Protein Family IF09645

Metagenome Isolate
201 Members
72 Samples
172 Scaffolds
337.32 Avg Length

🧬 Representative Sequence

ID
3300042648|Ga0466709_263807|Ga0466709_263807_6185_7318
Length
377 aa
Sequence
MGKKIKIITAMFLNDILLGNKETRRQKTGNKRRGKDEKQAKKFSSFAFLLFPCFLVSFLPACVEIEEYVDTPQGNFEALWKIIDERYCFFDYKEVDWNRIHDEYLRRISNDMNQESLFMLLNEMLQELKDGHVNLTTPFDVGRYWKWFEDYPSNYDESLIRQYLGTDYRIAGSIRYKILDDNIAYLRYADFSSGIGETNLDYIIEKAGICLGMIIDIRDNGGGVLTYSDVFASRFVNEKTLVGYIRHKTGKGHNDFSEPYPKYIEPSSRLRYQKPVVILTNRKCFSTTNDFVNTMGYAPNVTILGDRTGGGSGLPFSSELPNGWSVRFSTCPMFNADMEHLEFGIDPDEPCYLLKEDIHKGKDTLIEKARSLIKERN

📊 Sample Types

Isolate 14.4%
Metagenome 85.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 25.4%
Termitidae 21.1%
Kalotermitidae 19.7%
Unclassified 14.1%
Rhinotermitidae 8.5%
Termopsidae 4.2%
Passalidae 2.8%
Tenebrionidae 1.4%
Hydrophilidae 1.4%
Hodotermitidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 195
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3004677695 Bacteroides sp. 214 Isolate Blattidae
2 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
3 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
4 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
5 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
6 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
7 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
8 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
9 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
10 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
11 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
12 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
13 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
14 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
15 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
16 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
17 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
18 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
19 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
20 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
21 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
22 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
23 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
24 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
25 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
26 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
27 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
28 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
29 3004672520 Bacteroides sp. 51 Isolate Blattidae
30 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
31 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
32 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
33 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
34 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
35 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
36 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
37 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
38 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
39 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
40 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
41 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
42 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
43 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
44 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
45 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
46 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
47 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
