Protein Family IF09628

Metagenome Isolate
121 Members
39 Samples
118 Scaffolds
384.52 Avg Length

🧬 Representative Sequence

ID
3300042648|Ga0466709_220714|Ga0466709_220714_4227_5363
Length
378 aa
Sequence
MQYVTYGKTGLKVSRLGLGCMRLPSYEKDGKTIFDEEKSISLIHRAMDLGVNYFDTAPGYCDTLSEIIVGKALKGGRREKIFLSTKNPIENDSGDDYEKRLEKSLKKLDTGYIDFYHFWGITLDTFVHKINVPDGPLSRAKKLKAQGVIRHISFSFHDTPGNMAEIVRRGEGEFSSLLCQYNLLDRSNARDIDFAYGEGLGIAVMGPVGGGRLGAPTKVIQDLLPGKVHSSAEVALRYVFSNPHIHIALSGMSSIEQLEENAAIVDNTAPLSPVEQERILAMMKENERLAGLYCTGCKYCMPCPQGLNIPELFTLMNYHRVYQITEFAQKTYAQIGKVPWMMYENAAACVECGVCEDKCPQKLPIRKQLKETHKTLAV

📊 Sample Types

Isolate 2.5%
Metagenome 97.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 36.8%
Termitidae 34.2%
Unclassified 10.5%
Rhinotermitidae 7.9%
Termopsidae 7.9%
Hodotermitidae 2.6%

