacteria | 91363 |
| 62 | Ga0466716_124299 | 3300042605 | Archaea | 4586 |
| 63 | Ga0466716_149977 | 3300042605 | Bacteria | 23838 |
| 64 | Ga0466716_440726 | 3300042605 | Bacteria | 4362 |
| 65 | 2227469079 | 2225789004 | Bacteria | 23964 |
| 66 | 2227496369 | 2225789004 | Bacteria | 763 |
| 67 | JGI24702J35022_10187954 | 3300002462 | Bacteria | 1177 |
| 68 | JGI24705J35276_12236284 | 3300002504 | Bacteria | 7769 |
| 69 | CVPL010W_10005191 | 3300002931 | Bacteria | 14618 |
| 70 | Ga0068305_10970609 | 3300005083 | Unclassified | 653 |
| 71 | Ga0466730_079616 | 3300042625 | Bacteria | 2569 |
| 72 | Ga0466703_031243 | 3300042636 | Bacteria | 17564 |
| 73 | Ga0466708_353123 | 3300042652 | Bacteria | 5283 |
| 74 | Ga0466705_428164 | 3300042612 | Bacteria | 12108 |
| 75 | Ga0466705_445908 | 3300042612 | Bacteria | 2131 |
| 76 | Ga0466715_078396 | 3300042616 | Bacteria | 18037 |
| 77 | Ga0466718_049366 | 3300042617 | Bacteria | 1309 |
| 78 | Ga0466718_080122 | 3300042617 | Bacteria | 3314 |
| 79 | Ga0466726_061757 | 3300042619 | Bacteria | 1661 |
| 80 | Ga0123353_10209200 | 3300010167 | Bacteria | 3061 |
| 81 | Ga0466701_067233 | 3300042598 | Bacteria | 1108 |
| 82 | Ga0466706_004517 | 3300042599 | Bacteria | 1983 |
| 83 | Ga0466713_012192 | 3300042602 | Bacteria | 24424 |
| 84 | Ga0466722_114641 | 3300042609 | Bacteria | 8467 |
| 85 | IMNBL1DRAFT_c0004421 | 3300000062 | Bacteria | 8470 |
| 86 | Ga0102736_1004798 | 3300007052 | Bacteria | 1775 |
| 87 | Ga0102735_1000237 | 3300007080 | Bacteria | 17112 |
| 88 | Ga0123357_10000246 | 3300009784 | Bacteria | 51630 |
| 89 | Ga0466697_139943 | 3300042611 | Archaea | 3073 |
| 90 | Ga0466730_006339 | 3300042625 | Bacteria | 2434 |
| 91 | Ga0466708_129284 | 3300042652 | Bacteria | 87640 |
| 92 | Ga0466726_008118 | 3300042619 | Bacteria | 3235 |
| 93 | Ga0160456_100059 | 3300012820 | Bacteria | 166063 |
| 94 | Ga0160433_108971 | 3300012846 | Bacteria | 1324 |
| 95 | Ga0466692_197569 | 3300042591 | Bacteria | 10512 |
| 96 | Ga0466695_257172 | 3300042595 | Bacteria | 2923 |
| 97 | Ga0123355_10405964 | 3300009826 | Bacteria | 1753 |
| 98 | Ga0123353_11041530 | 3300010167 | Bacteria | 1094 |
| 99 | Ga0123354_10130792 | 3300010882 | Bacteria | 3172 |
| 100 | Ga0123354_10237502 | 3300010882 | Bacteria | 1885 |
| 101 | Ga0466700_137489 | 3300042600 | Bacteria | 1037 |
| 102 | Ga0466707_086068 | 3300042601 | Bacteria | 36407 |
| 103 | Ga0466707_393735 | 3300042601 | Bacteria | 10161 |
| 104 | Ga0102739_1001412 | 3300007095 | Bacteria | 3967 |
| 105 | Ga0103268_1000088 | 3300007192 | Unclassified | 28722 |
| 106 | Ga0466705_256941 | 3300042612 | Bacteria | 1304 |