48 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
49 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
50 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
51 2922326829 Bacteroides sp. 224 Isolate Blattidae
52 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
53 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
54 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
55 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
56 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
57 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
58 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
59 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
60 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
61 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
62 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
63 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
64 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
65 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
66 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
67 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
68 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
69 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
70 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
71 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
72 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_312455 3300042612 Bacteria 5173
2 Ga0466715_018558 3300042616 Bacteria 17961
3 Ga0466690_060743 3300042590 Bacteria 7339
4 Ga0466696_014961 3300042596 Bacteria 77550
5 Ga0466703_132815 3300042636 Bacteria 1521
6 Ga0466703_250773 3300042636 Bacteria 8485
7 Ga0466704_244636 3300042643 Bacteria 19020
8 Ga0466708_046422 3300042652 Bacteria 20392
9 Ga0466708_159009 3300042652 Bacteria 7226
10 Ga0466707_065309 3300042601 Bacteria 5696
11 Ga0466707_318000 3300042601 Bacteria 2805
12 Ga0466707_403545 3300042601 Bacteria 9865
13 Ga0466719_205100 3300042606 Bacteria 11471
14 2227248328 2225789004 Unclassified 1324
15 2227480510 2225789004 Bacteria 4447
16 JGI24702J35022_10003146 3300002462 Bacteria 9981
17 Ga0068305_10000024 3300005083 Bacteria 79054
18 Ga0072941_1399755 3300005201 Bacteria 1298
19 Ga0466697_142743 3300042611 Bacteria 3275
20 Ga0466705_084572 3300042612 Bacteria 1454
21 Ga0466710_050905 3300042613 Bacteria 10230
22 Ga0466711_122606 3300042615 Bacteria 2531
23 Ga0466715_118178 3300042616 Bacteria 5340
24 Ga0123357_10057723 3300009784 Unclassified 5214
25 Ga0466692_187597 3300042591 Bacteria 1836
26 Ga0466691_162981 3300042593 Bacteria 7968
27 Ga0466729_317537 3300042621 Bacteria 4259
28 Ga0466735_141625 3300042624 Bacteria 2692
29 Ga0466703_026949 3300042636 Bacteria 4053
30 Ga0466703_309558 3300042636 Bacteria 3419
31 Ga0466704_116415 3300042643 Bacteria 3636
32 Ga0466709_263807 3300042648 Bacteria 8178
33 Ga0466706_022674 3300042599 Bacteria 12666
34 Ga0466706_171967 3300042599 Bacteria 2336
35 Ga0466706_220496 3300042599 Bacteria 1491
36 Ga0466700_355677 3300042600 Bacteria 7219
37 Ga0466707_232640 3300042601 Bacteria 10806
38 Ga0466707_407480 3300042601 Bacteria 6575
39 Ga0466713_085966 3300042602 Bacteria 3006
40 Ga0466713_154523 3300042602 Bacteria 2129
41 2227133582 2225789004 Bacteria 8883
42 2227180791 2225789004 Bacteria 8080
43 2227228888 2225789004 Bacteria 1369
44 JGI24705J35276_12214726 3300002504 Unclassified 1973
45 Ga0466697_139692 3300042611 Bacteria 246544
46 Ga0466705_268245 3300042612 Bacteria 6106
47 Ga0466715_449037 3300042616 Bacteria 16321
48 Ga0123357_10106735 3300009784 Bacteria 3589
