Protein Family IF09638

Metagenome Metatranscriptome Isolate
201 Members
49 Samples
191 Scaffolds
179.02 Avg Length

🧬 Representative Sequence

ID
3300042648|Ga0466709_246533|Ga0466709_246533_12632_13258
Length
208 aa
Sequence
MLILSGLKKFTPRRIPTLNGEDEKEYGVNHRGGKIRSTTVLVVRRGGKVAMAGDGQVTMGETVMKNNARKVRRLAEGKVLCGFAGATADAFTLFDRFEEKLKEYSGDLRRSAVELAKDWRTDRALRRLEALLLAADHNATLLISGTGDVIEPEGDALAIGSGGNYAYAAALAYLEGSGFSAAEIAEKSLGIAANICIYTNGQITLEEL

📊 Sample Types

Isolate 5.0%
Metagenome 94.5%
MAG 0.0%
Metatranscriptome 0.5%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 32.6%
Kalotermitidae 30.4%
Unclassified 19.6%
Rhinotermitidae 6.5%
Termopsidae 6.5%
Hodotermitidae 2.2%
Blaberidae 2.2%

🌳 Taxonomy

Archaea 0
Bacteria 179
Eukaryota 0
Viruses 0
Unclassified 22

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
6 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
9 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
10 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
11 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
12 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
13 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
14 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
15 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
16 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
17 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
18 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
19 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
20 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
21 2772190975 Treponema sp. RmG30 Isolate Blaberidae
22 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
23 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
24 650716102 Treponema primitia ZAS-2 Isolate Unclassified
25 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
26 3300021235 Termite gut microbial communities from nest from French Guiana - FG16_2_6 mRNA SA Metatranscriptome
27 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
28 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
29 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
30 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
31 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
32 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
33 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
34 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
35 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
36 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
37 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
38 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
39 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
40 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
41 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
42 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
43 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
44 2556921622 Terasakiella pusilla DSM 6293 Isolate Unclassified
45 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
46 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
