Protein Family IF09595

Metagenome Isolate
127 Members
30 Samples
123 Scaffolds
431.46 Avg Length

🧬 Representative Sequence

ID
3300042648|Ga0466709_118694|Ga0466709_118694_7004_8422
Length
472 aa
Sequence
LGKRQKNFRGTDTFAEFREGPVIPRFPGFSPWIGFVASRYVRRGRRNSPSPVLSVLGIATGVLALIVILAVMNGFQLGFIESIIEISSYHLRAEKFPPEKAGLLEDRLRETPGLVSIVPFREFQGLARGRRSTQHGILVRCLPPDALARDPAMAAKLEIEAGAFDLAGADSILLGSELARSLQLRLGDKLTLLSIPGLFTVSDEEAPPAGDPGDEDAGRVNEFTVTGIFRSGFYEYDMGWGFINLEAGRKLAGEGMSLGIKLRDRWQDRSALSAIERSFAAGGEDFGDLAFSAWRDYNRAFFGALRTEKLFMFILVGLIFVVVGLNIFQAQRRAVLERREEIGLLRAVGGADKAVRLVFVCDGLIIGFAGAGAGLVLGLLVASHIPLFFTFIEKLVNGIIGVANAFTGSFSAPGDFAVFSPAVFYIKEIPSRIIVQEVVFVFMFGFLSALFAAWFASGQVSKMKPAEVLRDE

📊 Sample Types

Isolate 3.1%
Metagenome 96.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 46.7%
Termitidae 20.0%
Unclassified 16.7%
Termopsidae 10.0%
Rhinotermitidae 6.7%

