Protein Family IF09630

Metagenome Isolate
131 Members
75 Samples
115 Scaffolds
301.64 Avg Length

🧬 Representative Sequence

ID
3300042648|Ga0466709_221860|Ga0466709_221860_232212_233249
Length
345 aa
Sequence
MICPPYLKSGDSVAIVAPARKIALSEISQSIEILQSWGLKVIFSKNLFESYDQFAGTDMQRADDFQEAINNPEIKAIFCARGGYGSVRIIDQIDFSPLLSSPKWIIGFSDITVFHSKLNTLGIESLHAPVLTTLSDAPPETLIKIKNTLFGEALQYNIQLNKANSLNIDGECTGELIGGNLSILYSLLGSNCDIDFRNKILFIEDLDEYFYHIDRIMTALKRAGKLSELNGLIVGDIAKMNDNSIPFGKTAEEIIHDIVGEYNYPVCFNFPAGHIPNNNPLILGRNISLTINKTNINIDFFTKTTDKAIPNSKKRIIKLSLVLLAFFVMIWVVYKIASHFILKMF

📊 Sample Types

Isolate 11.4%
Metagenome 88.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 35.7%
Unclassified 15.7%
Kalotermitidae 11.4%
Formicidae 10.0%
Armadillidiidae 7.1%
Culicidae 5.7%
Drosophilidae 4.3%
Rhinotermitidae 2.9%
Elmidae 2.9%
Tenebrionidae 1.4%
Hydrophilidae 1.4%
Daphniidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 127
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
2 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
3 2899132286 Myroides albus BIT-d1 Isolate Tenebrionidae
4 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
5 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
6 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
7 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
8 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
9 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
10 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
11 2820765201 Unclassified Bacteroidetes Lab288P3bin82 Isolate Unclassified
12 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
13 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
14 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
15 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
16 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
17 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
18 2820744581 Unclassified Bacteroidetes Th196P3bin138 Isolate Unclassified
19 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
20 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
21 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
22 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
23 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
24 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
25 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
26 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
27 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
28 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
29 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
30 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
31 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
32 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
33 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
34 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
35 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
36 2811995047 Flavobacterium succinicans DD5b Isolate Daphniidae
37 2820751898 Unclassified Bacteroidetes Nc150P4bin22 Isolate Unclassified
38 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
39 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
40 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
41 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
42 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
43 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
44 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
45 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
46 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
47 2820753519 Unclassified Bacteroidetes Nc150P4bin20 Isolate Unclassified
48 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
49 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
50 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
51 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
52 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
53 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
54 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
55 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
56 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
57 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
58 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
59 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
60 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
61 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
62 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
63 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
64 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
65 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
66 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
67 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
68 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
69 2718218155 Flavobacteriaceae bacterium UJ101 Isolate
70 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
71 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
72 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
73 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
74 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
75 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123353_10114930 3300010167 Bacteria 4332