47 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
48 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
49 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_164302 3300042612 Bacteria 4883
2 Ga0466733_020925 3300042659 Bacteria 34524
3 Ga0466733_043624 3300042659 Bacteria 28843
4 Ga0466706_122265 3300042599 Bacteria 5004
5 Ga0466716_201114 3300042605 Bacteria 39030
6 Ga0466716_358101 3300042605 Bacteria 17911
7 Ga0466719_135362 3300042606 Bacteria 51759
8 Ga0466722_061542 3300042609 Bacteria 32040
9 JGI24698J34947_10025314 3300002449 Bacteria 3160
10 JGI24698J34947_10028369 3300002449 Bacteria 2964
11 JGI24698J34947_10050011 3300002449 Bacteria 2109
12 JGI24698J34947_10052022 3300002449 Bacteria 2057
13 Ga0072940_1021456 3300005200 Bacteria 20392
14 Ga0466690_055878 3300042590 Unclassified 1720
15 Ga0466694_026162 3300042594 Bacteria 6229
16 Ga0466696_134146 3300042596 Unclassified 4969
17 Ga0466712_176072 3300042614 Bacteria 26085
18 Ga0466718_000308 3300042617 Bacteria 15294
19 Ga0466703_092266 3300042636 Bacteria 37200
20 Ga0466704_049040 3300042643 Bacteria 14387
21 Ga0466704_082141 3300042643 Bacteria 21700
22 Ga0466704_273943 3300042643 Unclassified 1565
23 Ga0466704_305606 3300042643 Bacteria 29402
24 Ga0466706_148964 3300042599 Bacteria 1192
25 Ga0466707_263592 3300042601 Bacteria 2416
26 Ga0466707_366442 3300042601 Bacteria 1097
27 Ga0466719_084144 3300042606 Bacteria 12012
28 JGI24698J34947_10010002 3300002449 Bacteria 5199
29 JGI24698J34947_10023979 3300002449 Bacteria 3260
30 JGI24698J34947_10042968 3300002449 Bacteria 2319
31 JGI24698J34947_10192401 3300002449 Bacteria 806
32 JGI24695J34938_10024127 3300002450 Bacteria 2924
33 Ga0074263_113140 3300005485 Bacteria 2422
34 Ga0264413_108373 3300024493 Bacteria 5452
35 Ga0466696_377833 3300042596 Bacteria 3384
36 Ga0466699_136032 3300042597 Bacteria 1665
37 Ga0466705_472413 3300042612 Unclassified 1810
38 Ga0466712_014889 3300042614 Bacteria 58641
39 Ga0466723_140549 3300042618 Unclassified 2955
40 Ga0466723_153245 3300042618 Bacteria 3265
41 Ga0466726_212048 3300042619 Bacteria 1218
42 Ga0466726_235292 3300042619 Bacteria 1543
43 Ga0466726_337549 3300042619 Bacteria 1589
44 Ga0466726_466797 3300042619 Bacteria 2452
45 Ga0466728_280706 3300042620 Unclassified 3393
46 Ga0466703_409321 3300042636 Bacteria 56299
47 Ga0466704_093587 3300042643 Bacteria 14739
48 Ga0466704_125291 3300042643 Bacteria 4915
49 Ga0466704_148598 3300042643 Unclassified 6292
50 Ga0466709_403724 3300042648 Bacteria 7641
51 Ga0466708_010042 3300042652 Bacteria 27601
52 Ga0466708_300654 3300042652 Bacteria 30678
53 Ga0466705_054661 3300042612 Bacteria 27078
54 Ga0466705_222087 3300042612 Bacteria 4527
55 Ga0466733_103842 3300042659 Bacteria 1143
56 Ga0466716_011850 3300042605 Bacteria 1363
57 AustNasuHG_c1000040 3300000089 Bacteria 32335
58 JGI24695J34938_10000165 3300002450 Bacteria 61724
59 JGI24695J34938_10000933 3300002450 Bacteria 26685
60 JGI24695J34938_10010053 3300002450 Bacteria 5214
61 Ga0072941_1001892 3300005201 Bacteria 14106
62 Ga0072941_1006211 3300005201 Bacteria 28326
63 Ga0264413_111156 3300024493 Bacteria 3762