🌳 Taxonomy

Archaea 1
Bacteria 124
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
2 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
3 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
4 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
5 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
6 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
7 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
8 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
9 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
10 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
11 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
12 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
13 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
14 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
15 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
16 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
17 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
18 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
19 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
20 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
21 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
22 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
23 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
24 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
25 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
26 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
27 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
28 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
29 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
30 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466722_068591 3300042609 Bacteria 9734
2 Ga0466711_032983 3300042615 Bacteria 3107
3 Ga0466711_477746 3300042615 Bacteria 3593
4 Ga0466715_147164 3300042616 Bacteria 17560
5 Ga0466715_263195 3300042616 Bacteria 8028
6 Ga0466715_355918 3300042616 Bacteria 9209
7 Ga0466723_343537 3300042618 Bacteria 96271
8 Ga0466726_084031 3300042619 Bacteria 3750
9 Ga0466728_032486 3300042620 Bacteria 12326
10 Ga0466705_026099 3300042612 Bacteria 14603
11 Ga0466705_060150 3300042612 Bacteria 42844
12 Ga0466705_128423 3300042612 Bacteria 4557
13 Ga0466690_245675 3300042590 Bacteria 3731
14 Ga0466692_042687 3300042591 Bacteria 64519
15 Ga0466696_019439 3300042596 Bacteria 13656
16 Ga0466709_338063 3300042648 Bacteria 8036
17 Ga0466708_121832 3300042652 Bacteria 10302
18 Ga0466727_012228 3300042655 Bacteria 2717
19 Ga0466707_023018 3300042601 Bacteria 3778
20 Ga0466707_047263 3300042601 Bacteria 18620
21 Ga0466719_214459 3300042606 Bacteria 27938
22 Ga0466723_323276 3300042618 Bacteria 12192
23 Ga0466726_363596 3300042619 Bacteria 1869
24 Ga0466728_065446 3300042620 Bacteria 45233
25 Ga0466705_068713 3300042612 Bacteria 12031
26 Ga0466691_174510 3300042593 Bacteria 2260
27 Ga0466696_079274 3300042596 Bacteria 11056
28 Ga0466696_153555 3300042596 Bacteria 5443
29 Ga0466696_335069 3300042596 Bacteria 23035
30 JGI24702J35022_10061127 3300002462 Bacteria 2015
31 Ga0466735_117126 3300042624 Bacteria 3118
32 Ga0466703_012351 3300042636 Bacteria 30446
33 Ga0466703_316437 3300042636 Bacteria 17841
34 Ga0466704_511287 3300042643 Bacteria 48132
35 Ga0466708_096456 3300042652 Bacteria 22929
36 Ga0466727_278107 3300042655 Unclassified 1370
37 Ga0123353_10029732 3300010167 Bacteria 8427
38 Ga0466715_307882 3300042616 Bacteria 10887
39 Ga0466723_117615 3300042618 Bacteria 53992
40 Ga0466723_163980 3300042618 Bacteria 8569
41 Ga0466723_177815 3300042618 Bacteria 12006
42 Ga0466723_240327 3300042618 Bacteria 7338
43 Ga0466726_032660 3300042619 Bacteria 9899