🌳 Taxonomy

Archaea 1
Bacteria 107
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
2 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
3 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
4 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
5 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
6 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
7 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
8 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
9 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
10 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
11 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
12 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
13 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
14 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
15 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
16 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
17 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
18 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
19 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
20 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
21 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
22 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
23 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
24 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
25 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
26 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
27 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
28 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
29 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
30 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
31 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
32 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
33 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
34 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
35 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
36 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
37 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
38 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
39 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466694_122253 3300042594 Bacteria 2939
2 Ga0466699_230182 3300042597 Bacteria 6399
3 Ga0466699_233055 3300042597 Bacteria 20555
4 Ga0466699_439168 3300042597 Unclassified 4727
5 Ga0466719_061882 3300042606 Unclassified 5265
6 Ga0466698_363232 3300042610 Bacteria 1563
7 Ga0466704_079313 3300042643 Unclassified 11972
8 Ga0466704_225677 3300042643 Bacteria 2320
9 Ga0466708_220002 3300042652 Bacteria 3896
10 JGI24698J34947_10001268 3300002449 Bacteria 13219
11 JGI24702J35022_10002110 3300002462 Bacteria 12275
12 Ga0466694_149503 3300042594 Bacteria 3151
13 Ga0466696_348440 3300042596 Bacteria 5431
14 Ga0466699_342016 3300042597 Bacteria 7753
15 Ga0466712_028599 3300042614 Bacteria 26608
16 Ga0466712_109596 3300042614 Bacteria 15349
17 Ga0466718_098669 3300042617 Bacteria 1539
18 Ga0466716_085974 3300042605 Bacteria 7895
19 Ga0466709_223564 3300042648 Bacteria 6795
20 Ga0466708_335657 3300042652 Bacteria 9039
21 Ga0466727_202860 3300042655 Bacteria 4799
22 JGI24698J34947_10030969 3300002449 Bacteria 2818
23 Ga0466705_043926 3300042612 Bacteria 3465
24 Ga0466694_246372 3300042594 Bacteria 2639
25 Ga0466694_407720 3300042594 Bacteria 2855
26 Ga0466699_103125 3300042597 Bacteria 4183
27 Ga0466712_234671 3300042614 Bacteria 6701
28 Ga0466711_175538 3300042615 Bacteria 43523
29 Ga0466718_045216 3300042617 Bacteria 3629
30 Ga0466707_163413 3300042601 Bacteria 4063
31 Ga0466716_021020 3300042605 Bacteria 8650
32 Ga0466720_030086 3300042607 Bacteria 1803
33 Ga0466720_046925 3300042607 Bacteria 1358
34 Ga0466722_159819 3300042609 Bacteria 3025
35 Ga0466703_121472 3300042636 Bacteria 13448