64 Ga0264413_118139 3300024493 Bacteria 7256
65 Ga0466691_196544 3300042593 Bacteria 22060
66 Ga0466696_086690 3300042596 Bacteria 3373
67 Ga0466696_271574 3300042596 Bacteria 3928
68 Ga0466712_021971 3300042614 Bacteria 1209
69 Ga0466718_134708 3300042617 Bacteria 11234
70 Ga0466723_036462 3300042618 Bacteria 18899
71 Ga0466703_111886 3300042636 Bacteria 19229
72 Ga0466703_372705 3300042636 Bacteria 3378
73 Ga0466705_030354 3300042612 Bacteria 9527
74 Ga0466719_214454 3300042606 Bacteria 1861
75 Ga0123356_10427459 3300010049 Bacteria 1468
76 AustNasuHG_c1000440 3300000089 Bacteria 14540
77 JGI24698J34947_10005031 3300002449 Bacteria 7243
78 JGI24698J34947_10015688 3300002449 Bacteria 4120
79 JGI24698J34947_10054010 3300002449 Bacteria 2008
80 JGI24695J34938_10004155 3300002450 Bacteria 9633
81 Ga0223674_1029558 3300021235 Bacteria 2068
82 Ga0466690_045541 3300042590 Unclassified 1530
83 Ga0466690_242095 3300042590 Bacteria 1400
84 Ga0466692_051344 3300042591 Bacteria 2445
85 Ga0466692_116356 3300042591 Bacteria 4872
86 Ga0466692_204049 3300042591 Bacteria 14250
87 Ga0466691_031910 3300042593 Bacteria 45146
88 Ga0466696_138618 3300042596 Bacteria 4277
89 Ga0466699_011532 3300042597 Unclassified 1537
90 Ga0466712_155558 3300042614 Bacteria 36572
91 Ga0466712_317085 3300042614 Unclassified 1907
92 Ga0466718_045163 3300042617 Bacteria 3037
93 Ga0466723_315269 3300042618 Unclassified 2546
94 Ga0466709_246533 3300042648 Bacteria 16446
95 Ga0466709_402278 3300042648 Bacteria 13984
96 Ga0466708_038229 3300042652 Bacteria 8156
97 Ga0466705_053793 3300042612 Bacteria 32940
98 Ga0466705_203092 3300042612 Bacteria 17319
99 Ga0466720_076003 3300042607 Bacteria 34599
100 JGI24698J34947_10005006 3300002449 Bacteria 7262
101 JGI24698J34947_10033692 3300002449 Bacteria 2685
102 JGI24698J34947_10035790 3300002449 Unclassified 2588
103 JGI24698J34947_10066903 3300002449 Unclassified 1746
104 JGI24695J34938_10001107 3300002450 Bacteria 24311
105 Ga0264413_101606 3300024493 Bacteria 1840
106 Ga0466690_138314 3300042590 Bacteria 1812
107 Ga0466693_429074 3300042592 Bacteria 2103
108 Ga0466696_044118 3300042596 Bacteria 8531
109 Ga0466696_218972 3300042596 Bacteria 19000
110 Ga0466705_467668 3300042612 Unclassified 1334
111 Ga0466712_132707 3300042614 Unclassified 2638
112 Ga0466723_007474 3300042618 Bacteria 2174
113 Ga0466723_359383 3300042618 Bacteria 7053
114 Ga0466735_018546 3300042624 Bacteria 1222
115 Ga0466735_088766 3300042624 Bacteria 2174
116 Ga0466735_190828 3300042624 Bacteria 2779
117 Ga0466703_014620 3300042636 Bacteria 11910
118 Ga0466703_041012 3300042636 Bacteria 25158
119 Ga0466708_010753 3300042652 Bacteria 16107
120 Ga0466708_038537 3300042652 Bacteria 13838
121 Ga0466727_117146 3300042655 Bacteria 4134
122 Ga0466705_127577 3300042612 Bacteria 32685
123 Ga0466705_176547 3300042612 Bacteria 2184
124 Ga0466706_051236 3300042599 Bacteria 1305
125 Ga0466716_119703 3300042605 Bacteria 6564
126 AustNasuHG_c1005488 3300000089 Bacteria 4532
127 JGI24695J34938_10000021 3300002450 Bacteria 112419
128 JGI24695J34938_10000049 3300002450 Bacteria 91446
129 JGI24695J34938_10015085 3300002450 Bacteria 3977