44 Ga0466726_245933 3300042619 Bacteria 3398
45 Ga0466728_031898 3300042620 Bacteria 21446
46 Ga0466728_165253 3300042620 Bacteria 19087
47 Ga0466733_128044 3300042659 Bacteria 1596
48 Ga0466733_207738 3300042659 Bacteria 14249
49 Ga0466692_084153 3300042591 Bacteria 6355
50 Ga0466691_167928 3300042593 Bacteria 7785
51 JGI24695J34938_10003235 3300002450 Bacteria 11530
52 Ga0466703_190075 3300042636 Bacteria 5688
53 Ga0466704_209487 3300042643 Bacteria 45601
54 Ga0466709_118694 3300042648 Bacteria 11857
55 Ga0466709_212079 3300042648 Bacteria 2226
56 Ga0466719_350536 3300042606 Bacteria 1983
57 Ga0466711_329070 3300042615 Bacteria 4594
58 Ga0466715_018975 3300042616 Bacteria 15600
59 Ga0466715_505926 3300042616 Bacteria 12607
60 Ga0466715_616711 3300042616 Bacteria 1502
61 Ga0466723_109836 3300042618 Bacteria 4695
62 Ga0466728_052374 3300042620 Bacteria 39388
63 Ga0466728_355275 3300042620 Bacteria 4246
64 Ga0466690_352707 3300042590 Bacteria 9829
65 Ga0466691_010692 3300042593 Bacteria 45781
66 Ga0466703_068102 3300042636 Bacteria 2644
67 Ga0466703_293690 3300042636 Bacteria 3977
68 Ga0466709_129154 3300042648 Bacteria 51098
69 Ga0466708_157225 3300042652 Bacteria 4164
70 Ga0466708_366296 3300042652 Bacteria 6308
71 Ga0466716_038402 3300042605 Bacteria 5676
72 Ga0466716_099890 3300042605 Bacteria 31090
73 Ga0466719_280035 3300042606 Bacteria 7223
74 Ga0466715_055859 3300042616 Bacteria 18639
75 Ga0466723_142238 3300042618 Bacteria 10110
76 Ga0466726_156632 3300042619 Bacteria 2518
77 Ga0466733_057162 3300042659 Bacteria 7194
78 Ga0466735_136805 3300042624 Bacteria 2824
79 Ga0466703_116563 3300042636 Bacteria 3902
80 Ga0466704_212969 3300042643 Bacteria 10903
81 Ga0466704_232658 3300042643 Bacteria 5607
82 Ga0123354_10109779 3300010882 Unclassified 3652
83 Ga0466722_036342 3300042609 Bacteria 8504
84 Ga0466711_517874 3300042615 Bacteria 5933
85 Ga0466715_382872 3300042616 Bacteria 22351
86 Ga0466723_009360 3300042618 Bacteria 5258
87 Ga0466723_058123 3300042618 Bacteria 8843
88 Ga0466723_292225 3300042618 Bacteria 6835
89 Ga0466726_490752 3300042619 Bacteria 8164
90 Ga0466728_088286 3300042620 Bacteria 6195
91 Ga0466694_002155 3300042594 Bacteria 38089
92 Ga0466704_301952 3300042643 Bacteria 17756
93 Ga0466708_005524 3300042652 Bacteria 9864
94 Ga0123353_10080652 3300010167 Bacteria 5233
95 Ga0466716_495783 3300042605 Bacteria 7669
96 Ga0466715_069257 3300042616 Bacteria 34190
97 Ga0466715_078388 3300042616 Bacteria 13010
98 Ga0466723_308761 3300042618 Bacteria 24583
99 Ga0466726_086676 3300042619 Bacteria 9773
100 Ga0466726_156215 3300042619 Bacteria 14405
101 Ga0466705_025306 3300042612 Bacteria 30242
102 Ga0466705_341583 3300042612 Bacteria 5874
103 Ga0466733_044201 3300042659 Bacteria 54685
104 Ga0466733_055788 3300042659 Bacteria 32943
105 Ga0466691_134095 3300042593 Bacteria 9924
106 Ga0466696_427426 3300042596 Bacteria 4839
107 Ga0466735_221177 3300042624 Bacteria 2352
108 Ga0466704_216309 3300042643 Bacteria 43311
109 Ga0466704_582104 3300042643 Bacteria 10224
110 Ga0466719_415041 3300042606 Bacteria 20967
111 Ga0466711_050410 3300042615 Bacteria 22899
112 Ga0466728_023553 3300042620 Bacteria 8397
113 Ga0466705_234159 3300042612 Bacteria 9676
114 Ga0466690_087446 3300042590 Bacteria 49513
115 Ga0466690_138934 3300042590 Archaea 2913
116 Ga0466692_033635 3300042591 Bacteria 4884
117 JGI24702J35022_10001467 3300002462 Bacteria 14658
118 Ga0466709_230244 3300042648 Bacteria 10623
119 Ga0466708_022521 3300042652 Bacteria 3058
120 Ga0466708_197587 3300042652 Bacteria 12562
121 Ga0466708_234390 3300042652 Bacteria 27135
122 Ga0466727_173103 3300042655 Bacteria 11113
123 Ga0466727_327080 3300042655 Bacteria 6263