| 107 | Ga0466709_348323 | 3300042648 | Bacteria | 6456 |
| 108 | Ga0466708_063582 | 3300042652 | Bacteria | 30911 |
| 109 | Ga0466705_419543 | 3300042612 | Bacteria | 18737 |
| 110 | Ga0466711_092284 | 3300042615 | Bacteria | 21797 |
| 111 | Ga0466711_148366 | 3300042615 | Bacteria | 1032 |
| 112 | Ga0466723_163819 | 3300042618 | Bacteria | 1217 |
| 113 | Ga0466728_118083 | 3300042620 | Bacteria | 127464 |
| 114 | Ga0160431_100001 | 3300012828 | Bacteria | 647842 |
| 115 | Ga0466692_077511 | 3300042591 | Bacteria | 1957 |
| 116 | Ga0466693_114151 | 3300042592 | Bacteria | 1076 |
| 117 | Ga0466696_057212 | 3300042596 | Bacteria | 8254 |
| 118 | Ga0123355_10003030 | 3300009826 | Bacteria | 23945 |
| 119 | Ga0123355_10873275 | 3300009826 | Bacteria | 984 |
| 120 | Ga0123353_12211876 | 3300010167 | Bacteria | 665 |
| 121 | Ga0123354_10108441 | 3300010882 | Bacteria | 3688 |
| 122 | Ga0160465_109234 | 3300012803 | Bacteria | 851 |
| 123 | Ga0466700_059782 | 3300042600 | Bacteria | 1753 |
| 124 | Ga0466717_183836 | 3300042604 | Bacteria | 1114 |
| 125 | Ga0466698_209574 | 3300042610 | Bacteria | 1390 |
| 126 | Ga0103260_1000198 | 3300007139 | Bacteria | 13234 |
| 127 | Ga0102738_1004735 | 3300007141 | Bacteria | 1934 |
| 128 | Ga0466704_427258 | 3300042643 | Bacteria | 1487 |
| 129 | Ga0466704_560239 | 3300042643 | Bacteria | 3278 |
| 130 | Ga0466725_191735 | 3300042654 | Bacteria | 1761 |
| 131 | Ga0466715_113238 | 3300042616 | Bacteria | 9016 |
| 132 | Ga0466715_222525 | 3300042616 | Bacteria | 9825 |
| 133 | Ga0123353_10356570 | 3300010167 | Archaea | 2200 |
| 134 | Ga0123353_10832365 | 3300010167 | Bacteria | 1268 |
| 135 | Ga0466700_087474 | 3300042600 | Bacteria | 1328 |
| 136 | Ga0466700_193155 | 3300042600 | Bacteria | 2385 |
| 137 | IMNBL1DRAFT_c0000053 | 3300000062 | Archaea | 108777 |
| 138 | JGI24702J35022_10000147 | 3300002462 | Bacteria | 35962 |
| 139 | JGI24702J35022_10146220 | 3300002462 | Bacteria | 1323 |
| 140 | Ga0102734_1005868 | 3300007129 | Bacteria | 3295 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300007190 | Ga0103267_1112230 | Ga0103267_11122302 | 142 |
| 2 | 3300042655 | Ga0466727_067534 | Ga0466727_067534_59_502 | 147 |
| 3 | 3300005201 | Ga0072941_1350793 | Ga0072941_13507931 | 156 |
| 4 | 3300010167 | Ga0123353_10838638 | Ga0123353_108386381 | 156 |
| 5 | 3300042605 | Ga0466716_124299 | Ga0466716_124299_2487_2966 | 159 |
| 6 | 3300042617 | Ga0466718_080122 | Ga0466718_080122_2245_2724 | 159 |
| 7 | 3300000062 | IMNBL1DRAFT_c0000053 | IMNBL1DRAFT_0000053109 | 160 |
| 8 | 3300042619 | Ga0466726_061757 | Ga0466726_061757_1129_1611 | 160 |
| 9 | iso_pu_archaea | 2684622742 | 2685522421 | 160 |
