Protein Family IF09614
Metagenome
Isolate
136
Members
43
Samples
132
Scaffolds
192.38
Avg Length
Representative Sequence
- ID
- 3300042648|Ga0466709_167094|Ga0466709_167094_1319_1897
- Length
- 177 aa
- Sequence
- MDWTFNIKDFVSAFIVLFAIIDVSGSLPIFVDLKNKNKSFSPLKASLLAFFFVGEGILRLFNVDVSSFAVAGSLVLFVIACEMTFGVEIFKMDSPTSSATMVPVIFPLLAGPGAFTALLSLKAEYSSLVIILAIVLWRVNLIEKLIGAGGVYVLRKFFGIILLAISAKLFMGNITLL
Sample Types
Isolate
2.9%
Metagenome
97.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
32.6%
Termitidae
27.9%
Unclassified
14.0%
Termopsidae
9.3%
Rhinotermitidae
7.0%
Passalidae
4.7%
Hodotermitidae
2.3%
Blattidae
2.3%
Taxonomy
Archaea
0
Bacteria
128
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 3 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 4 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 5 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 6 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 7 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 8 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 9 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 10 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 11 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 12 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 13 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 16 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 17 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 18 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 19 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 20 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 21 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 22 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 23 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 24 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 25 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 26 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 27 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 28 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 29 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 30 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 31 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 32 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 33 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 34 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 35 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 36 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 37 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 38 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 39 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 40 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 41 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 42 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 43 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10015402 | 3300009784 | Unclassified | 10023 |