2 Ga0123354_10125073 3300010882 Unclassified 3290
3 Ga0466717_127900 3300042604 Bacteria 2039
4 Ga0466722_034024 3300042609 Bacteria 12789
5 JGI24702J35022_10142347 3300002462 Bacteria 1339
6 Ga0103268_1001254 3300007192 Bacteria 6446
7 Ga0160453_100567 3300012814 Bacteria 25698
8 Ga0466699_358114 3300042597 Bacteria 1240
9 Ga0466731_352681 3300042622 Bacteria 2639
10 Ga0466724_26560 3300042649 Bacteria 2134
11 Ga0466697_243917 3300042611 Bacteria 1216
12 Ga0466697_258576 3300042611 Bacteria 357278
13 Ga0123354_10006986 3300010882 Bacteria 16875
14 Ga0466701_045240 3300042598 Bacteria 5701
15 Ga0466713_116444 3300042602 Bacteria 17088
16 Ga0103265_1000910 3300007068 Bacteria 4908
17 Ga0160453_100069 3300012814 Bacteria 106591
18 Ga0466696_181092 3300042596 Bacteria 12612
19 Ga0466712_128732 3300042614 Bacteria 1559
20 Ga0123356_10209660 3300010049 Bacteria 1996
21 Ga0123353_10001252 3300010167 Bacteria 31127
22 Ga0123353_10049243 3300010167 Bacteria 6712
23 Ga0466714_046827 3300042603 Bacteria 1435
24 JGI24695J34938_10002006 3300002450 Bacteria 16153
25 JGI24696J40584_12938526 3300002834 Bacteria 1630
26 JGI24696J40584_12939423 3300002834 Bacteria 1652
27 Ga0068305_10008280 3300005083 Bacteria 10270
28 Ga0104045_1005232 3300007085 Bacteria 3519
29 Ga0104045_1005795 3300007085 Bacteria 5205
30 Ga0104019_1001755 3300007150 Unclassified 3168
31 Ga0103267_1001206 3300007190 Bacteria 10576
32 Ga0123357_10000477 3300009784 Bacteria 39043
33 Ga0160441_100011 3300012825 Bacteria 461375
34 Ga0160457_1000756 3300012858 Bacteria 11831
35 Ga0466696_093422 3300042596 Bacteria 5957
36 Ga0466696_256305 3300042596 Bacteria 7114
37 Ga0466697_264169 3300042611 Bacteria 2683
38 Ga0466732_196603 3300042656 Bacteria 1490
39 Ga0123353_10101616 3300010167 Bacteria 4635
40 Ga0466701_100585 3300042598 Bacteria 25075
41 Ga0160467_100018 3300012829 Bacteria 326466
42 Ga0160443_100303 3300012848 Bacteria 46301
43 Ga0160434_100104 3300012850 Bacteria 50591
44 Ga0160457_1000010 3300012858 Bacteria 500717
45 Ga0466657_159267 3300042582 Bacteria 2904
46 Ga0466657_337380 3300042582 Bacteria 20451
47 Ga0466694_043555 3300042594 Bacteria 12509
48 Ga0466710_413891 3300042613 Bacteria 2500
49 Ga0466715_461705 3300042616 Bacteria 25922
50 Ga0466697_092635 3300042611 Bacteria 1882
51 Ga0123353_10298052 3300010167 Bacteria 2463
52 Ga0123354_10170314 3300010882 Bacteria 2538
53 Ga0123354_10333306 3300010882 Unclassified 1379
54 Ga0466701_053978 3300042598 Bacteria 47344
55 Ga0466701_077120 3300042598 Bacteria 3536
56 Ga0466714_131070 3300042603 Bacteria 8259
57 Ga0466697_023069 3300042611 Bacteria 3490
58 Ga0103268_1001071 3300007192 Bacteria 7245
59 Ga0160472_102003 3300012839 Bacteria 5024
60 Ga0466690_041700 3300042590 Bacteria 2711
61 Ga0466695_062912 3300042595 Bacteria 1765
62 Ga0466696_376346 3300042596 Bacteria 14636
63 Ga0466705_450960 3300042612 Bacteria 4184
64 Ga0466723_192552 3300042618 Bacteria 7965
65 Ga0466728_379967 3300042620 Bacteria 2251
66 Ga0466733_148985 3300042659 Bacteria 20037
67 Ga0123356_10014952 3300010049 Bacteria 7446
68 Ga0466701_074746 3300042598 Bacteria 3242
69 Ga0466713_147564 3300042602 Bacteria 35409
70 Ga0466720_001946 3300042607 Bacteria 5181
71 JGI24702J35022_10011405 3300002462 Bacteria 4952
72 JGI24702J35022_10029611 3300002462 Bacteria 2938
73 Ga0160433_100067 3300012846 Bacteria 112579
74 Ga0160447_100011 3300012849 Bacteria 463863
75 Ga0466710_053565 3300042613 Bacteria 3063
76 Ga0466710_074540 3300042613 Bacteria 5531
77 Ga0466704_502860 3300042643 Bacteria 19936
78 Ga0466725_061088 3300042654 Bacteria 1343
79 Ga0466733_074247 3300042659 Bacteria 8839
80 Ga0123353_10336372 3300010167 Bacteria 2283
81 Ga0160465_100028 3300012803 Bacteria 208271
82 Ga0466717_068364 3300042604 Bacteria 3709
83 JGI24696J40584_12959518 3300002834 Bacteria 5235
84 Ga0102740_1001379 3300007140 Bacteria 6202
85 Ga0102737_1000047 3300007142 Bacteria 35246
86 Ga0104019_1003246 3300007150 Bacteria 6264
87 Ga0103267_1000174 3300007190 Bacteria 32636
88 Ga0103267_1002548 3300007190 Bacteria 4681
89 Ga0160455_100119 3300012837 Bacteria 109702
90 Ga0160460_100018 3300012845 Bacteria 384310
91 Ga0466693_119031 3300042592 Bacteria 1234
92 Ga0466694_147748 3300042594 Unclassified 5647
93 Ga0466694_166089 3300042594 Bacteria 1224
94 Ga0466699_233882 3300042597 Bacteria 1330
95 Ga0466710_028580 3300042613 Bacteria 1596
96 Ga0466731_355246 3300042622 Bacteria 5575
97 Ga0466731_412590 3300042622 Bacteria 3561
98 Ga0466709_221860 3300042648 Bacteria 264751
99 Ga0123356_10014819 3300010049 Bacteria 7487
100 Ga0160464_100256 3300012805 Bacteria 49696
101 Ga0466701_086669 3300042598 Bacteria 16776
102 Ga0466713_096332 3300042602 Bacteria 24639
103 Ga0466720_052584 3300042607 Bacteria 2970
104 JGI24702J35022_10048355 3300002462 Bacteria 2264
105 JGI24696J40584_12951268 3300002834 Bacteria 2227
106 Ga0068305_10662144 3300005083 Bacteria 3016
107 Ga0102735_1000010 3300007080 Bacteria 108713
108 Ga0102739_1000003 3300007095 Bacteria 77722
109 Ga0104048_1000483 3300007143 Bacteria 5100
110 Ga0160433_100066 3300012846 Bacteria 116006
111 Ga0466710_244864 3300042613 Bacteria 10078
112 Ga0466710_278710 3300042613 Bacteria 16262
113 Ga0466718_134197 3300042617 Bacteria 3024
114 Ga0466729_264434 3300042621 Bacteria 4331
115 Ga0466724_23916 3300042649 Bacteria 557842