| 10 | iso_pu_archaea | 2684622743 | 2685524857 | 160 |
| 11 | iso_pu_archaea | 2773857683 | 2774156003 | 160 |
| 12 | iso_pu_archaea | 2773857693 | 2774168846 | 160 |
| 13 | 3300010167 | Ga0123353_10007838 | Ga0123353_100078384 | 161 |
| 14 | 3300042615 | Ga0466711_144071 | Ga0466711_144071_135_620 | 161 |
| 15 | iso_pu_archaea | 2684622740 | 2685517848 | 161 |
| 16 | 3300002504 | JGI24705J35276_12236180 | JGI24705J35276_122361801 | 162 |
| 17 | 3300010049 | Ga0123356_10010207 | Ga0123356_100102078 | 162 |
| 18 | 3300042599 | Ga0466706_004517 | Ga0466706_004517_1338_1826 | 162 |
| 19 | 3300042612 | Ga0466705_428164 | Ga0466705_428164_7102_7590 | 162 |
| 20 | 2225789004 | 2227496369 | 2227974006 | 163 |
| 21 | 3300005083 | Ga0068305_10970609 | Ga0068305_109706091 | 163 |
| 22 | 3300010167 | Ga0123353_10209200 | Ga0123353_102092002 | 163 |
| 23 | 3300042602 | Ga0466713_012192 | Ga0466713_012192_15814_16305 | 163 |
| 24 | 3300042621 | Ga0466729_242998 | Ga0466729_242998_178623_179114 | 163 |
| 25 | 3300042654 | Ga0466725_191735 | Ga0466725_191735_209_700 | 163 |
| 26 | iso_pr_bacteria | 2508501043 | 2508700892 | 163 |
| 27 | iso_pr_bacteria | 2861449170 | 2861450396 | 163 |
| 28 | 3300009784 | Ga0123357_10260703 | Ga0123357_102607032 | 164 |
| 29 | 3300009784 | Ga0123357_10761755 | Ga0123357_107617551 | 164 |
| 30 | 3300010882 | Ga0123354_10001722 | Ga0123354_1000172211 | 164 |
| 31 | 3300010882 | Ga0123354_10108441 | Ga0123354_101084414 | 164 |
| 32 | 3300042591 | Ga0466692_197569 | Ga0466692_197569_7533_8027 | 164 |
| 33 | 3300042592 | Ga0466693_075770 | Ga0466693_075770_65_559 | 164 |
| 34 | 3300042592 | Ga0466693_114151 | Ga0466693_114151_262_756 | 164 |
| 35 | 3300042598 | Ga0466701_082277 | Ga0466701_082277_115_609 | 164 |
| 36 | 3300042599 | Ga0466706_286688 | Ga0466706_286688_661_1155 | 164 |
| 37 | 3300042600 | Ga0466700_059782 | Ga0466700_059782_547_1041 | 164 |
| 38 | 3300042604 | Ga0466717_183836 | Ga0466717_183836_389_883 | 164 |
| 39 | 3300042610 | Ga0466698_209574 | Ga0466698_209574_428_922 | 164 |
| 40 | 3300042611 | Ga0466697_139943 | Ga0466697_139943_2178_2672 | 164 |
| 41 | 3300042623 | Ga0466734_099799 | Ga0466734_099799_1918_2412 | 164 |
| 42 | iso_pr_bacteria | 2820058318 | 2820059588 | 164 |
| 43 | 2225789004 | 2227103050 | 2227487516 | 165 |
| 44 | 3300002462 | JGI24702J35022_10187954 | JGI24702J35022_101879542 | 165 |
| 45 | 3300002504 | JGI24705J35276_12236284 | JGI24705J35276_122362843 | 165 |
| 46 | 3300009784 | Ga0123357_10000246 | Ga0123357_100002468 | 165 |
| 47 | 3300009784 | Ga0123357_10417312 | Ga0123357_104173122 | 165 |
| 48 | 3300009826 | Ga0123355_10405964 | Ga0123355_104059642 | 165 |