| 2 | Ga0123353_10486196 | 3300010167 | Bacteria | 1804 |
| 3 | Ga0123354_10025067 | 3300010882 | Bacteria | 9405 |
| 4 | Ga0123354_10154043 | 3300010882 | Bacteria | 2767 |
| 5 | Ga0466707_311275 | 3300042601 | Bacteria | 1593 |
| 6 | Ga0466713_087936 | 3300042602 | Bacteria | 6062 |
| 7 | Ga0466722_009206 | 3300042609 | Bacteria | 29346 |
| 8 | Ga0466690_061550 | 3300042590 | Bacteria | 26019 |
| 9 | Ga0466692_140423 | 3300042591 | Bacteria | 16022 |
| 10 | Ga0466692_167389 | 3300042591 | Bacteria | 6083 |
| 11 | Ga0466696_202133 | 3300042596 | Bacteria | 4570 |
| 12 | JGI24699J35502_11134124 | 3300002509 | Bacteria | 34130 |
| 13 | Ga0068302_10524873 | 3300005071 | Bacteria | 1203 |
| 14 | Ga0466704_456616 | 3300042643 | Bacteria | 35507 |
| 15 | Ga0466705_338893 | 3300042612 | Bacteria | 11291 |
| 16 | Ga0466715_259115 | 3300042616 | Bacteria | 4413 |
| 17 | Ga0466715_500083 | 3300042616 | Bacteria | 5001 |
| 18 | Ga0466726_090145 | 3300042619 | Bacteria | 14217 |
| 19 | Ga0466728_424066 | 3300042620 | Bacteria | 2456 |
| 20 | Ga0123357_10004638 | 3300009784 | Bacteria | 16215 |
| 21 | Ga0123357_10773959 | 3300009784 | Bacteria | 659 |
| 22 | Ga0123356_10135131 | 3300010049 | Bacteria | 2423 |
| 23 | Ga0123354_10197424 | 3300010882 | Bacteria | 2226 |
| 24 | Ga0123354_10583451 | 3300010882 | Bacteria | 827 |
| 25 | Ga0466707_274678 | 3300042601 | Unclassified | 1724 |
| 26 | Ga0466719_460020 | 3300042606 | Bacteria | 7296 |
| 27 | Ga0466719_505790 | 3300042606 | Bacteria | 8367 |
| 28 | JGI24696J40584_12933959 | 3300002834 | Bacteria | 1530 |
| 29 | Ga0068305_10046343 | 3300005083 | Bacteria | 3419 |
| 30 | Ga0466735_091393 | 3300042624 | Bacteria | 2585 |
| 31 | Ga0466735_110024 | 3300042624 | Bacteria | 5631 |
| 32 | Ga0466735_226949 | 3300042624 | Bacteria | 1239 |
| 33 | Ga0466708_221268 | 3300042652 | Bacteria | 13982 |
| 34 | Ga0123357_10049328 | 3300009784 | Unclassified | 5701 |
| 35 | Ga0123357_10384085 | 3300009784 | Bacteria | 1299 |
| 36 | Ga0123356_10416612 | 3300010049 | Bacteria | 1484 |
| 37 | Ga0123354_10003998 | 3300010882 | Bacteria | 20665 |
| 38 | Ga0466707_035868 | 3300042601 | Bacteria | 5454 |
| 39 | Ga0466707_037216 | 3300042601 | Bacteria | 1301 |
| 40 | Ga0466707_170429 | 3300042601 | Bacteria | 10238 |
| 41 | Ga0466707_241759 | 3300042601 | Bacteria | 17311 |
| 42 | Ga0466722_085596 | 3300042609 | Bacteria | 1535 |
| 43 | Ga0466722_165738 | 3300042609 | Bacteria | 25578 |
| 44 | Ga0466698_255996 | 3300042610 | Bacteria | 1459 |
| 45 | Ga0466692_117229 | 3300042591 | Bacteria | 56912 |
| 46 | Ga0466735_165935 | 3300042624 | Bacteria | 1845 |
| 47 | Ga0466704_319388 | 3300042643 | Bacteria | 1942 |
| 48 | Ga0466709_167094 | 3300042648 | Bacteria | 7391 |
| 49 | Ga0466727_124195 | 3300042655 | Bacteria | 107642 |
| 50 | Ga0466705_373818 | 3300042612 | Bacteria | 18025 |
| 51 | Ga0466726_266728 | 3300042619 | Bacteria | 3732 |
| 52 | Ga0123357_10008295 | 3300009784 | Bacteria | 12964 |