130 Ga0072941_1002872 3300005201 Bacteria 18952
131 Ga0466690_002538 3300042590 Bacteria 8784
132 Ga0466690_088451 3300042590 Bacteria 1784
133 Ga0466691_028375 3300042593 Bacteria 17257
134 Ga0466696_075410 3300042596 Bacteria 18499
135 Ga0466696_114663 3300042596 Bacteria 1482
136 Ga0466696_423691 3300042596 Bacteria 31979
137 Ga0466712_129146 3300042614 Bacteria 7663
138 Ga0466712_264052 3300042614 Unclassified 2029
139 Ga0466711_183178 3300042615 Bacteria 53190
140 Ga0466715_199866 3300042616 Bacteria 13252
141 Ga0466718_086776 3300042617 Bacteria 73105
142 Ga0466726_441461 3300042619 Bacteria 3626
143 Ga0466728_013152 3300042620 Bacteria 2970
144 Ga0466728_056459 3300042620 Unclassified 1926
145 Ga0466703_049531 3300042636 Bacteria 42822
146 Ga0466709_280168 3300042648 Bacteria 28407
147 Ga0466708_019469 3300042652 Bacteria 3264
148 Ga0466708_086152 3300042652 Bacteria 9560
149 Ga0466705_012075 3300042612 Bacteria 2675
150 Ga0466733_114880 3300042659 Bacteria 2057
151 Ga0466706_040800 3300042599 Bacteria 3197
152 Ga0466706_065496 3300042599 Bacteria 2207
153 Ga0466706_107786 3300042599 Bacteria 1120
154 Ga0466720_091075 3300042607 Bacteria 5243
155 JGI24698J34947_10054002 3300002449 Bacteria 2008
156 Ga0072941_1002871 3300005201 Bacteria 36049
157 Ga0072941_1091051 3300005201 Bacteria 5968
158 Ga0466694_267270 3300042594 Bacteria 1928
159 Ga0466696_015896 3300042596 Bacteria 2936
160 Ga0466715_134163 3300042616 Unclassified 1621
161 Ga0466723_013497 3300042618 Bacteria 2608
162 Ga0466726_107131 3300042619 Bacteria 1093
163 Ga0466726_127759 3300042619 Bacteria 20118
164 Ga0466728_237034 3300042620 Bacteria 9493
165 Ga0466728_321611 3300042620 Bacteria 2189
166 Ga0466702_114022 3300042635 Bacteria 6060
167 Ga0466703_007205 3300042636 Bacteria 42180
168 Ga0466703_324157 3300042636 Bacteria 1650
169 Ga0466704_128155 3300042643 Bacteria 28523
170 Ga0466706_226269 3300042599 Bacteria 1193
171 Ga0466716_093126 3300042605 Bacteria 26989
172 Ga0466719_162738 3300042606 Bacteria 5593
173 Ga0466720_073592 3300042607 Bacteria 36208
174 Ga0466720_088933 3300042607 Bacteria 8147
175 JGI24698J34947_10002431 3300002449 Bacteria 10033
176 JGI24698J34947_10076741 3300002449 Unclassified 1583
177 JGI24699J35502_11115368 3300002509 Unclassified 2912
178 Ga0466693_419846 3300042592 Bacteria 23203
179 Ga0466694_076710 3300042594 Bacteria 2625
180 Ga0466694_223729 3300042594 Unclassified 1664
181 Ga0466696_316255 3300042596 Bacteria 1769
182 Ga0466712_133685 3300042614 Bacteria 1096
183 Ga0466712_178477 3300042614 Bacteria 4664
184 Ga0466723_081328 3300042618 Bacteria 12661
185 Ga0466729_173392 3300042621 Bacteria 1124
186 Ga0466703_007440 3300042636 Bacteria 2187
187 Ga0466703_158700 3300042636 Bacteria 5828
188 Ga0466703_220845 3300042636 Bacteria 51302
189 Ga0466709_345059 3300042648 Unclassified 2208
190 Ga0466727_067983 3300042655 Bacteria 8567
191 Ga0466727_149468 3300042655 Bacteria 2545

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300024493 Ga0264413_101606 Ga0264413_1016062 168
2 3300024493 Ga0264413_108373 Ga0264413_1083735 168
3 3300024493 Ga0264413_111156 Ga0264413_1111564 168