| 49 | 3300010167 | Ga0123353_11041530 | Ga0123353_110415302 | 165 |
| 50 | 3300010167 | Ga0123353_11458787 | Ga0123353_114587872 | 165 |
| 51 | 3300010167 | Ga0123353_11900296 | Ga0123353_119002961 | 165 |
| 52 | 3300010882 | Ga0123354_10237502 | Ga0123354_102375023 | 165 |
| 53 | 3300038395 | Ga0415639_000212 | Ga0415639_000212_1291_1788 | 165 |
| 54 | 3300042550 | Ga0466656_035168 | Ga0466656_035168_514_1011 | 165 |
| 55 | 3300042595 | Ga0466695_257172 | Ga0466695_257172_527_1024 | 165 |
| 56 | 3300042595 | Ga0466695_403775 | Ga0466695_403775_157_654 | 165 |
| 57 | 3300042596 | Ga0466696_057212 | Ga0466696_057212_3551_4048 | 165 |
| 58 | 3300042598 | Ga0466701_067233 | Ga0466701_067233_55_552 | 165 |
| 59 | 3300042601 | Ga0466707_086068 | Ga0466707_086068_17276_17773 | 165 |
| 60 | 3300042602 | Ga0466713_080847 | Ga0466713_080847_60803_61300 | 165 |
| 61 | 3300042602 | Ga0466713_136558 | Ga0466713_136558_13353_13850 | 165 |
| 62 | 3300042609 | Ga0466722_065535 | Ga0466722_065535_23476_23973 | 165 |
| 63 | 3300042609 | Ga0466722_209032 | Ga0466722_209032_29980_30477 | 165 |
| 64 | 3300042610 | Ga0466698_433151 | Ga0466698_433151_410_907 | 165 |
| 65 | 3300042611 | Ga0466697_230735 | Ga0466697_230735_250_747 | 165 |
| 66 | 3300042613 | Ga0466710_077736 | Ga0466710_077736_52943_53440 | 165 |
| 67 | 3300042617 | Ga0466718_049366 | Ga0466718_049366_434_931 | 165 |
| 68 | 3300042621 | Ga0466729_315795 | Ga0466729_315795_232_729 | 165 |
| 69 | 3300042624 | Ga0466735_126624 | Ga0466735_126624_3815_4312 | 165 |
| 70 | 3300042648 | Ga0466709_064956 | Ga0466709_064956_1568_2065 | 165 |
| 71 | 3300042652 | Ga0466708_129284 | Ga0466708_129284_19664_20161 | 165 |
| 72 | 3300002931 | CVPL010W_10005191 | CVPL010W_100051919 | 166 |
| 73 | 3300007052 | Ga0102736_1004798 | Ga0102736_10047982 | 166 |
| 74 | 3300007080 | Ga0102735_1000237 | Ga0102735_10002374 | 166 |
| 75 | 3300007095 | Ga0102739_1001412 | Ga0102739_10014122 | 166 |
| 76 | 3300007129 | Ga0102734_1005868 | Ga0102734_10058685 | 166 |
| 77 | 3300007139 | Ga0103260_1000198 | Ga0103260_100019811 | 166 |
| 78 | 3300007141 | Ga0102738_1004735 | Ga0102738_10047352 | 166 |
| 79 | 3300007192 | Ga0103268_1000088 | Ga0103268_10000887 | 166 |
| 80 | 3300009826 | Ga0123355_10873275 | Ga0123355_108732752 | 166 |
| 81 | 3300010049 | Ga0123356_10112458 | Ga0123356_101124583 | 166 |
| 82 | 3300010167 | Ga0123353_10011742 | Ga0123353_100117425 | 166 |
| 83 | 3300010882 | Ga0123354_10130792 | Ga0123354_101307922 | 166 |
| 84 | 3300042599 | Ga0466706_050734 | Ga0466706_050734_9297_9797 | 166 |
| 85 | 3300042600 | Ga0466700_137489 | Ga0466700_137489_215_715 | 166 |