49 Ga0123354_10100796 3300010882 Bacteria 3906
50 Ga0466690_254247 3300042590 Bacteria 29646
51 Ga0466692_071062 3300042591 Bacteria 16092
52 Ga0466703_276157 3300042636 Bacteria 10545
53 Ga0466703_354635 3300042636 Bacteria 3199
54 Ga0466703_387816 3300042636 Bacteria 1852
55 Ga0466704_036083 3300042643 Bacteria 8019
56 Ga0466704_199973 3300042643 Bacteria 1098
57 Ga0466709_393388 3300042648 Bacteria 7050
58 Ga0466701_050816 3300042598 Bacteria 1432
59 Ga0466706_106820 3300042599 Bacteria 11486
60 Ga0466706_185118 3300042599 Bacteria 14790
61 Ga0466700_238891 3300042600 Bacteria 11536
62 Ga0466707_073283 3300042601 Bacteria 1560
63 Ga0466713_014552 3300042602 Bacteria 1384
64 Ga0466713_047571 3300042602 Bacteria 55256
65 Ga0466713_127535 3300042602 Bacteria 10447
66 Ga0466713_147626 3300042602 Bacteria 5759
67 Ga0466698_465792 3300042610 Bacteria 2689
68 JGI24699J35502_11134178 3300002509 Bacteria 45574
69 Ga0466705_276615 3300042612 Bacteria 2222
70 Ga0466727_350800 3300042655 Bacteria 2711
71 Ga0466733_006107 3300042659 Bacteria 1387
72 Ga0466733_099932 3300042659 Bacteria 24839
73 Ga0466733_154603 3300042659 Bacteria 23462
74 Ga0562377_0004 3300056842 Bacteria 3525959
75 Ga0466726_147793 3300042619 Bacteria 11298
76 Ga0466728_459317 3300042620 Bacteria 5290
77 Ga0123353_10402252 3300010167 Bacteria 2037
78 Ga0123354_10018572 3300010882 Bacteria 10905
79 Ga0123354_10109074 3300010882 Bacteria 3671
80 Ga0466690_005231 3300042590 Bacteria 13066
81 Ga0466692_050331 3300042591 Bacteria 31106
82 Ga0466692_094763 3300042591 Bacteria 33557
83 Ga0466693_386018 3300042592 Bacteria 2041
84 Ga0466696_073941 3300042596 Bacteria 3062
85 Ga0466703_286961 3300042636 Bacteria 18817
86 Ga0466703_431863 3300042636 Bacteria 6232
87 Ga0466704_036567 3300042643 Bacteria 7243
88 Ga0466727_012010 3300042655 Bacteria 7360
89 Ga0466706_166407 3300042599 Bacteria 20740
90 Ga0466707_075398 3300042601 Bacteria 8912
91 Ga0466713_151406 3300042602 Bacteria 82944
92 Ga0466719_550418 3300042606 Bacteria 4378
93 IMNBL1DRAFT_c0001109 3300000062 Bacteria 20634
94 IMNBL1DRAFT_c0050378 3300000062 Bacteria 1321
95 Ga0466705_033239 3300042612 Bacteria 5194
96 Ga0466705_128515 3300042612 Bacteria 6075
97 Ga0466705_136696 3300042612 Unclassified 2503
98 Ga0466705_462556 3300042612 Bacteria 1255
99 Ga0466715_026465 3300042616 Bacteria 99999
100 Ga0466715_580927 3300042616 Bacteria 12597
101 Ga0466728_077153 3300042620 Bacteria 32982
102 Ga0123354_10034285 3300010882 Bacteria 7938
103 Ga0466729_207125 3300042621 Bacteria 3458
104 Ga0466735_132051 3300042624 Bacteria 7466
105 Ga0466704_153053 3300042643 Bacteria 29430
106 Ga0466704_186547 3300042643 Bacteria 9429
107 Ga0466713_006137 3300042602 Bacteria 25307
108 Ga0466713_031124 3300042602 Bacteria 10723
109 Ga0466713_044092 3300042602 Bacteria 37791
110 Ga0466713_063720 3300042602 Bacteria 27762
111 Ga0466716_177329 3300042605 Bacteria 13283
112 Ga0466719_047744 3300042606 Bacteria 5910
113 Ga0466722_009000 3300042609 Bacteria 22538
114 IMNBL1DRAFT_c0007525 3300000062 Bacteria 5708
115 Ga0068305_10252525 3300005083 Bacteria 2250
116 Ga0466705_209420 3300042612 Unclassified 3316
117 Ga0466726_071754 3300042619 Bacteria 11003
118 Ga0466728_064136 3300042620 Bacteria 50421
119 Ga0466728_306930 3300042620 Bacteria 116996
120 Ga0466729_173423 3300042621 Bacteria 5917
121 Ga0123357_10008182 3300009784 Bacteria 13032
122 Ga0466690_254053 3300042590 Bacteria 10580
123 Ga0466691_105692 3300042593 Bacteria 8969
124 Ga0466735_101674 3300042624 Bacteria 5313
125 Ga0466735_186740 3300042624 Unclassified 1879