4 3300042591 Ga0466692_204049 Ga0466692_204049_7786_8325 168
5 3300042594 Ga0466694_076710 Ga0466694_076710_889_1467 168
6 3300042594 Ga0466694_223729 Ga0466694_223729_500_1078 168
7 3300042594 Ga0466694_267270 Ga0466694_267270_161_739 168
8 3300042607 Ga0466720_088933 Ga0466720_088933_4910_5449 168
9 3300042607 Ga0466720_091075 Ga0466720_091075_1628_2167 168
10 3300042635 Ga0466702_114022 Ga0466702_114022_1856_2401 168
11 3300002450 JGI24695J34938_10010053 JGI24695J34938_100100532 169
12 3300005485 Ga0074263_113140 Ga0074263_1131402 169
13 3300042596 Ga0466696_218972 Ga0466696_218972_16585_17094 169
14 3300042597 Ga0466699_011532 Ga0466699_011532_1009_1518 169
15 3300042601 Ga0466707_263592 Ga0466707_263592_1558_2094 169
16 3300042612 Ga0466705_472413 Ga0466705_472413_1247_1756 169
17 3300042614 Ga0466712_014889 Ga0466712_014889_43613_44155 169
18 3300042614 Ga0466712_129146 Ga0466712_129146_6894_7436 169
19 3300042614 Ga0466712_132707 Ga0466712_132707_1565_2107 169
20 3300042614 Ga0466712_133685 Ga0466712_133685_23_565 169
21 3300042614 Ga0466712_264052 Ga0466712_264052_1401_1943 169
22 3300042614 Ga0466712_317085 Ga0466712_317085_1221_1763 169
23 3300042617 Ga0466718_086776 Ga0466718_086776_57222_57767 169
24 3300042652 Ga0466708_086152 Ga0466708_086152_8078_8587 169
25 3300002449 JGI24698J34947_10002431 JGI24698J34947_100024313 170
26 3300002449 JGI24698J34947_10005031 JGI24698J34947_100050317 170
27 3300002449 JGI24698J34947_10010002 JGI24698J34947_100100023 170
28 3300002449 JGI24698J34947_10015688 JGI24698J34947_100156883 170
29 3300002449 JGI24698J34947_10066903 JGI24698J34947_100669032 170
30 3300002449 JGI24698J34947_10076741 JGI24698J34947_100767412 170
31 3300002450 JGI24695J34938_10015085 JGI24695J34938_100150853 170
32 3300005201 Ga0072941_1002871 Ga0072941_100287115 170
33 3300005201 Ga0072941_1006211 Ga0072941_100621116 170
34 3300021235 Ga0223674_1029558 Ga0223674_10295582 170
35 3300024493 Ga0264413_118139 Ga0264413_1181392 170
36 3300042591 Ga0466692_116356 Ga0466692_116356_388_936 170
37 3300042597 Ga0466699_136032 Ga0466699_136032_289_831 170
38 3300042607 Ga0466720_073592 Ga0466720_073592_5000_5545 170
39 3300042607 Ga0466720_076003 Ga0466720_076003_1580_2125 170
40 3300042612 Ga0466705_203092 Ga0466705_203092_16182_16694 170
41 3300042614 Ga0466712_178477 Ga0466712_178477_1548_2099 170
42 3300042619 Ga0466726_235292 Ga0466726_235292_264_815 170
43 3300042619 Ga0466726_466797 Ga0466726_466797_331_843 170
44 3300042643 Ga0466704_148598 Ga0466704_148598_2897_3409 170
45 3300000089 AustNasuHG_c1000440 AustNasuHG_10004409 171
46 3300002449 JGI24698J34947_10005006 JGI24698J34947_100050062 171
47 3300002449 JGI24698J34947_10025314 JGI24698J34947_100253141 171
48 3300002449 JGI24698J34947_10033692 JGI24698J34947_100336922 171
49 3300005201 Ga0072941_1001892 Ga0072941_10018923 171
50 3300005201 Ga0072941_1002872 Ga0072941_100287215 171
51 3300005201 Ga0072941_1091051 Ga0072941_10910515 171
52 3300000089 AustNasuHG_c1000040 AustNasuHG_100004023 172
53 3300000089 AustNasuHG_c1005488 AustNasuHG_10054886 172