| 86 | 3300042601 | Ga0466707_393735 | Ga0466707_393735_650_1150 | 166 |
| 87 | 3300042612 | Ga0466705_234490 | Ga0466705_234490_2302_2802 | 166 |
| 88 | 3300042612 | Ga0466705_256941 | Ga0466705_256941_572_1072 | 166 |
| 89 | 3300042616 | Ga0466715_239851 | Ga0466715_239851_11365_11865 | 166 |
| 90 | 3300042616 | Ga0466715_272472 | Ga0466715_272472_2431_2931 | 166 |
| 91 | 3300042619 | Ga0466726_008118 | Ga0466726_008118_2055_2555 | 166 |
| 92 | 3300042625 | Ga0466730_006339 | Ga0466730_006339_926_1426 | 166 |
| 93 | 3300042625 | Ga0466730_079616 | Ga0466730_079616_1454_1954 | 166 |
| 94 | iso_pr_bacteria | 2820068815 | 2820068922 | 166 |
| 95 | iso_pr_bacteria | 2820072841 | 2820074076 | 166 |
| 96 | iso_pr_bacteria | 2820492969 | 2820493315 | 166 |
| 97 | 3300009826 | Ga0123355_10003030 | Ga0123355_100030303 | 167 |
| 98 | 3300010049 | Ga0123356_10302800 | Ga0123356_103028001 | 167 |
| 99 | 3300010167 | Ga0123353_10516360 | Ga0123353_105163602 | 167 |
| 100 | 3300042591 | Ga0466692_077511 | Ga0466692_077511_1007_1510 | 167 |
| 101 | 3300042600 | Ga0466700_087474 | Ga0466700_087474_721_1224 | 167 |
| 102 | 3300042601 | Ga0466707_214851 | Ga0466707_214851_1481_1984 | 167 |
| 103 | 3300042605 | Ga0466716_440726 | Ga0466716_440726_1174_1677 | 167 |
| 104 | 3300042612 | Ga0466705_419543 | Ga0466705_419543_2947_3450 | 167 |
| 105 | 3300042616 | Ga0466715_222525 | Ga0466715_222525_4772_5275 | 167 |
| 106 | 3300042617 | Ga0466718_026332 | Ga0466718_026332_70_573 | 167 |
| 107 | 3300042620 | Ga0466728_118083 | Ga0466728_118083_54881_55384 | 167 |
| 108 | iso_pr_bacteria | 2820070515 | 2820070758 | 167 |
| 109 | 3300042590 | Ga0466690_060733 | Ga0466690_060733_486_992 | 168 |
| 110 | 3300042615 | Ga0466711_092284 | Ga0466711_092284_16213_16719 | 168 |
| 111 | 3300042619 | Ga0466726_380598 | Ga0466726_380598_437_943 | 168 |
| 112 | 3300042636 | Ga0466703_031243 | Ga0466703_031243_12356_12862 | 168 |
| 113 | 3300042636 | Ga0466703_047974 | Ga0466703_047974_3397_3903 | 168 |
| 114 | 3300042636 | Ga0466703_230998 | Ga0466703_230998_6993_7499 | 168 |
| 115 | 3300042643 | Ga0466704_115088 | Ga0466704_115088_1176_1682 | 168 |
| 116 | 3300042652 | Ga0466708_353123 | Ga0466708_353123_1402_1908 | 168 |
| 117 | iso_pr_bacteria | 2820046858 | 2820047793 | 168 |
| 118 | iso_pr_bacteria | 2864937364 | 2864938545 | 168 |
| 119 | 2225789004 | 2227469079 | 2227912291 | 169 |
| 120 | 3300010167 | Ga0123353_10832365 | Ga0123353_108323652 | 169 |
| 121 | 3300012835 | Ga0160446_107351 | Ga0160446_1073512 | 169 |
| 122 | 3300042600 | Ga0466700_193155 | Ga0466700_193155_1028_1537 | 169 |
| 123 | 3300042602 | Ga0466713_119043 | Ga0466713_119043_88951_89460 | 169 |