36 Ga0123357_10100184 3300009784 Bacteria 3739
37 AustNasuHG_c1000580 3300000089 Bacteria 12907
38 Ga0466691_132760 3300042593 Bacteria 3506
39 Ga0466712_043020 3300042614 Bacteria 10399
40 Ga0466712_058877 3300042614 Bacteria 25182
41 Ga0466718_159659 3300042617 Bacteria 1846
42 Ga0466726_089413 3300042619 Bacteria 5102
43 Ga0466728_062850 3300042620 Bacteria 2619
44 Ga0466706_071759 3300042599 Bacteria 1372
45 Ga0466719_194305 3300042606 Bacteria 4170
46 Ga0466698_236113 3300042610 Bacteria 1386
47 Ga0466735_068378 3300042624 Bacteria 3392
48 Ga0466703_255268 3300042636 Bacteria 2623
49 Ga0466709_026631 3300042648 Bacteria 14426
50 Ga0466727_101998 3300042655 Bacteria 5094
51 AustNasuHG_c1006243 3300000089 Bacteria 4258
52 Ga0072941_1019068 3300005201 Bacteria 5261
53 Ga0466696_028437 3300042596 Bacteria 47665
54 Ga0466696_204250 3300042596 Bacteria 2889
55 Ga0466699_043720 3300042597 Bacteria 24375
56 Ga0466699_245580 3300042597 Bacteria 19984
57 Ga0466699_412125 3300042597 Unclassified 2759
58 Ga0466712_272471 3300042614 Bacteria 2924
59 Ga0466715_349454 3300042616 Bacteria 41739
60 Ga0466729_040049 3300042621 Bacteria 2307
61 Ga0466707_066585 3300042601 Unclassified 1658
62 Ga0466719_527305 3300042606 Bacteria 10995
63 Ga0466735_186691 3300042624 Bacteria 9243
64 Ga0466703_030542 3300042636 Unclassified 2483
65 Ga0466703_063524 3300042636 Unclassified 4435
66 Ga0466709_220714 3300042648 Bacteria 12433
67 Ga0466708_255900 3300042652 Bacteria 2367
68 AustNasuHG_c1026487 3300000089 Bacteria 1805
69 Ga0466732_420569 3300042656 Bacteria 3365
70 Ga0466691_209139 3300042593 Bacteria 9020
71 Ga0466694_243559 3300042594 Bacteria 9213
72 Ga0466712_151289 3300042614 Bacteria 1368
73 Ga0466700_067182 3300042600 Bacteria 1787
74 Ga0466707_198888 3300042601 Bacteria 1321
75 Ga0466707_344900 3300042601 Unclassified 1875
76 Ga0466716_080780 3300042605 Bacteria 20496
77 Ga0466722_169528 3300042609 Bacteria 1687
78 Ga0466708_015554 3300042652 Bacteria 30533
79 Ga0466727_178593 3300042655 Unclassified 2399
80 Ga0123353_10715221 3300010167 Bacteria 1402
81 Ga0072941_1000141 3300005201 Bacteria 43983
82 Ga0466732_081939 3300042656 Bacteria 3113
83 Ga0466711_046725 3300042615 Bacteria 2231
84 Ga0466715_009454 3300042616 Bacteria 11159
85 Ga0466715_136346 3300042616 Bacteria 9194
86 Ga0466723_050194 3300042618 Bacteria 9529
87 Ga0466723_182417 3300042618 Bacteria 25448
88 Ga0466726_206704 3300042619 Bacteria 1599
89 Ga0466728_143134 3300042620 Bacteria 2348
90 Ga0466707_165173 3300042601 Bacteria 5150
91 Ga0466719_036914 3300042606 Bacteria 9855
92 Ga0466720_024432 3300042607 Bacteria 2159
93 Ga0466703_089740 3300042636 Bacteria 13321
94 Ga0466703_395171 3300042636 Bacteria 1436
95 Ga0466727_348193 3300042655 Bacteria 2992
96 Ga0123357_10023060 3300009784 Bacteria 8358
97 JGI24698J34947_10001002 3300002449 Bacteria 14498
98 JGI24698J34947_10006174 3300002449 Unclassified 6581
99 Ga0466705_146159 3300042612 Bacteria 5282
100 Ga0466705_168737 3300042612 Bacteria 19471
101 Ga0466690_339415 3300042590 Bacteria 9655
102 Ga0466692_115587 3300042591 Archaea 1546
103 Ga0466696_025993 3300042596 Bacteria 11411
104 Ga0466699_230553 3300042597 Bacteria 2266
105 Ga0466699_307206 3300042597 Unclassified 1654
106 Ga0466715_155296 3300042616 Bacteria 5619
107 Ga0466718_088176 3300042617 Bacteria 2043
108 Ga0466707_319505 3300042601 Bacteria 5778
109 Ga0466722_022356 3300042609 Bacteria 2123
110 Ga0466698_403122 3300042610 Bacteria 3040
111 Ga0466703_292012 3300042636 Bacteria 42783
112 Ga0466704_483469 3300042643 Bacteria 21202
113 Ga0466704_557630 3300042643 Bacteria 4233
114 Ga0466709_046489 3300042648 Unclassified 1450
115 Ga0466727_125772 3300042655 Unclassified 1396
116 JGI24698J34947_10008343 3300002449 Bacteria 5683
117 JGI24698J34947_10015998 3300002449 Bacteria 4079
118 Ga0072941_1001255 3300005201 Bacteria 90205