54 3300002450 JGI24695J34938_10000165 JGI24695J34938_1000016542 172
55 3300005200 Ga0072940_1021456 Ga0072940_102145620 172
56 3300042614 Ga0466712_021971 Ga0466712_021971_55_606 172
57 3300002449 JGI24698J34947_10054002 JGI24698J34947_100540023 173
58 3300002449 JGI24698J34947_10054010 JGI24698J34947_100540103 173
59 3300042590 Ga0466690_002538 Ga0466690_002538_4051_4596 173
60 3300002450 JGI24695J34938_10000021 JGI24695J34938_1000002170 174
61 3300042591 Ga0466692_051344 Ga0466692_051344_960_1520 174
62 3300002449 JGI24698J34947_10052022 JGI24698J34947_100520222 175
63 3300042593 Ga0466691_031910 Ga0466691_031910_16298_16846 177
64 3300042614 Ga0466712_176072 Ga0466712_176072_20247_20813 177
65 3300042617 Ga0466718_000308 Ga0466718_000308_4452_5024 177
66 3300042617 Ga0466718_045163 Ga0466718_045163_2448_3020 177
67 3300042617 Ga0466718_134708 Ga0466718_134708_2030_2596 177
68 3300042619 Ga0466726_212048 Ga0466726_212048_212_745 177
69 3300042612 Ga0466705_467668 Ga0466705_467668_751_1323 178
70 3300042592 Ga0466693_429074 Ga0466693_429074_915_1454 179
71 3300042596 Ga0466696_075410 Ga0466696_075410_8350_8889 179
72 3300042601 Ga0466707_366442 Ga0466707_366442_12_551 179
73 3300042612 Ga0466705_053793 Ga0466705_053793_15475_16014 179
74 3300042618 Ga0466723_007474 Ga0466723_007474_188_727 179
75 3300042619 Ga0466726_441461 Ga0466726_441461_663_1202 179
76 3300042636 Ga0466703_041012 Ga0466703_041012_8292_8831 179
77 3300042643 Ga0466704_082141 Ga0466704_082141_3652_4191 179
78 3300042659 Ga0466733_043624 Ga0466733_043624_15433_15972 179
79 3300042659 Ga0466733_114880 Ga0466733_114880_942_1481 179
80 iso_pr_bacteria 2819992462 2819993392 179
81 3300002450 JGI24695J34938_10000049 JGI24695J34938_1000004922 180
82 3300002450 JGI24695J34938_10001107 JGI24695J34938_100011076 180
83 3300042590 Ga0466690_045541 Ga0466690_045541_912_1454 180
84 3300042593 Ga0466691_196544 Ga0466691_196544_1854_2435 180
85 3300042596 Ga0466696_086690 Ga0466696_086690_1495_2037 180
86 3300042596 Ga0466696_114663 Ga0466696_114663_758_1300 180
87 3300042596 Ga0466696_377833 Ga0466696_377833_929_1471 180
88 3300042599 Ga0466706_051236 Ga0466706_051236_749_1291 180
89 3300042599 Ga0466706_107786 Ga0466706_107786_204_746 180
90 3300042599 Ga0466706_122265 Ga0466706_122265_1669_2211 180
91 3300042599 Ga0466706_148964 Ga0466706_148964_152_694 180
92 3300042599 Ga0466706_226269 Ga0466706_226269_178_720 180
93 3300042605 Ga0466716_093126 Ga0466716_093126_14383_14955 180
94 3300042606 Ga0466719_214454 Ga0466719_214454_357_899 180
95 3300042612 Ga0466705_054661 Ga0466705_054661_19294_19836 180
96 3300042612 Ga0466705_164302 Ga0466705_164302_1759_2340 180
97 3300042618 Ga0466723_013497 Ga0466723_013497_922_1464 180
98 3300042618 Ga0466723_140549 Ga0466723_140549_1771_2343 180
99 3300042618 Ga0466723_315269 Ga0466723_315269_721_1263 180
100 3300042619 Ga0466726_127759 Ga0466726_127759_18880_19422 180
101 3300042620 Ga0466728_237034 Ga0466728_237034_8641_9183 180
102 3300042620 Ga0466728_280706 Ga0466728_280706_2226_2768 180
103 3300042620 Ga0466728_321611 Ga0466728_321611_1022_1564 180
104 3300042624 Ga0466735_018546 Ga0466735_018546_340_882 180