| 53 | Ga0123357_10155245 | 3300009784 | Bacteria | 2763 |
| 54 | Ga0123354_10065814 | 3300010882 | Bacteria | 5300 |
| 55 | Ga0466713_058280 | 3300042602 | Bacteria | 24824 |
| 56 | Ga0466713_111128 | 3300042602 | Bacteria | 15728 |
| 57 | Ga0466716_313507 | 3300042605 | Bacteria | 6921 |
| 58 | Ga0466691_161680 | 3300042593 | Bacteria | 8234 |
| 59 | Ga0068305_10442926 | 3300005083 | Bacteria | 1010 |
| 60 | Ga0466729_203014 | 3300042621 | Bacteria | 7591 |
| 61 | Ga0466735_061695 | 3300042624 | Bacteria | 9727 |
| 62 | Ga0466703_010285 | 3300042636 | Bacteria | 3132 |
| 63 | Ga0466703_024045 | 3300042636 | Bacteria | 1631 |
| 64 | Ga0466704_337559 | 3300042643 | Unclassified | 3932 |
| 65 | Ga0466725_440777 | 3300042654 | Bacteria | 1445 |
| 66 | Ga0466727_140347 | 3300042655 | Bacteria | 3402 |
| 67 | Ga0466705_144072 | 3300042612 | Bacteria | 11569 |
| 68 | Ga0466711_021889 | 3300042615 | Bacteria | 32119 |
| 69 | Ga0466711_178990 | 3300042615 | Bacteria | 9408 |
| 70 | Ga0466715_169397 | 3300042616 | Bacteria | 1674 |
| 71 | Ga0466701_049400 | 3300042598 | Bacteria | 1741 |
| 72 | Ga0466706_185768 | 3300042599 | Unclassified | 1370 |
| 73 | Ga0466707_022690 | 3300042601 | Bacteria | 15610 |
| 74 | Ga0466719_313001 | 3300042606 | Bacteria | 17722 |
| 75 | IMNBL1DRAFT_c0008364 | 3300000062 | Bacteria | 5274 |
| 76 | Ga0466703_146142 | 3300042636 | Bacteria | 4729 |
| 77 | Ga0466703_411727 | 3300042636 | Unclassified | 2960 |
| 78 | Ga0466704_273784 | 3300042643 | Unclassified | 4997 |
| 79 | Ga0466709_243801 | 3300042648 | Bacteria | 109845 |
| 80 | Ga0466715_220088 | 3300042616 | Bacteria | 21738 |
| 81 | Ga0123356_10145292 | 3300010049 | Bacteria | 2346 |
| 82 | Ga0466713_149966 | 3300042602 | Bacteria | 6880 |
| 83 | Ga0466690_373916 | 3300042590 | Bacteria | 40566 |
| 84 | Ga0466692_019635 | 3300042591 | Bacteria | 1239 |
| 85 | Ga0466692_143025 | 3300042591 | Bacteria | 2598 |
| 86 | Ga0466691_092862 | 3300042593 | Bacteria | 14737 |
| 87 | JGI24699J35502_11134037 | 3300002509 | Bacteria | 25927 |
| 88 | Ga0068305_10126923 | 3300005083 | Bacteria | 6033 |
| 89 | Ga0466729_219588 | 3300042621 | Bacteria | 3998 |
| 90 | Ga0466729_298617 | 3300042621 | Bacteria | 2482 |
| 91 | Ga0466734_081052 | 3300042623 | Bacteria | 1296 |
| 92 | Ga0466735_150289 | 3300042624 | Bacteria | 1717 |
| 93 | Ga0466704_583464 | 3300042643 | Bacteria | 34188 |
| 94 | Ga0466705_219437 | 3300042612 | Unclassified | 1323 |
| 95 | Ga0466723_095077 | 3300042618 | Bacteria | 3737 |
| 96 | Ga0466726_079746 | 3300042619 | Bacteria | 2213 |
| 97 | Ga0466701_091833 | 3300042598 | Bacteria | 1288 |
| 98 | Ga0466701_100075 | 3300042598 | Bacteria | 1229 |
| 99 | Ga0466700_139869 | 3300042600 | Bacteria | 5254 |
| 100 | Ga0466707_062515 | 3300042601 | Bacteria | 19268 |
| 101 | Ga0466716_187453 | 3300042605 | Bacteria | 14311 |
| 102 | Ga0466719_500894 | 3300042606 | Bacteria | 5139 |
| 103 | Ga0466735_126051 | 3300042624 | Bacteria | 4642 |