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042617 Ga0466718_159659 Ga0466718_159659_218_1291 357
2 3300042597 Ga0466699_412125 Ga0466699_412125_219_1376 363
3 3300042597 Ga0466699_230553 Ga0466699_230553_928_2022 364
4 3300042620 Ga0466728_062850 Ga0466728_062850_43_1137 364
5 3300042652 Ga0466708_335657 Ga0466708_335657_31_1125 364
6 3300002449 JGI24698J34947_10015998 JGI24698J34947_100159984 365
7 3300042601 Ga0466707_165173 Ga0466707_165173_3212_4315 367
8 3300042648 Ga0466709_220714 Ga0466709_220714_4227_5363 378
9 3300042601 Ga0466707_198888 Ga0466707_198888_75_1223 382
10 3300042594 Ga0466694_149503 Ga0466694_149503_1198_2349 383
11 3300042597 Ga0466699_307206 Ga0466699_307206_255_1406 383
12 3300042597 Ga0466699_342016 Ga0466699_342016_2612_3763 383
13 3300042601 Ga0466707_344900 Ga0466707_344900_158_1309 383
14 3300042607 Ga0466720_024432 Ga0466720_024432_951_2102 383
15 3300042607 Ga0466720_046925 Ga0466720_046925_103_1254 383
16 3300042609 Ga0466722_159819 Ga0466722_159819_1184_2335 383
17 3300042616 Ga0466715_136346 Ga0466715_136346_8032_9183 383
18 3300042617 Ga0466718_045216 Ga0466718_045216_1823_2974 383
19 3300042617 Ga0466718_088176 Ga0466718_088176_637_1788 383
20 3300042618 Ga0466723_182417 Ga0466723_182417_2010_3161 383
21 3300042636 Ga0466703_063524 Ga0466703_063524_3222_4373 383
22 3300042656 Ga0466732_081939 Ga0466732_081939_890_2041 383
23 iso_pr_bacteria 2781125694 2781435450 383
24 3300000089 AustNasuHG_c1000580 AustNasuHG_10005807 384
25 3300000089 AustNasuHG_c1006243 AustNasuHG_10062432 384
26 3300000089 AustNasuHG_c1026487 AustNasuHG_10264871 384
27 3300005201 Ga0072941_1000141 Ga0072941_100014119 384
28 3300005201 Ga0072941_1001255 Ga0072941_100125525 384
29 3300005201 Ga0072941_1019068 Ga0072941_10190683 384
30 3300042591 Ga0466692_115587 Ga0466692_115587_375_1529 384
31 3300042594 Ga0466694_122253 Ga0466694_122253_1124_2278 384
32 3300042594 Ga0466694_243559 Ga0466694_243559_436_1590 384
33 3300042594 Ga0466694_246372 Ga0466694_246372_395_1549 384
34 3300042594 Ga0466694_407720 Ga0466694_407720_1036_2190 384
35 3300042597 Ga0466699_103125 Ga0466699_103125_1969_3123 384
36 3300042597 Ga0466699_439168 Ga0466699_439168_2190_3344 384
37 3300042599 Ga0466706_071759 Ga0466706_071759_132_1286 384
38 3300042600 Ga0466700_067182 Ga0466700_067182_353_1507 384
39 3300042601 Ga0466707_163413 Ga0466707_163413_2829_3983 384
40 3300042601 Ga0466707_319505 Ga0466707_319505_3179_4333 384
41 3300042606 Ga0466719_036914 Ga0466719_036914_1161_2315 384
42 3300042606 Ga0466719_527305 Ga0466719_527305_3868_5022 384
43 3300042607 Ga0466720_030086 Ga0466720_030086_298_1452 384
44 3300042609 Ga0466722_169528 Ga0466722_169528_218_1372 384
45 3300042610 Ga0466698_236113 Ga0466698_236113_70_1224 384
46 3300042610 Ga0466698_363232 Ga0466698_363232_372_1526 384
47 3300042610 Ga0466698_403122 Ga0466698_403122_240_1394 384
48 3300042614 Ga0466712_028599 Ga0466712_028599_23788_24942 384
49 3300042614 Ga0466712_043020 Ga0466712_043020_3783_4937 384
50 3300042614 Ga0466712_058877 Ga0466712_058877_7380_8534 384
51 3300042614 Ga0466712_109596 Ga0466712_109596_1060_2214 384
52 3300042614 Ga0466712_151289 Ga0466712_151289_46_1200 384
53 3300042614 Ga0466712_234671 Ga0466712_234671_429_1583 384
54 3300042614 Ga0466712_272471 Ga0466712_272471_1359_2513 384
55 3300042615 Ga0466711_046725 Ga0466711_046725_383_1537 384
56 3300042616 Ga0466715_009454 Ga0466715_009454_9227_10381 384
57 3300042617 Ga0466718_098669 Ga0466718_098669_141_1295 384
58 3300042619 Ga0466726_089413 Ga0466726_089413_3678_4832 384
59 3300042619 Ga0466726_206704 Ga0466726_206704_234_1388 384
60 3300042621 Ga0466729_040049 Ga0466729_040049_897_2051 384
61 3300042624 Ga0466735_186691 Ga0466735_186691_4127_5281 384
62 3300042636 Ga0466703_395171 Ga0466703_395171_134_1288 384
63 3300042643 Ga0466704_557630 Ga0466704_557630_2774_3928 384
64 3300042648 Ga0466709_026631 Ga0466709_026631_415_1569 384