105 3300042636 Ga0466703_007205 Ga0466703_007205_8651_9193 180
106 3300042643 Ga0466704_128155 Ga0466704_128155_18930_19472 180
107 3300042643 Ga0466704_305606 Ga0466704_305606_19658_20200 180
108 3300042648 Ga0466709_280168 Ga0466709_280168_18624_19166 180
109 3300042648 Ga0466709_345059 Ga0466709_345059_780_1352 180
110 3300042655 Ga0466727_117146 Ga0466727_117146_516_1058 180
111 3300042655 Ga0466727_149468 Ga0466727_149468_400_942 180
112 3300002449 JGI24698J34947_10192401 JGI24698J34947_101924011 181
113 3300002450 JGI24695J34938_10004155 JGI24695J34938_100041553 181
114 3300042596 Ga0466696_044118 Ga0466696_044118_6219_6764 181
115 3300042596 Ga0466696_316255 Ga0466696_316255_937_1482 181
116 3300042605 Ga0466716_011850 Ga0466716_011850_372_917 181
117 3300042606 Ga0466719_162738 Ga0466719_162738_112_657 181
118 3300042618 Ga0466723_153245 Ga0466723_153245_1435_1980 181
119 3300042619 Ga0466726_337549 Ga0466726_337549_314_859 181
120 3300042620 Ga0466728_013152 Ga0466728_013152_1800_2345 181
121 3300042624 Ga0466735_088766 Ga0466735_088766_187_732 181
122 3300042643 Ga0466704_049040 Ga0466704_049040_12920_13465 181
123 3300042643 Ga0466704_093587 Ga0466704_093587_13272_13817 181
124 3300042648 Ga0466709_403724 Ga0466709_403724_4522_5067 181
125 3300042659 Ga0466733_020925 Ga0466733_020925_15846_16391 181
126 3300042659 Ga0466733_103842 Ga0466733_103842_410_955 181
127 iso_pr_bacteria 2781125629 2781263971 181
128 iso_pr_bacteria 2781125689 2781425013 181
129 iso_pr_bacteria 2819992462 2819994639 181
130 iso_pr_bacteria 2820020240 2820020270 181
131 3300002449 JGI24698J34947_10023979 JGI24698J34947_100239793 182
132 3300002449 JGI24698J34947_10028369 JGI24698J34947_100283692 182
133 3300002449 JGI24698J34947_10035790 JGI24698J34947_100357902 182
134 3300002449 JGI24698J34947_10042968 JGI24698J34947_100429683 182
135 3300002449 JGI24698J34947_10050011 JGI24698J34947_100500111 182
136 3300002509 JGI24699J35502_11115368 JGI24699J35502_111153682 182
137 3300042590 Ga0466690_055878 Ga0466690_055878_544_1092 182
138 3300042590 Ga0466690_088451 Ga0466690_088451_1045_1593 182
139 3300042590 Ga0466690_138314 Ga0466690_138314_27_575 182
140 3300042594 Ga0466694_026162 Ga0466694_026162_5152_5700 182
141 3300042596 Ga0466696_015896 Ga0466696_015896_1861_2409 182
142 3300042596 Ga0466696_134146 Ga0466696_134146_3279_3827 182
143 3300042605 Ga0466716_201114 Ga0466716_201114_30202_30750 182
144 3300042606 Ga0466719_084144 Ga0466719_084144_1685_2233 182
145 3300042612 Ga0466705_012075 Ga0466705_012075_580_1128 182
146 3300042612 Ga0466705_030354 Ga0466705_030354_5377_5925 182
147 3300042612 Ga0466705_176547 Ga0466705_176547_1057_1605 182
148 3300042616 Ga0466715_134163 Ga0466715_134163_1049_1597 182
149 3300042616 Ga0466715_199866 Ga0466715_199866_7555_8103 182
150 3300042618 Ga0466723_081328 Ga0466723_081328_1834_2382 182
151 3300042624 Ga0466735_190828 Ga0466735_190828_1657_2205 182
152 3300042636 Ga0466703_014620 Ga0466703_014620_6954_7526 182
153 3300042636 Ga0466703_158700 Ga0466703_158700_3801_4349 182
154 3300042636 Ga0466703_409321 Ga0466703_409321_8102_8650 182