| 104 | Ga0466735_169248 | 3300042624 | Bacteria | 1288 |
| 105 | Ga0466727_130490 | 3300042655 | Bacteria | 3239 |
| 106 | Ga0466727_203810 | 3300042655 | Bacteria | 6610 |
| 107 | Ga0466697_089909 | 3300042611 | Bacteria | 1123 |
| 108 | Ga0466715_095832 | 3300042616 | Bacteria | 10625 |
| 109 | Ga0466715_347763 | 3300042616 | Bacteria | 4996 |
| 110 | Ga0466723_129762 | 3300042618 | Bacteria | 6447 |
| 111 | Ga0123356_10006359 | 3300010049 | Bacteria | 11913 |
| 112 | Ga0123353_10335408 | 3300010167 | Bacteria | 2286 |
| 113 | Ga0123353_10439487 | 3300010167 | Bacteria | 1925 |
| 114 | Ga0466707_112391 | 3300042601 | Bacteria | 11861 |
| 115 | Ga0466707_176204 | 3300042601 | Bacteria | 3431 |
| 116 | Ga0466713_125567 | 3300042602 | Bacteria | 2899 |
| 117 | Ga0466722_230306 | 3300042609 | Bacteria | 4777 |
| 118 | Ga0466692_043899 | 3300042591 | Bacteria | 67267 |
| 119 | Ga0466692_184027 | 3300042591 | Bacteria | 1459 |
| 120 | 2227441906 | 2225789004 | Bacteria | 25850 |
| 121 | 2227546020 | 2225789004 | Bacteria | 2920 |
| 122 | IMNBL1DRAFT_c0000764 | 3300000062 | Bacteria | 25441 |
| 123 | Ga0068302_10035013 | 3300005071 | Bacteria | 8885 |
| 124 | Ga0466734_113356 | 3300042623 | Bacteria | 2643 |
| 125 | Ga0466735_005506 | 3300042624 | Bacteria | 2799 |
| 126 | Ga0466735_095551 | 3300042624 | Bacteria | 1957 |
| 127 | Ga0466735_119845 | 3300042624 | Bacteria | 1932 |
| 128 | Ga0466703_035424 | 3300042636 | Bacteria | 4790 |
| 129 | Ga0466703_406596 | 3300042636 | Bacteria | 2023 |
| 130 | Ga0466704_164604 | 3300042643 | Bacteria | 18380 |
| 131 | Ga0466708_146236 | 3300042652 | Bacteria | 6526 |
| 132 | Ga0466726_041756 | 3300042619 | Bacteria | 1371 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042643 | Ga0466704_319388 | Ga0466704_319388_1395_1904 | 169 |
| 2 | 3300042609 | Ga0466722_085596 | Ga0466722_085596_465_1049 | 170 |
| 3 | 3300009784 | Ga0123357_10049328 | Ga0123357_100493282 | 171 |
| 4 | 3300042619 | Ga0466726_266728 | Ga0466726_266728_1120_1704 | 171 |
| 5 | 3300042648 | Ga0466709_167094 | Ga0466709_167094_1319_1897 | 177 |
| 6 | 3300042643 | Ga0466704_456616 | Ga0466704_456616_4797_5378 | 178 |
| 7 | 3300042601 | Ga0466707_062515 | Ga0466707_062515_4696_5280 | 179 |
| 8 | 3300042609 | Ga0466722_230306 | Ga0466722_230306_1105_1683 | 179 |
| 9 | 3300009784 | Ga0123357_10773959 | Ga0123357_107739591 | 180 |
| 10 | 3300042601 | Ga0466707_170429 | Ga0466707_170429_7705_8289 | 180 |
| 11 | 3300042619 | Ga0466726_041756 | Ga0466726_041756_327_911 | 182 |
| 12 | 3300009784 | Ga0123357_10155245 | Ga0123357_101552452 | 183 |
| 13 | 3300002834 | JGI24696J40584_12933959 | JGI24696J40584_129339592 | 186 |
| 14 | 3300042601 | Ga0466707_112391 | Ga0466707_112391_4576_5160 | 186 |
| 15 | 3300042612 | Ga0466705_219437 | Ga0466705_219437_711_1289 | 186 |
| 16 | 3300042624 | Ga0466735_091393 | Ga0466735_091393_36_620 | 186 |
| 17 | 3300042655 | Ga0466727_130490 | Ga0466727_130490_1873_2457 | 186 |