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042659 Ga0466733_128044 Ga0466733_128044_24_1211 381
2 3300042596 Ga0466696_153555 Ga0466696_153555_710_1903 383
3 3300042616 Ga0466715_307882 Ga0466715_307882_930_2105 391
4 iso_pr_bacteria 2781125652 2781311253 391
5 3300042619 Ga0466726_245933 Ga0466726_245933_25_1203 392
6 3300042615 Ga0466711_050410 Ga0466711_050410_13936_15174 394
7 3300042636 Ga0466703_293690 Ga0466703_293690_11_1252 394
8 3300042643 Ga0466704_232658 Ga0466704_232658_2639_3823 394
9 3300042659 Ga0466733_207738 Ga0466733_207738_8180_9496 394
10 3300042648 Ga0466709_338063 Ga0466709_338063_2741_3952 395
11 3300042606 Ga0466719_280035 Ga0466719_280035_2593_3786 397
12 3300042615 Ga0466711_032983 Ga0466711_032983_1803_2996 397
13 3300042655 Ga0466727_278107 Ga0466727_278107_33_1226 397
14 3300042636 Ga0466703_116563 Ga0466703_116563_590_1798 402
15 3300042648 Ga0466709_212079 Ga0466709_212079_418_1626 402
16 3300042609 Ga0466722_036342 Ga0466722_036342_2412_3629 405
17 3300042652 Ga0466708_197587 Ga0466708_197587_3349_4566 405
18 3300042624 Ga0466735_136805 Ga0466735_136805_125_1375 406
19 3300042591 Ga0466692_033635 Ga0466692_033635_2245_3468 407
20 3300042620 Ga0466728_032486 Ga0466728_032486_8856_10079 407
21 3300042636 Ga0466703_068102 Ga0466703_068102_97_1320 407
22 3300042590 Ga0466690_087446 Ga0466690_087446_3178_4428 408
23 3300042605 Ga0466716_099890 Ga0466716_099890_27850_29109 411
24 3300042652 Ga0466708_234390 Ga0466708_234390_8276_9511 411
25 3300042618 Ga0466723_240327 Ga0466723_240327_856_2097 413
26 3300042624 Ga0466735_221177 Ga0466735_221177_716_2047 414
27 3300042620 Ga0466728_065446 Ga0466728_065446_2346_3617 415
28 3300042652 Ga0466708_022521 Ga0466708_022521_762_2051 417
29 3300042620 Ga0466728_023553 Ga0466728_023553_4874_6202 421
30 3300042596 Ga0466696_079274 Ga0466696_079274_7307_8575 422
31 3300042615 Ga0466711_517874 Ga0466711_517874_3907_5235 422
32 3300042616 Ga0466715_355918 Ga0466715_355918_5444_6757 422
33 3300002450 JGI24695J34938_10003235 JGI24695J34938_100032354 423
34 3300042594 Ga0466694_002155 Ga0466694_002155_7061_8362 423
35 3300042659 Ga0466733_044201 Ga0466733_044201_2166_3482 423
36 3300042596 Ga0466696_427426 Ga0466696_427426_1290_2564 424
37 3300042601 Ga0466707_047263 Ga0466707_047263_5684_7018 425
38 3300042620 Ga0466728_088286 Ga0466728_088286_717_2075 425
39 3300042616 Ga0466715_505926 Ga0466715_505926_9735_11015 426
40 3300042636 Ga0466703_012351 Ga0466703_012351_24295_25632 427
41 3300042652 Ga0466708_005524 Ga0466708_005524_5736_7058 427
42 3300010167 Ga0123353_10029732 Ga0123353_100297328 428
43 3300042591 Ga0466692_042687 Ga0466692_042687_29081_30367 428
44 3300042593 Ga0466691_010692 Ga0466691_010692_31532_32842 428
45 3300042618 Ga0466723_117615 Ga0466723_117615_19541_20875 428
46 3300042620 Ga0466728_031898 Ga0466728_031898_9953_11290 428
47 3300042652 Ga0466708_366296 Ga0466708_366296_361_1677 428
48 3300042619 Ga0466726_363596 Ga0466726_363596_172_1509 429
49 3300042620 Ga0466728_165253 Ga0466728_165253_3403_4695 430
50 3300042643 Ga0466704_301952 Ga0466704_301952_11176_12567 430
51 3300042618 Ga0466723_009360 Ga0466723_009360_3502_4797 431
52 3300042590 Ga0466690_352707 Ga0466690_352707_5187_6509 432
53 3300042593 Ga0466691_174510 Ga0466691_174510_363_1700 432
54 3300042616 Ga0466715_018975 Ga0466715_018975_5622_6944 432
55 3300042618 Ga0466723_308761 Ga0466723_308761_3579_4901 432
56 3300010167 Ga0123353_10080652 Ga0123353_100806523 433
57 3300042590 Ga0466690_138934 Ga0466690_138934_1276_2577 433
58 3300042612 Ga0466705_234159 Ga0466705_234159_3265_4587 433
59 3300042655 Ga0466727_012228 Ga0466727_012228_955_2256 433
60 3300042659 Ga0466733_057162 Ga0466733_057162_5095_6411 433
61 3300042616 Ga0466715_069257 Ga0466715_069257_1943_3247 434
62 3300042618 Ga0466723_109836 Ga0466723_109836_1581_2885 434
63 3300042618 Ga0466723_142238 Ga0466723_142238_1697_3058 434
64 3300042596 Ga0466696_335069 Ga0466696_335069_5680_6987 435
65 3300042612 Ga0466705_128423 Ga0466705_128423_3047_4354 435
66 3300042643 Ga0466704_212969 Ga0466704_212969_7701_9008 435