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042596 Ga0466696_256305 Ga0466696_256305_3959_4786 275
2 3300007085 Ga0104045_1005232 Ga0104045_10052321 288
3 3300042602 Ga0466713_147564 Ga0466713_147564_10320_11192 290
4 3300042596 Ga0466696_376346 Ga0466696_376346_5646_6527 293
5 3300042604 Ga0466717_127900 Ga0466717_127900_646_1527 293
6 iso_pr_bacteria 2820744581 2820744696 293
7 iso_pr_bacteria 2820765201 2820766598 293
8 3300002462 JGI24702J35022_10029611 JGI24702J35022_100296113 294
9 3300010167 Ga0123353_10114930 Ga0123353_101149304 294
10 3300010882 Ga0123354_10125073 Ga0123354_101250732 294
11 3300042594 Ga0466694_166089 Ga0466694_166089_72_956 294
12 3300042597 Ga0466699_233882 Ga0466699_233882_211_1095 294
13 3300042611 Ga0466697_243917 Ga0466697_243917_240_1124 294
14 3300002834 JGI24696J40584_12951268 JGI24696J40584_129512681 295
15 3300042598 Ga0466701_077120 Ga0466701_077120_764_1651 295
16 3300042596 Ga0466696_093422 Ga0466696_093422_2453_3343 296
17 3300042596 Ga0466696_181092 Ga0466696_181092_7635_8525 296
18 3300042602 Ga0466713_116444 Ga0466713_116444_8120_9010 296
19 iso_pr_bacteria 2820751898 2820752896 296
20 iso_pr_bacteria 2820776227 2820776570 296
21 3300009784 Ga0123357_10000477 Ga0123357_1000047723 297
22 3300012848 Ga0160443_100303 Ga0160443_10030334 297
23 3300042603 Ga0466714_046827 Ga0466714_046827_432_1325 297
24 3300010167 Ga0123353_10336372 Ga0123353_103363722 298
25 3300042598 Ga0466701_053978 Ga0466701_053978_29842_30738 298
26 3300042598 Ga0466701_053978 Ga0466701_053978_310_1206 298
27 3300042607 Ga0466720_052584 Ga0466720_052584_725_1621 298
28 3300042613 Ga0466710_413891 Ga0466710_413891_421_1317 298
29 3300042621 Ga0466729_264434 Ga0466729_264434_2561_3457 298
30 3300042622 Ga0466731_352681 Ga0466731_352681_1186_2082 298
31 3300042649 Ga0466724_23916 Ga0466724_23916_530475_531371 298
32 3300042654 Ga0466725_061088 Ga0466725_061088_189_1085 298
33 3300007085 Ga0104045_1005795 Ga0104045_10057955 299
34 3300007150 Ga0104019_1001755 Ga0104019_10017553 299
35 3300007150 Ga0104019_1003246 Ga0104019_10032462 299
36 3300012837 Ga0160455_100119 Ga0160455_10011954 299
37 3300012846 Ga0160433_100067 Ga0160433_10006754 299
38 3300012858 Ga0160457_1000010 Ga0160457_1000010237 299
39 3300042582 Ga0466657_159267 Ga0466657_159267_849_1748 299
40 3300042594 Ga0466694_043555 Ga0466694_043555_2262_3161 299
41 3300042594 Ga0466694_147748 Ga0466694_147748_3224_4123 299
42 3300042595 Ga0466695_062912 Ga0466695_062912_482_1381 299
43 3300042604 Ga0466717_068364 Ga0466717_068364_2040_2939 299
44 3300042611 Ga0466697_023069 Ga0466697_023069_372_1271 299
45 3300042611 Ga0466697_264169 Ga0466697_264169_1668_2567 299
46 3300042612 Ga0466705_450960 Ga0466705_450960_2281_3180 299
47 3300042613 Ga0466710_053565 Ga0466710_053565_765_1664 299
48 3300042617 Ga0466718_134197 Ga0466718_134197_1985_2884 299
49 3300042622 Ga0466731_412590 Ga0466731_412590_1452_2351 299
50 3300042643 Ga0466704_502860 Ga0466704_502860_4413_5312 299
51 iso_pr_bacteria 2820753519 2820753905 299
52 iso_pr_bacteria 2820755292 2820755519 299
53 iso_pr_bacteria 2820792843 2820793060 299
54 iso_pr_bacteria 2820795054 2820796065 299
55 iso_pr_bacteria 2820797595 2820797960 299
56 3300002450 JGI24695J34938_10002006 JGI24695J34938_100020067 300
57 3300010049 Ga0123356_10014952 Ga0123356_100149526 300
58 3300010049 Ga0123356_10209660 Ga0123356_102096602 300
59 3300010167 Ga0123353_10049243 Ga0123353_100492434 300
60 3300010167 Ga0123353_10298052 Ga0123353_102980522 300
61 3300010882 Ga0123354_10006986 Ga0123354_100069866 300
62 3300010882 Ga0123354_10170314 Ga0123354_101703143 300
63 3300012803 Ga0160465_100028 Ga0160465_10002855 300
64 3300012805 Ga0160464_100256 Ga0160464_10025633 300
65 3300012839 Ga0160472_102003 Ga0160472_1020032 300
66 3300012845 Ga0160460_100018 Ga0160460_100018287 300