65 3300042655 Ga0466727_101998 Ga0466727_101998_3745_4899 384
66 3300042655 Ga0466727_125772 Ga0466727_125772_134_1288 384
67 3300042655 Ga0466727_348193 Ga0466727_348193_708_1862 384
68 3300042656 Ga0466732_420569 Ga0466732_420569_411_1565 384
69 iso_pr_bacteria 2781125693 2781434120 384
70 iso_pr_bacteria 650716099 650879051 384
71 3300002449 JGI24698J34947_10001002 JGI24698J34947_1000100216 385
72 3300002449 JGI24698J34947_10001268 JGI24698J34947_100012686 385
73 3300002449 JGI24698J34947_10006174 JGI24698J34947_100061745 385
74 3300002449 JGI24698J34947_10008343 JGI24698J34947_100083432 385
75 3300002449 JGI24698J34947_10030969 JGI24698J34947_100309692 385
76 3300002462 JGI24702J35022_10002110 JGI24702J35022_100021108 385
77 3300009784 Ga0123357_10100184 Ga0123357_101001843 385
78 3300010167 Ga0123353_10715221 Ga0123353_107152211 385
79 3300042596 Ga0466696_025993 Ga0466696_025993_8261_9418 385
80 3300042596 Ga0466696_028437 Ga0466696_028437_46444_47601 385
81 3300042597 Ga0466699_230182 Ga0466699_230182_1327_2484 385
82 3300042597 Ga0466699_233055 Ga0466699_233055_1562_2719 385
83 3300042597 Ga0466699_245580 Ga0466699_245580_3598_4755 385
84 3300042605 Ga0466716_080780 Ga0466716_080780_1605_2762 385
85 3300042605 Ga0466716_085974 Ga0466716_085974_3826_4983 385
86 3300042606 Ga0466719_061882 Ga0466719_061882_43_1200 385
87 3300042616 Ga0466715_349454 Ga0466715_349454_531_1688 385
88 3300042618 Ga0466723_050194 Ga0466723_050194_688_1845 385
89 3300042620 Ga0466728_143134 Ga0466728_143134_459_1616 385
90 3300042636 Ga0466703_030542 Ga0466703_030542_10_1167 385
91 3300042636 Ga0466703_255268 Ga0466703_255268_1454_2611 385
92 3300042643 Ga0466704_079313 Ga0466704_079313_1561_2718 385
93 3300042643 Ga0466704_225677 Ga0466704_225677_438_1595 385
94 3300042652 Ga0466708_015554 Ga0466708_015554_17608_18765 385
95 3300042652 Ga0466708_220002 Ga0466708_220002_157_1314 385
96 3300042655 Ga0466727_178593 Ga0466727_178593_835_1992 385
97 3300009784 Ga0123357_10023060 Ga0123357_100230605 386
98 3300042593 Ga0466691_209139 Ga0466691_209139_6162_7322 386
99 3300042605 Ga0466716_021020 Ga0466716_021020_3349_4509 386
100 3300042612 Ga0466705_146159 Ga0466705_146159_2799_3959 386
101 3300042636 Ga0466703_292012 Ga0466703_292012_28099_29259 386
102 3300042643 Ga0466704_483469 Ga0466704_483469_1116_2276 386
103 3300042609 Ga0466722_022356 Ga0466722_022356_916_2079 387
104 3300042655 Ga0466727_202860 Ga0466727_202860_2963_4126 387
105 3300042616 Ga0466715_155296 Ga0466715_155296_574_1740 388
106 3300042590 Ga0466690_339415 Ga0466690_339415_2510_3679 389
107 3300042612 Ga0466705_168737 Ga0466705_168737_11187_12356 389
108 3300042636 Ga0466703_089740 Ga0466703_089740_10084_11253 389
109 3300042636 Ga0466703_121472 Ga0466703_121472_10143_11312 389
110 3300042648 Ga0466709_046489 Ga0466709_046489_181_1350 389
111 3300042597 Ga0466699_043720 Ga0466699_043720_15442_16614 390
112 3300042624 Ga0466735_068378 Ga0466735_068378_478_1650 390
113 3300042593 Ga0466691_132760 Ga0466691_132760_187_1362 391
114 3300042601 Ga0466707_066585 Ga0466707_066585_89_1264 391
115 3300042648 Ga0466709_223564 Ga0466709_223564_714_1889 391
116 3300042606 Ga0466719_194305 Ga0466719_194305_522_1709 395
117 3300042612 Ga0466705_043926 Ga0466705_043926_1253_2446 397
118 3300042596 Ga0466696_204250 Ga0466696_204250_295_1491 398
119 3300042652 Ga0466708_255900 Ga0466708_255900_372_1595 407
120 3300042615 Ga0466711_175538 Ga0466711_175538_14070_15302 410
121 3300042596 Ga0466696_348440 Ga0466696_348440_3263_4525 420

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13187 Fer4_9 4Fe-4S dicluster domain 293 362 0.95
PF00248 Aldo_ket_red Aldo/keto reductase family 15 274 0.91
PF13534 Fer4_17 4Fe-4S dicluster domain 294 363 0.66
PF13183 Fer4_8 4Fe-4S dicluster domain 293 363 0.63

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.77 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.