| 18 | 3300042655 | Ga0466727_203810 | Ga0466727_203810_4667_5251 | 186 |
| 19 | 3300042624 | Ga0466735_110024 | Ga0466735_110024_2570_3154 | 187 |
| 20 | 3300042636 | Ga0466703_411727 | Ga0466703_411727_549_1136 | 190 |
| 21 | 3300042602 | Ga0466713_149966 | Ga0466713_149966_2362_2937 | 191 |
| 22 | 3300005083 | Ga0068305_10126923 | Ga0068305_101269231 | 192 |
| 23 | 3300005083 | Ga0068305_10442926 | Ga0068305_104429262 | 192 |
| 24 | 3300010167 | Ga0123353_10486196 | Ga0123353_104861962 | 192 |
| 25 | 3300042598 | Ga0466701_049400 | Ga0466701_049400_75_653 | 192 |
| 26 | 3300042598 | Ga0466701_091833 | Ga0466701_091833_236_814 | 192 |
| 27 | 3300042600 | Ga0466700_139869 | Ga0466700_139869_1134_1712 | 192 |
| 28 | 3300042602 | Ga0466713_058280 | Ga0466713_058280_17813_18391 | 192 |
| 29 | 3300042602 | Ga0466713_087936 | Ga0466713_087936_3515_4093 | 192 |
| 30 | 3300042611 | Ga0466697_089909 | Ga0466697_089909_33_611 | 192 |
| 31 | 3300042623 | Ga0466734_113356 | Ga0466734_113356_1368_1946 | 192 |
| 32 | 3300042636 | Ga0466703_035424 | Ga0466703_035424_2574_3152 | 192 |
| 33 | 3300042643 | Ga0466704_583464 | Ga0466704_583464_22396_22974 | 192 |
| 34 | iso_pr_bacteria | 2820759988 | 2820761064 | 192 |
| 35 | 2225789004 | 2227441906 | 2227880153 | 193 |
| 36 | 2225789004 | 2227546020 | 2228071587 | 193 |
| 37 | 3300009784 | Ga0123357_10004638 | Ga0123357_1000463813 | 193 |
| 38 | 3300009784 | Ga0123357_10008295 | Ga0123357_100082957 | 193 |
| 39 | 3300009784 | Ga0123357_10015402 | Ga0123357_100154027 | 193 |
| 40 | 3300010049 | Ga0123356_10006359 | Ga0123356_100063598 | 193 |
| 41 | 3300010049 | Ga0123356_10135131 | Ga0123356_101351312 | 193 |
| 42 | 3300010049 | Ga0123356_10145292 | Ga0123356_101452922 | 193 |
| 43 | 3300010882 | Ga0123354_10003998 | Ga0123354_1000399817 | 193 |
| 44 | 3300010882 | Ga0123354_10025067 | Ga0123354_100250678 | 193 |
| 45 | 3300010882 | Ga0123354_10154043 | Ga0123354_101540432 | 193 |
| 46 | 3300010882 | Ga0123354_10197424 | Ga0123354_101974242 | 193 |
| 47 | 3300010882 | Ga0123354_10583451 | Ga0123354_105834511 | 193 |
| 48 | 3300042601 | Ga0466707_274678 | Ga0466707_274678_655_1236 | 193 |
| 49 | 3300042602 | Ga0466713_111128 | Ga0466713_111128_1909_2490 | 193 |
| 50 | 3300042602 | Ga0466713_125567 | Ga0466713_125567_1616_2197 | 193 |
| 51 | 3300042605 | Ga0466716_187453 | Ga0466716_187453_5460_6041 | 193 |
| 52 | 3300042610 | Ga0466698_255996 | Ga0466698_255996_41_622 | 193 |
| 53 | 3300042655 | Ga0466727_140347 | Ga0466727_140347_1667_2248 | 193 |
| 54 | 3300000062 | IMNBL1DRAFT_c0000764 | IMNBL1DRAFT_000076421 | 194 |
| 55 | 3300005071 | Ga0068302_10035013 | Ga0068302_100350138 | 194 |
| 56 | 3300005083 | Ga0068305_10046343 | Ga0068305_100463433 | 194 |
| 57 | 3300042590 | Ga0466690_373916 | Ga0466690_373916_35619_36203 | 194 |
| 58 | 3300042591 | Ga0466692_019635 | Ga0466692_019635_638_1222 | 194 |
| 59 | 3300042591 | Ga0466692_043899 | Ga0466692_043899_42523_43107 | 194 |
| 60 | 3300042591 | Ga0466692_117229 | Ga0466692_117229_32326_32910 | 194 |