67 3300042616 Ga0466715_147164 Ga0466715_147164_6118_7461 436
68 3300042652 Ga0466708_157225 Ga0466708_157225_2402_3712 436
69 3300042659 Ga0466733_055788 Ga0466733_055788_9027_10358 436
70 iso_pr_bacteria 2781125692 2781432493 436
71 3300010882 Ga0123354_10109779 Ga0123354_101097793 438
72 3300042605 Ga0466716_495783 Ga0466716_495783_2404_3747 438
73 3300042612 Ga0466705_025306 Ga0466705_025306_4504_5898 438
74 3300042618 Ga0466723_323276 Ga0466723_323276_3347_4663 438
75 3300042590 Ga0466690_245675 Ga0466690_245675_16_1335 439
76 3300042612 Ga0466705_068713 Ga0466705_068713_2229_3593 439
77 3300042618 Ga0466723_343537 Ga0466723_343537_56216_57535 439
78 3300042636 Ga0466703_190075 Ga0466703_190075_2100_3464 439
79 3300042615 Ga0466711_477746 Ga0466711_477746_561_1925 440
80 3300042618 Ga0466723_292225 Ga0466723_292225_2250_3575 441
81 3300042643 Ga0466704_216309 Ga0466704_216309_24181_25506 441
82 3300042615 Ga0466711_329070 Ga0466711_329070_1410_2738 442
83 3300042593 Ga0466691_167928 Ga0466691_167928_1521_2852 443
84 3300042605 Ga0466716_038402 Ga0466716_038402_2305_3672 443
85 3300042616 Ga0466715_078388 Ga0466715_078388_1956_3287 443
86 3300042616 Ga0466715_616711 Ga0466715_616711_89_1420 443
87 3300042619 Ga0466726_032660 Ga0466726_032660_2821_4179 443
88 3300042619 Ga0466726_156215 Ga0466726_156215_3958_5289 443
89 3300042655 Ga0466727_327080 Ga0466727_327080_2281_3615 444
90 3300042606 Ga0466719_415041 Ga0466719_415041_10145_11482 445
91 3300042619 Ga0466726_086676 Ga0466726_086676_2594_3931 445
92 3300042643 Ga0466704_209487 Ga0466704_209487_16982_18319 445
93 3300042655 Ga0466727_173103 Ga0466727_173103_2971_4308 445
94 3300042601 Ga0466707_023018 Ga0466707_023018_1447_2787 446
95 3300042618 Ga0466723_058123 Ga0466723_058123_1651_2991 446
96 3300042620 Ga0466728_052374 Ga0466728_052374_21051_22391 446
97 3300042648 Ga0466709_129154 Ga0466709_129154_14425_15765 446
98 3300042652 Ga0466708_096456 Ga0466708_096456_4352_5692 446
99 iso_pr_bacteria 650716099 650879454 446
100 3300042609 Ga0466722_068591 Ga0466722_068591_3229_4653 447
101 3300042612 Ga0466705_026099 Ga0466705_026099_5049_6440 447
102 3300042616 Ga0466715_055859 Ga0466715_055859_3686_5029 447
103 3300042618 Ga0466723_177815 Ga0466723_177815_1174_2517 447
104 3300042619 Ga0466726_156632 Ga0466726_156632_1038_2381 447
105 3300042619 Ga0466726_490752 Ga0466726_490752_1941_3290 449
106 3300042636 Ga0466703_316437 Ga0466703_316437_7774_9123 449
107 3300042591 Ga0466692_084153 Ga0466692_084153_2631_4079 450
108 3300042619 Ga0466726_084031 Ga0466726_084031_2224_3576 450
109 3300042620 Ga0466728_355275 Ga0466728_355275_2367_3719 450
110 3300042596 Ga0466696_019439 Ga0466696_019439_2355_3710 451
111 3300042612 Ga0466705_060150 Ga0466705_060150_24268_25626 452
112 3300042643 Ga0466704_582104 Ga0466704_582104_2270_3628 452
113 3300042652 Ga0466708_121832 Ga0466708_121832_364_1725 453
114 3300042593 Ga0466691_134095 Ga0466691_134095_6626_7990 454
115 3300042606 Ga0466719_214459 Ga0466719_214459_14441_15805 454
116 3300042616 Ga0466715_263195 Ga0466715_263195_3950_5314 454
117 3300042616 Ga0466715_382872 Ga0466715_382872_1273_2637 454
118 3300042643 Ga0466704_511287 Ga0466704_511287_41681_43045 454
119 3300002462 JGI24702J35022_10061127 JGI24702J35022_100611272 455
120 3300042648 Ga0466709_230244 Ga0466709_230244_3842_5227 455
121 3300042606 Ga0466719_350536 Ga0466719_350536_520_1890 456
122 3300042624 Ga0466735_117126 Ga0466735_117126_223_1611 457
123 iso_pr_bacteria 2781125688 2781424162 457
124 3300002462 JGI24702J35022_10001467 JGI24702J35022_100014678 459
125 3300042618 Ga0466723_163980 Ga0466723_163980_3469_4851 460
126 3300042612 Ga0466705_341583 Ga0466705_341583_2011_3399 462
127 3300042648 Ga0466709_118694 Ga0466709_118694_7004_8422 472

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02687 FtsX FtsX-like permease family 314 465 0.9
PF12704 MacB_PCD MacB-like periplasmic core domain 52 231 0.74

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02687 GO:0016020 membrane CC

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.67 0.75 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.