67 3300012849 Ga0160447_100011 Ga0160447_100011362 300
68 3300012850 Ga0160434_100104 Ga0160434_10010410 300
69 3300012858 Ga0160457_1000756 Ga0160457_10007563 300
70 3300042598 Ga0466701_074746 Ga0466701_074746_1293_2195 300
71 3300042613 Ga0466710_028580 Ga0466710_028580_392_1294 300
72 3300042620 Ga0466728_379967 Ga0466728_379967_1311_2213 300
73 3300042622 Ga0466731_355246 Ga0466731_355246_577_1479 300
74 3300042649 Ga0466724_26560 Ga0466724_26560_40_942 300
75 iso_pr_bacteria 2718218155 2720329327 300
76 3300002462 JGI24702J35022_10048355 JGI24702J35022_100483551 301
77 3300002462 JGI24702J35022_10142347 JGI24702J35022_101423472 301
78 3300002834 JGI24696J40584_12938526 JGI24696J40584_129385262 301
79 3300002834 JGI24696J40584_12939423 JGI24696J40584_129394232 301
80 3300007143 Ga0104048_1000483 Ga0104048_10004834 301
81 3300010049 Ga0123356_10014819 Ga0123356_100148195 301
82 3300042582 Ga0466657_337380 Ga0466657_337380_8863_9768 301
83 3300042590 Ga0466690_041700 Ga0466690_041700_557_1462 301
84 3300042592 Ga0466693_119031 Ga0466693_119031_307_1212 301
85 3300042598 Ga0466701_045240 Ga0466701_045240_3825_4730 301
86 3300042598 Ga0466701_100585 Ga0466701_100585_6579_7484 301
87 3300042602 Ga0466713_096332 Ga0466713_096332_10360_11265 301
88 3300042611 Ga0466697_258576 Ga0466697_258576_346702_347607 301
89 3300042613 Ga0466710_074540 Ga0466710_074540_1804_2709 301
90 3300042613 Ga0466710_244864 Ga0466710_244864_5545_6450 301
91 3300042613 Ga0466710_278710 Ga0466710_278710_3898_4803 301
92 3300042614 Ga0466712_128732 Ga0466712_128732_450_1355 301
93 3300042616 Ga0466715_461705 Ga0466715_461705_5497_6402 301
94 3300042618 Ga0466723_192552 Ga0466723_192552_1482_2387 301
95 3300042656 Ga0466732_196603 Ga0466732_196603_408_1313 301
96 3300005083 Ga0068305_10008280 Ga0068305_100082809 302
97 3300010167 Ga0123353_10101616 Ga0123353_101016163 302
98 3300010882 Ga0123354_10333306 Ga0123354_103333061 302
99 3300012825 Ga0160441_100011 Ga0160441_100011251 302
100 3300042598 Ga0466701_086669 Ga0466701_086669_3905_4813 302
101 3300042607 Ga0466720_001946 Ga0466720_001946_4132_5040 302
102 3300042659 Ga0466733_148985 Ga0466733_148985_15246_16154 302
103 3300007190 Ga0103267_1000174 Ga0103267_100017417 303
104 3300007192 Ga0103268_1001071 Ga0103268_10010715 303
105 3300042609 Ga0466722_034024 Ga0466722_034024_8544_9455 303
106 3300042611 Ga0466697_092635 Ga0466697_092635_533_1444 303
107 iso_pr_bacteria 2899132286 2899135193 303
108 3300002834 JGI24696J40584_12959518 JGI24696J40584_129595182 304
109 3300005083 Ga0068305_10662144 Ga0068305_106621445 304
110 3300007068 Ga0103265_1000910 Ga0103265_10009103 304
111 3300007080 Ga0102735_1000010 Ga0102735_100001054 304
112 3300007142 Ga0102737_1000047 Ga0102737_100004718 304
113 3300007190 Ga0103267_1002548 Ga0103267_10025482 304
114 3300010167 Ga0123353_10001252 Ga0123353_100012527 304
115 3300007095 Ga0102739_1000003 Ga0102739_100000330 305
116 3300007190 Ga0103267_1001206 Ga0103267_100120610 305
117 3300012829 Ga0160467_100018 Ga0160467_100018223 305
118 3300042603 Ga0466714_131070 Ga0466714_131070_1591_2508 305
119 3300002462 JGI24702J35022_10011405 JGI24702J35022_100114056 306
120 3300042659 Ga0466733_074247 Ga0466733_074247_4794_5714 306
121 3300007140 Ga0102740_1001379 Ga0102740_10013797 307
122 3300007192 Ga0103268_1001254 Ga0103268_10012542 307
123 iso_pr_bacteria 2873776654 2873778585 307
124 3300012846 Ga0160433_100066 Ga0160433_10006625 308
125 3300042597 Ga0466699_358114 Ga0466699_358114_154_1080 308
126 3300012814 Ga0160453_100567 Ga0160453_10056716 340
127 3300012814 Ga0160453_100069 Ga0160453_10006914 342
128 iso_pr_bacteria 2811995047 2812947257 343
129 3300042648 Ga0466709_221860 Ga0466709_221860_232212_233249 345
130 iso_pr_bacteria 2864878056 2864878747 345
131 iso_pr_bacteria 2864886855 2864887568 345