126 Ga0466704_492009 3300042643 Bacteria 4588
127 Ga0466709_024483 3300042648 Bacteria 22052
128 Ga0466725_156612 3300042654 Bacteria 2511
129 Ga0466706_022572 3300042599 Bacteria 3078
130 Ga0466706_117983 3300042599 Bacteria 21054
131 Ga0466706_138321 3300042599 Bacteria 12585
132 Ga0466706_197390 3300042599 Bacteria 2278
133 Ga0466707_057560 3300042601 Bacteria 16917
134 Ga0466707_096133 3300042601 Bacteria 3054
135 Ga0466713_034002 3300042602 Bacteria 8993
136 Ga0466713_139646 3300042602 Bacteria 516516
137 Ga0466716_165199 3300042605 Bacteria 5228
138 Ga0466716_202600 3300042605 Bacteria 25648
139 Ga0466711_199572 3300042615 Bacteria 17449
140 Ga0466715_128059 3300042616 Bacteria 2908
141 Ga0466723_223421 3300042618 Bacteria 3946
142 Ga0466690_121795 3300042590 Bacteria 6579
143 Ga0466692_026896 3300042591 Bacteria 2499
144 Ga0466691_201737 3300042593 Bacteria 4851
145 Ga0466735_041309 3300042624 Bacteria 3064
146 Ga0466735_085212 3300042624 Bacteria 6769
147 Ga0466703_272549 3300042636 Bacteria 6490
148 Ga0466704_215432 3300042643 Bacteria 4435
149 Ga0466727_172428 3300042655 Bacteria 29494
150 Ga0466701_032343 3300042598 Bacteria 11792
151 Ga0466706_219848 3300042599 Bacteria 17847
152 Ga0466707_038125 3300042601 Bacteria 1858
153 Ga0466719_260128 3300042606 Bacteria 3060
154 Ga0466705_037841 3300042612 Bacteria 6743
155 Ga0466711_199870 3300042615 Bacteria 28300
156 Ga0466711_402421 3300042615 Bacteria 13902
157 Ga0466728_412973 3300042620 Bacteria 5014
158 Ga0123357_10267842 3300009784 Bacteria 1792
159 Ga0123356_10247759 3300010049 Bacteria 1857
160 Ga0123354_10010439 3300010882 Bacteria 14310
161 Ga0123354_10182539 3300010882 Bacteria 2388
162 Ga0123354_10282229 3300010882 Bacteria 1610
163 Ga0466707_352479 3300042601 Bacteria 1824
164 Ga0466713_127978 3300042602 Bacteria 1994
165 Ga0466716_169394 3300042605 Bacteria 10493
166 Ga0466719_023689 3300042606 Bacteria 8986
167 Ga0466722_197334 3300042609 Bacteria 12124
168 Ga0466722_264523 3300042609 Bacteria 1802
169 IMNBL1DRAFT_c0000216 3300000062 Bacteria 50594
170 Ga0068305_10051435 3300005083 Bacteria 4652
171 Ga0072941_1202284 3300005201 Bacteria 1404
172 Ga0123357_10000449 3300009784 Bacteria 39751

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042643 Ga0466704_199973 Ga0466704_199973_40_939 299
2 3300042591 Ga0466692_026896 Ga0466692_026896_352_1293 306
3 3300042636 Ga0466703_354635 Ga0466703_354635_61_1059 311
4 3300042602 Ga0466713_006137 Ga0466713_006137_3332_4270 312
5 3300042605 Ga0466716_169394 Ga0466716_169394_8555_9496 313
6 3300042606 Ga0466719_205100 Ga0466719_205100_7728_8669 313
7 3300042621 Ga0466729_317537 Ga0466729_317537_2478_3419 313
8 3300042636 Ga0466703_387816 Ga0466703_387816_304_1245 313
9 3300042606 Ga0466719_023689 Ga0466719_023689_4596_5540 314
10 3300042610 Ga0466698_465792 Ga0466698_465792_842_1786 314
11 3300042592 Ga0466693_386018 Ga0466693_386018_284_1231 315
12 3300042600 Ga0466700_355677 Ga0466700_355677_3057_4004 315
13 3300042602 Ga0466713_044092 Ga0466713_044092_31786_32733 315
14 3300042605 Ga0466716_202600 Ga0466716_202600_20492_21439 315
15 3300042606 Ga0466719_550418 Ga0466719_550418_2769_3716 315
16 3300042615 Ga0466711_122606 Ga0466711_122606_12_959 315
17 3300042616 Ga0466715_018558 Ga0466715_018558_498_1445 315
18 3300056842 Ga0562377_0004 Ga0562377_0004_1383106_1384116 315
19 3300042598 Ga0466701_050816 Ga0466701_050816_202_1152 316
20 3300042636 Ga0466703_026949 Ga0466703_026949_1983_2933 316
21 3300042593 Ga0466691_162981 Ga0466691_162981_2533_3543 317
22 3300042599 Ga0466706_022674 Ga0466706_022674_10697_11650 317