| 61 | 3300042591 | Ga0466692_140423 | Ga0466692_140423_13231_13815 | 194 |
| 62 | 3300042591 | Ga0466692_167389 | Ga0466692_167389_2781_3365 | 194 |
| 63 | 3300042596 | Ga0466696_202133 | Ga0466696_202133_301_885 | 194 |
| 64 | 3300042598 | Ga0466701_100075 | Ga0466701_100075_482_1066 | 194 |
| 65 | 3300042599 | Ga0466706_185768 | Ga0466706_185768_268_852 | 194 |
| 66 | 3300042601 | Ga0466707_022690 | Ga0466707_022690_4697_5281 | 194 |
| 67 | 3300042601 | Ga0466707_035868 | Ga0466707_035868_759_1343 | 194 |
| 68 | 3300042601 | Ga0466707_037216 | Ga0466707_037216_106_690 | 194 |
| 69 | 3300042606 | Ga0466719_460020 | Ga0466719_460020_4952_5536 | 194 |
| 70 | 3300042606 | Ga0466719_505790 | Ga0466719_505790_6150_6734 | 194 |
| 71 | 3300042609 | Ga0466722_009206 | Ga0466722_009206_16915_17499 | 194 |
| 72 | 3300042612 | Ga0466705_144072 | Ga0466705_144072_2088_2672 | 194 |
| 73 | 3300042612 | Ga0466705_338893 | Ga0466705_338893_2049_2633 | 194 |
| 74 | 3300042612 | Ga0466705_373818 | Ga0466705_373818_16677_17261 | 194 |
| 75 | 3300042615 | Ga0466711_021889 | Ga0466711_021889_8074_8658 | 194 |
| 76 | 3300042615 | Ga0466711_178990 | Ga0466711_178990_6990_7574 | 194 |
| 77 | 3300042616 | Ga0466715_095832 | Ga0466715_095832_1443_2027 | 194 |
| 78 | 3300042616 | Ga0466715_220088 | Ga0466715_220088_8440_9024 | 194 |
| 79 | 3300042616 | Ga0466715_500083 | Ga0466715_500083_1635_2219 | 194 |
| 80 | 3300042618 | Ga0466723_129762 | Ga0466723_129762_4198_4782 | 194 |
| 81 | 3300042619 | Ga0466726_079746 | Ga0466726_079746_820_1404 | 194 |
| 82 | 3300042621 | Ga0466729_203014 | Ga0466729_203014_2646_3230 | 194 |
| 83 | 3300042621 | Ga0466729_219588 | Ga0466729_219588_1899_2483 | 194 |
| 84 | 3300042623 | Ga0466734_081052 | Ga0466734_081052_457_1041 | 194 |
| 85 | 3300042624 | Ga0466735_005506 | Ga0466735_005506_247_831 | 194 |
| 86 | 3300042624 | Ga0466735_061695 | Ga0466735_061695_7200_7784 | 194 |
| 87 | 3300042624 | Ga0466735_095551 | Ga0466735_095551_1283_1867 | 194 |
| 88 | 3300042624 | Ga0466735_119845 | Ga0466735_119845_928_1512 | 194 |
| 89 | 3300042624 | Ga0466735_150289 | Ga0466735_150289_81_665 | 194 |
| 90 | 3300042624 | Ga0466735_226949 | Ga0466735_226949_615_1199 | 194 |
| 91 | 3300042636 | Ga0466703_010285 | Ga0466703_010285_1430_2014 | 194 |
| 92 | 3300042636 | Ga0466703_406596 | Ga0466703_406596_947_1531 | 194 |
| 93 | 3300042643 | Ga0466704_164604 | Ga0466704_164604_1448_2032 | 194 |
| 94 | 3300042643 | Ga0466704_273784 | Ga0466704_273784_3327_3911 | 194 |
| 95 | 3300042643 | Ga0466704_337559 | Ga0466704_337559_1433_2017 | 194 |
| 96 | 3300042652 | Ga0466708_221268 | Ga0466708_221268_13088_13672 | 194 |
| 97 | iso_pr_bacteria | 2820762746 | 2820764111 | 194 |
| 98 | iso_pr_bacteria | 2940216256 | 2940218343 | 194 |
| 99 | iso_pr_bacteria | 2967483437 | 2967483524 | 194 |
| 100 | 3300000062 | IMNBL1DRAFT_c0008364 | IMNBL1DRAFT_00083643 | 195 |
| 101 | 3300002509 | JGI24699J35502_11134124 | JGI24699J35502_111341243 | 195 |