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain 13 128 0.96
PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain 173 289 0.93

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
6uuk-assembly1.cif.gz_A Crystal structure of muramoyltetrapeptide carboxypeptidase from Oxalobacter formigenes 0.914 13 300
6uuk-assembly1.cif.gz_B Crystal structure of muramoyltetrapeptide carboxypeptidase from Oxalobacter formigenes 0.898 12 300
3t5m-assembly1.cif.gz_B Crystal structure of the S112A mutant of mycrocine immunity protein (MccF) with AMP 0.88 1 298
3sr3-assembly1.cif.gz_B Crystal structure of the w180a mutant of microcin immunity protein mccf from Bacillus anthracis shows the active site loop in the open conformation. 0.878 4 303
5z01-assembly1.cif.gz_A-2 Native Escherichia coli L,D-carboxypeptidase A (LdcA) 0.876 11 301
IDDescriptionScoreStartEndSuperfamily
af_P76008_161_291_3.50.30.60 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;LD-carboxypeptidase A C-terminal domain-like 0.918 167 293 3.50.30.60
4mjxB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain 0.9155 1 148 3.40.50.10740
4h1hB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain 0.8763 2 149 3.40.50.10740
1zrsA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain 0.8584 4 149 3.40.50.10740
5f5xB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Murein tetrapeptidase LD-carboxypeptidase, N-terminal domain 0.8524 2 150 3.40.50.10740
IDDescriptionScoreStartEndGO Terms
AF-A0A7W1FZZ0-F1-model_v4 Uncharacterized/unreviewed 0.988 1 300
AF-A0A328YG71-F1-model_v4 Uncharacterized/unreviewed 0.9864 1 301 GO:0004180
GO:0008236
GO:0006508

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.