23 3300042599 Ga0466706_117983 Ga0466706_117983_9653_10606 317
24 3300042606 Ga0466719_260128 Ga0466719_260128_1972_2925 317
25 3300042596 Ga0466696_014961 Ga0466696_014961_73016_73972 318
26 3300042612 Ga0466705_128515 Ga0466705_128515_2836_3792 318
27 3300042636 Ga0466703_309558 Ga0466703_309558_334_1290 318
28 3300042643 Ga0466704_186547 Ga0466704_186547_2642_3598 318
29 3300042643 Ga0466704_215432 Ga0466704_215432_3317_4273 318
30 3300042601 Ga0466707_038125 Ga0466707_038125_821_1846 319
31 3300042606 Ga0466719_047744 Ga0466719_047744_371_1387 319
32 3300042609 Ga0466722_264523 Ga0466722_264523_750_1712 320
33 3300042590 Ga0466690_121795 Ga0466690_121795_4281_5255 324
34 3300042602 Ga0466713_031124 Ga0466713_031124_538_1512 324
35 3300042615 Ga0466711_402421 Ga0466711_402421_899_1876 325
36 3300042599 Ga0466706_171967 Ga0466706_171967_854_1837 327
37 3300010882 Ga0123354_10109074 Ga0123354_101090742 329
38 3300042599 Ga0466706_185118 Ga0466706_185118_10615_11637 329
39 3300042615 Ga0466711_199572 Ga0466711_199572_1449_2438 329
40 3300005201 Ga0072941_1202284 Ga0072941_12022842 330
41 3300005201 Ga0072941_1399755 Ga0072941_13997551 330
42 3300042624 Ga0466735_141625 Ga0466735_141625_785_1777 330
43 3300009784 Ga0123357_10008182 Ga0123357_100081824 331
44 3300042601 Ga0466707_075398 Ga0466707_075398_7736_8731 331
45 3300042602 Ga0466713_139646 Ga0466713_139646_35536_36534 332
46 3300042612 Ga0466705_084572 Ga0466705_084572_40_1038 332
47 3300042621 Ga0466729_173423 Ga0466729_173423_136_1134 332
48 3300042643 Ga0466704_492009 Ga0466704_492009_1779_2798 332
49 3300042659 Ga0466733_099932 Ga0466733_099932_16357_17355 332
50 3300042602 Ga0466713_063720 Ga0466713_063720_7023_8024 333
51 3300042602 Ga0466713_151406 Ga0466713_151406_54315_55316 333
52 3300042616 Ga0466715_580927 Ga0466715_580927_6373_7374 333
53 3300042618 Ga0466723_223421 Ga0466723_223421_1170_2171 333
54 3300042620 Ga0466728_306930 Ga0466728_306930_31689_32690 333
55 3300042636 Ga0466703_276157 Ga0466703_276157_8453_9454 333
56 3300042659 Ga0466733_154603 Ga0466733_154603_6335_7336 333
57 iso_pr_bacteria 2695420317 2695484103 333
58 iso_pr_bacteria 2922326829 2922329318 333
59 iso_pr_bacteria 8100157865 8100161759 333
60 iso_pr_bacteria 8100166142 8100171103 333
61 3300005083 Ga0068305_10252525 Ga0068305_102525253 334
62 3300042591 Ga0466692_071062 Ga0466692_071062_5691_6695 334
63 3300042596 Ga0466696_073941 Ga0466696_073941_896_1900 334
64 3300042600 Ga0466700_238891 Ga0466700_238891_8126_9130 334
65 3300042601 Ga0466707_057560 Ga0466707_057560_11829_12833 334
66 iso_pr_bacteria 2910959314 2910959743 334
67 2225789004 2227180791 2227598418 335
68 2225789004 2227228888 2227664419 335
69 3300009784 Ga0123357_10106735 Ga0123357_101067352 335
70 3300042591 Ga0466692_094763 Ga0466692_094763_23461_24468 335
71 3300042599 Ga0466706_022572 Ga0466706_022572_1033_2040 335
72 3300042602 Ga0466713_127535 Ga0466713_127535_6915_7922 335
73 3300042602 Ga0466713_127978 Ga0466713_127978_226_1233 335
74 3300042605 Ga0466716_165199 Ga0466716_165199_3766_4773 335
75 3300042611 Ga0466697_139692 Ga0466697_139692_28914_29921 335
76 3300042612 Ga0466705_276615 Ga0466705_276615_941_1948 335
77 3300042643 Ga0466704_153053 Ga0466704_153053_24036_25043 335
78 iso_pr_bacteria 2820778767 2820779368 335
79 iso_pr_bacteria 2940195863 2940197219 335
80 2225789004 2227133582 2227531705 336
81 2225789004 2227480510 2227940504 336
82 3300000062 IMNBL1DRAFT_c0000216 IMNBL1DRAFT_000021640 336
83 3300042602 Ga0466713_147626 Ga0466713_147626_1967_2977 336
84 3300042619 Ga0466726_071754 Ga0466726_071754_4211_5221 336