155 3300042643 Ga0466704_273943 Ga0466704_273943_98_646 182
156 3300042652 Ga0466708_019469 Ga0466708_019469_163_711 182
157 3300042652 Ga0466708_300654 Ga0466708_300654_1253_1828 182
158 3300042655 Ga0466727_067983 Ga0466727_067983_7742_8290 182
159 iso_pr_bacteria 2781125647 2781303345 182
160 3300002450 JGI24695J34938_10000933 JGI24695J34938_100009333 183
161 3300002450 JGI24695J34938_10024127 JGI24695J34938_100241273 183
162 3300042596 Ga0466696_423691 Ga0466696_423691_11891_12442 183
163 3300042599 Ga0466706_040800 Ga0466706_040800_2193_2744 183
164 3300042605 Ga0466716_119703 Ga0466716_119703_2052_2603 183
165 3300042612 Ga0466705_127577 Ga0466705_127577_18611_19183 183
166 3300042615 Ga0466711_183178 Ga0466711_183178_42885_43436 183
167 3300042621 Ga0466729_173392 Ga0466729_173392_303_854 183
168 3300042652 Ga0466708_010753 Ga0466708_010753_5819_6370 183
169 iso_pr_bacteria 2556921622 2558099552 183
170 iso_pr_bacteria 2772190975 2773723711 183
171 3300042618 Ga0466723_036462 Ga0466723_036462_5171_5725 184
172 3300042652 Ga0466708_038537 Ga0466708_038537_10178_10735 185
173 3300042592 Ga0466693_419846 Ga0466693_419846_11965_12525 186
174 3300042618 Ga0466723_359383 Ga0466723_359383_4621_5181 186
175 iso_pr_bacteria 2781125644 2781295184 186
176 3300042599 Ga0466706_065496 Ga0466706_065496_1159_1722 187
177 3300042593 Ga0466691_028375 Ga0466691_028375_1860_2426 188
178 3300042605 Ga0466716_358101 Ga0466716_358101_14626_15192 188
179 3300042636 Ga0466703_049531 Ga0466703_049531_17970_18536 188
180 3300042652 Ga0466708_010042 Ga0466708_010042_21308_21874 188
181 3300042596 Ga0466696_138618 Ga0466696_138618_1242_1811 189
182 3300042596 Ga0466696_271574 Ga0466696_271574_1261_1830 189
183 3300042606 Ga0466719_135362 Ga0466719_135362_15248_15817 189
184 3300042614 Ga0466712_155558 Ga0466712_155558_10181_10783 189
185 3300042636 Ga0466703_007440 Ga0466703_007440_468_1037 189
186 3300042636 Ga0466703_220845 Ga0466703_220845_20458_21027 189
187 3300042636 Ga0466703_372705 Ga0466703_372705_1418_1987 189
188 3300042643 Ga0466704_125291 Ga0466704_125291_854_1423 189
189 3300042590 Ga0466690_242095 Ga0466690_242095_16_588 190
190 iso_pr_bacteria 650716102 650882220 190
191 3300042652 Ga0466708_038229 Ga0466708_038229_4451_5029 192
192 3300042620 Ga0466728_056459 Ga0466728_056459_701_1282 193
193 3300042636 Ga0466703_111886 Ga0466703_111886_12041_12622 193
194 3300042636 Ga0466703_324157 Ga0466703_324157_786_1367 193
195 3300042648 Ga0466709_402278 Ga0466709_402278_4016_4597 193
196 3300010049 Ga0123356_10427459 Ga0123356_104274592 195
197 3300042619 Ga0466726_107131 Ga0466726_107131_233_823 196
198 3300042612 Ga0466705_222087 Ga0466705_222087_2455_3051 198
199 3300042636 Ga0466703_092266 Ga0466703_092266_18020_18616 198
200 3300042609 Ga0466722_061542 Ga0466722_061542_17618_18229 203
201 3300042648 Ga0466709_246533 Ga0466709_246533_12632_13258 208

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00227 Proteasome Proteasome subunit 37 206 0.96

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.78 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.