| 102 | 3300009784 | Ga0123357_10384085 | Ga0123357_103840852 | 195 |
| 103 | 3300010049 | Ga0123356_10416612 | Ga0123356_104166122 | 195 |
| 104 | 3300010167 | Ga0123353_10335408 | Ga0123353_103354082 | 195 |
| 105 | 3300010167 | Ga0123353_10439487 | Ga0123353_104394871 | 195 |
| 106 | 3300042590 | Ga0466690_061550 | Ga0466690_061550_21116_21703 | 195 |
| 107 | 3300042591 | Ga0466692_143025 | Ga0466692_143025_1734_2321 | 195 |
| 108 | 3300042591 | Ga0466692_184027 | Ga0466692_184027_108_695 | 195 |
| 109 | 3300042593 | Ga0466691_092862 | Ga0466691_092862_4939_5526 | 195 |
| 110 | 3300042593 | Ga0466691_161680 | Ga0466691_161680_1731_2318 | 195 |
| 111 | 3300042601 | Ga0466707_176204 | Ga0466707_176204_2696_3283 | 195 |
| 112 | 3300042606 | Ga0466719_313001 | Ga0466719_313001_12024_12611 | 195 |
| 113 | 3300042606 | Ga0466719_500894 | Ga0466719_500894_2912_3499 | 195 |
| 114 | 3300042609 | Ga0466722_165738 | Ga0466722_165738_9502_10089 | 195 |
| 115 | 3300042618 | Ga0466723_095077 | Ga0466723_095077_312_899 | 195 |
| 116 | 3300042620 | Ga0466728_424066 | Ga0466728_424066_1699_2286 | 195 |
| 117 | 3300042621 | Ga0466729_298617 | Ga0466729_298617_888_1475 | 195 |
| 118 | 3300042624 | Ga0466735_126051 | Ga0466735_126051_827_1414 | 195 |
| 119 | 3300042624 | Ga0466735_169248 | Ga0466735_169248_162_749 | 195 |
| 120 | 3300042636 | Ga0466703_024045 | Ga0466703_024045_282_869 | 195 |
| 121 | 3300042636 | Ga0466703_146142 | Ga0466703_146142_2435_3022 | 195 |
| 122 | 3300042648 | Ga0466709_243801 | Ga0466709_243801_100484_101071 | 195 |
| 123 | 3300042654 | Ga0466725_440777 | Ga0466725_440777_544_1131 | 195 |
| 124 | 3300002509 | JGI24699J35502_11134037 | JGI24699J35502_1113403714 | 196 |
| 125 | 3300005071 | Ga0068302_10524873 | Ga0068302_105248732 | 196 |
| 126 | 3300042601 | Ga0466707_311275 | Ga0466707_311275_218_808 | 196 |
| 127 | 3300042605 | Ga0466716_313507 | Ga0466716_313507_1309_1899 | 196 |
| 128 | 3300042601 | Ga0466707_241759 | Ga0466707_241759_2603_3199 | 198 |
| 129 | 3300042616 | Ga0466715_259115 | Ga0466715_259115_1560_2156 | 198 |
| 130 | 3300042616 | Ga0466715_347763 | Ga0466715_347763_2385_2981 | 198 |
| 131 | 3300042624 | Ga0466735_165935 | Ga0466735_165935_627_1268 | 198 |
| 132 | 3300010882 | Ga0123354_10065814 | Ga0123354_100658143 | 199 |
| 133 | 3300042655 | Ga0466727_124195 | Ga0466727_124195_80888_81499 | 203 |
| 134 | 3300042619 | Ga0466726_090145 | Ga0466726_090145_11227_11841 | 204 |
| 135 | 3300042652 | Ga0466708_146236 | Ga0466708_146236_2425_3039 | 204 |
| 136 | 3300042616 | Ga0466715_169397 | Ga0466715_169397_374_997 | 207 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01914 | MarC | MarC family integral membrane protein | 8 | 174 | 0.85 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01914 | GO:0016020 | membrane | CC |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.61 | 0.66 | Medium |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.