85 3300042620 Ga0466728_459317 Ga0466728_459317_3931_4941 336
86 3300042655 Ga0466727_172428 Ga0466727_172428_7460_8470 336
87 2225789004 2227248328 2227690711 337
88 3300000062 IMNBL1DRAFT_c0001109 IMNBL1DRAFT_000110921 337
89 3300010882 Ga0123354_10018572 Ga0123354_100185722 337
90 3300042591 Ga0466692_050331 Ga0466692_050331_22745_23758 337
91 3300042599 Ga0466706_138321 Ga0466706_138321_1803_2816 337
92 3300042620 Ga0466728_064136 Ga0466728_064136_32313_33326 337
93 3300042620 Ga0466728_077153 Ga0466728_077153_17665_18678 337
94 3300042652 Ga0466708_159009 Ga0466708_159009_143_1156 337
95 iso_pr_bacteria 2695420931 2698111093 337
96 iso_pr_bacteria 2910930387 2910933026 337
97 3300000062 IMNBL1DRAFT_c0007525 IMNBL1DRAFT_00075255 338
98 3300010882 Ga0123354_10034285 Ga0123354_100342854 338
99 3300042590 Ga0466690_060743 Ga0466690_060743_6105_7121 338
100 3300042602 Ga0466713_014552 Ga0466713_014552_45_1061 338
101 3300042612 Ga0466705_209420 Ga0466705_209420_491_1507 338
102 3300042636 Ga0466703_286961 Ga0466703_286961_296_1312 338
103 3300042648 Ga0466709_024483 Ga0466709_024483_10318_11334 338
104 3300042652 Ga0466708_046422 Ga0466708_046422_673_1689 338
105 iso_pr_bacteria 3004672520 3004675255 338
106 3300010049 Ga0123356_10247759 Ga0123356_102477592 339
107 3300042591 Ga0466692_187597 Ga0466692_187597_93_1157 339
108 3300042593 Ga0466691_201737 Ga0466691_201737_3116_4135 339
109 3300042602 Ga0466713_154523 Ga0466713_154523_181_1200 339
110 3300042612 Ga0466705_033239 Ga0466705_033239_2088_3107 339
111 3300042612 Ga0466705_136696 Ga0466705_136696_1313_2332 339
112 3300042612 Ga0466705_312455 Ga0466705_312455_3748_4767 339
113 3300042612 Ga0466705_462556 Ga0466705_462556_53_1072 339
114 3300042624 Ga0466735_186740 Ga0466735_186740_635_1654 339
115 3300042643 Ga0466704_036567 Ga0466704_036567_6049_7068 339
116 iso_pr_bacteria 2820757377 2820757482 339
117 iso_pr_bacteria 2940205530 2940208569 339
118 iso_pr_bacteria 2940212447 2940215483 339
119 iso_pr_bacteria 2940298504 2940301537 339
120 iso_pr_bacteria 2940302308 2940305339 339
121 iso_pr_bacteria 2940306115 2940308857 339
122 iso_pr_bacteria 2940309933 2940312695 339
123 iso_pr_bacteria 2940313741 2940316508 339
124 iso_pr_bacteria 2940317558 2940320323 339
125 iso_pr_bacteria 2940321370 2940324079 339
126 iso_pr_bacteria 2940325180 2940328209 339
127 iso_pr_bacteria 2940328985 2940332016 339
128 iso_pr_bacteria 2940332795 2940335461 339
129 iso_pr_bacteria 3004677695 3004680038 339
130 3300002504 JGI24705J35276_12214726 JGI24705J35276_122147262 340
131 3300005083 Ga0068305_10051435 Ga0068305_100514352 340
132 3300042590 Ga0466690_254247 Ga0466690_254247_713_1735 340
133 3300042616 Ga0466715_026465 Ga0466715_026465_66832_67854 340
134 3300042620 Ga0466728_412973 Ga0466728_412973_257_1279 340
135 3300042636 Ga0466703_272549 Ga0466703_272549_1450_2472 340
136 3300042659 Ga0466733_006107 Ga0466733_006107_256_1278 340
137 iso_pr_bacteria 2609459943 2610742127 340
138 iso_pr_bacteria 2830041218 2830044248 340
139 3300000062 IMNBL1DRAFT_c0050378 IMNBL1DRAFT_00503782 341
140 3300042599 Ga0466706_197390 Ga0466706_197390_955_1980 341
141 3300042601 Ga0466707_096133 Ga0466707_096133_649_1674 341
142 3300042605 Ga0466716_177329 Ga0466716_177329_980_2005 341
143 3300042609 Ga0466722_009000 Ga0466722_009000_5220_6245 341
144 3300042616 Ga0466715_128059 Ga0466715_128059_1727_2752 341
145 iso_pr_bacteria 2873610414 2873613873 341
146 3300005083 Ga0068305_10000024 Ga0068305_1000002444 342
147 3300009784 Ga0123357_10000449 Ga0123357_100004499 342