| 124 | 3300042612 | Ga0466705_445908 | Ga0466705_445908_300_809 | 169 |
| 125 | 3300042612 | Ga0466705_487876 | Ga0466705_487876_1121_1630 | 169 |
| 126 | 3300042615 | Ga0466711_148366 | Ga0466711_148366_58_567 | 169 |
| 127 | 3300042616 | Ga0466715_113238 | Ga0466715_113238_5803_6312 | 169 |
| 128 | 3300042618 | Ga0466723_163819 | Ga0466723_163819_204_713 | 169 |
| 129 | 3300042643 | Ga0466704_560239 | Ga0466704_560239_2519_3028 | 169 |
| 130 | 3300000062 | IMNBL1DRAFT_c0004421 | IMNBL1DRAFT_00044219 | 170 |
| 131 | 3300002462 | JGI24702J35022_10146220 | JGI24702J35022_101462201 | 170 |
| 132 | 3300010167 | Ga0123353_12211876 | Ga0123353_122118762 | 170 |
| 133 | 3300042636 | Ga0466703_347053 | Ga0466703_347053_6038_6550 | 170 |
| 134 | 3300042643 | Ga0466704_427258 | Ga0466704_427258_260_772 | 170 |
| 135 | iso_pr_bacteria | 8025685901 | 8025690396 | 170 |
| 136 | iso_pr_bacteria | 8102230706 | 8102235201 | 170 |
| 137 | 2225789004 | 2227499224 | 2227979861 | 171 |
| 138 | 3300002462 | JGI24702J35022_10000147 | JGI24702J35022_100001478 | 171 |
| 139 | 3300012803 | Ga0160465_109234 | Ga0160465_1092342 | 171 |
| 140 | 3300012820 | Ga0160456_100059 | Ga0160456_100059125 | 171 |
| 141 | 3300012828 | Ga0160431_100001 | Ga0160431_100001364 | 171 |
| 142 | 3300042616 | Ga0466715_078396 | Ga0466715_078396_12324_12839 | 171 |
| 143 | 3300042623 | Ga0466734_089338 | Ga0466734_089338_19188_19703 | 171 |
| 144 | 3300042652 | Ga0466708_063582 | Ga0466708_063582_16083_16598 | 171 |
| 145 | 3300010167 | Ga0123353_10356570 | Ga0123353_103565701 | 172 |
| 146 | 3300042615 | Ga0466711_280982 | Ga0466711_280982_1363_1881 | 172 |
| 147 | 3300042652 | Ga0466708_335299 | Ga0466708_335299_8824_9342 | 172 |
| 148 | 3300042591 | Ga0466692_020117 | Ga0466692_020117_1174_1695 | 173 |
| 149 | 3300042652 | Ga0466708_110330 | Ga0466708_110330_2787_3311 | 174 |
| 150 | 3300012846 | Ga0160433_108971 | Ga0160433_1089712 | 176 |
| 151 | 3300042609 | Ga0466722_140081 | Ga0466722_140081_512_1042 | 176 |
| 152 | 3300042609 | Ga0466722_114641 | Ga0466722_114641_6498_7040 | 180 |
| 153 | 3300042648 | Ga0466709_348323 | Ga0466709_348323_5494_6042 | 182 |
| 154 | 3300042605 | Ga0466716_149977 | Ga0466716_149977_18429_18983 | 184 |
| 155 | 3300042648 | Ga0466709_130801 | Ga0466709_130801_104_673 | 189 |
| 156 | 3300042648 | Ga0466709_328921 | Ga0466709_328921_9645_10217 | 190 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00694 | Aconitase_C | Aconitase C-terminal domain | 63 | 129 | 0.7 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.81 | 0.89 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.