148 3300009784 Ga0123357_10267842 Ga0123357_102678422 342
149 3300042602 Ga0466713_034002 Ga0466713_034002_16_1044 342
150 3300042598 Ga0466701_032343 Ga0466701_032343_4367_5398 343
151 3300042601 Ga0466707_352479 Ga0466707_352479_415_1446 343
152 3300042601 Ga0466707_403545 Ga0466707_403545_1332_2363 343
153 iso_pr_bacteria 2820762746 2820764616 343
154 3300002509 JGI24699J35502_11134178 JGI24699J35502_1113417833 344
155 3300042602 Ga0466713_047571 Ga0466713_047571_17419_18453 344
156 3300042643 Ga0466704_244636 Ga0466704_244636_144_1208 344
157 3300002462 JGI24702J35022_10003146 JGI24702J35022_100031465 345
158 3300010882 Ga0123354_10282229 Ga0123354_102822291 345
159 3300042624 Ga0466735_132051 Ga0466735_132051_6294_7331 345
160 iso_pr_bacteria 2967483437 2967486214 345
161 3300010882 Ga0123354_10010439 Ga0123354_100104399 347
162 3300010882 Ga0123354_10100796 Ga0123354_101007962 348
163 3300042599 Ga0466706_219848 Ga0466706_219848_15254_16300 348
164 3300042612 Ga0466705_037841 Ga0466705_037841_3551_4597 348
165 3300042616 Ga0466715_449037 Ga0466715_449037_6438_7484 348
166 3300042636 Ga0466703_431863 Ga0466703_431863_4592_5638 348
167 3300042643 Ga0466704_036083 Ga0466704_036083_1725_2771 348
168 3300009784 Ga0123357_10057723 Ga0123357_100577233 349
169 3300042593 Ga0466691_105692 Ga0466691_105692_3096_4145 349
170 3300042599 Ga0466706_166407 Ga0466706_166407_3636_4685 349
171 3300042611 Ga0466697_142743 Ga0466697_142743_224_1291 349
172 3300042619 Ga0466726_147793 Ga0466726_147793_10087_11136 349
173 3300042643 Ga0466704_116415 Ga0466704_116415_850_1899 349
174 3300042655 Ga0466727_012010 Ga0466727_012010_5270_6355 349
175 3300042655 Ga0466727_350800 Ga0466727_350800_150_1199 349
176 3300042590 Ga0466690_254053 Ga0466690_254053_1731_2783 350
177 3300010882 Ga0123354_10182539 Ga0123354_101825394 351
178 3300042599 Ga0466706_220496 Ga0466706_220496_271_1326 351
179 3300042636 Ga0466703_132815 Ga0466703_132815_328_1386 352
180 3300042601 Ga0466707_232640 Ga0466707_232640_5665_6726 353
181 3300042602 Ga0466713_085966 Ga0466713_085966_199_1260 353
182 3300042636 Ga0466703_250773 Ga0466703_250773_6196_7257 353
183 3300042613 Ga0466710_050905 Ga0466710_050905_2677_3741 354
184 3300042624 Ga0466735_085212 Ga0466735_085212_5474_6541 355
185 3300042654 Ga0466725_156612 Ga0466725_156612_782_1849 355
186 3300042648 Ga0466709_393388 Ga0466709_393388_1908_2978 356
187 3300042624 Ga0466735_041309 Ga0466735_041309_405_1481 358
188 3300042601 Ga0466707_065309 Ga0466707_065309_4220_5302 360
189 3300042616 Ga0466715_118178 Ga0466715_118178_3266_4348 360
190 3300042621 Ga0466729_207125 Ga0466729_207125_190_1275 361
191 3300042599 Ga0466706_106820 Ga0466706_106820_6083_7177 364
192 3300042601 Ga0466707_407480 Ga0466707_407480_1206_2300 364
193 3300042609 Ga0466722_197334 Ga0466722_197334_146_1240 364
194 3300042624 Ga0466735_101674 Ga0466735_101674_3423_4517 364
195 3300042612 Ga0466705_268245 Ga0466705_268245_719_1816 365
196 3300042590 Ga0466690_005231 Ga0466690_005231_9758_10864 368
197 3300010167 Ga0123353_10402252 Ga0123353_104022522 370
198 3300042615 Ga0466711_199870 Ga0466711_199870_26831_27952 373
199 3300042601 Ga0466707_073283 Ga0466707_073283_77_1201 374
200 3300042601 Ga0466707_318000 Ga0466707_318000_266_1459 374
201 3300042648 Ga0466709_263807 Ga0466709_263807_6185_7318 377

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF14684 Tricorn_C1 Tricorn protease C1 domain 72 125 0.96
PF03572 Peptidase_S41 Peptidase family S41 182 349 0.92

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.8 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.