Protein Family IF09588

Metagenome Isolate
111 Members
39 Samples
108 Scaffolds
200.87 Avg Length

🧬 Representative Sequence

ID
3300042648|Ga0466709_091328|Ga0466709_091328_2187_2891
Length
234 aa
Sequence
MPDALRRGKLFIVKVFIVYAHPSEDSLTRHVRDAFIAGLESAGHSYLVSDLYKMNFKTDMTEEEYRREAFYRGDIPVPDDVQAEQDKINSSGAIVFIFPLFWSDAPAKMVGWFDRVWTYGFAYGDASVAGADNVAARAAVSSVAPSGVALNSAGRTMKQLEKGLVLCVAGNTMEYFHETGILGALEKVMLQDRLFDRVKSKELVIFDSASRELESRKTRWEDYLKRAFKIGAEI

📊 Sample Types

Isolate 2.7%
Metagenome 97.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 43.6%
Kalotermitidae 33.3%
Unclassified 10.3%
Termopsidae 7.7%
Rhinotermitidae 5.1%

🌳 Taxonomy

Archaea 3
Bacteria 108
Eukaryota 0
Viruses 0
Unclassified 0

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
2 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
3 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
4 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
5 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
6 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
7 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
8 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
9 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
10 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
11 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
12 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
13 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
14 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
15 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
16 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
17 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
18 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
19 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
20 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
21 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
22 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
23 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
24 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
25 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
26 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
27 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
28 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
29 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
30 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
31 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
32 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
33 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
34 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
35 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
36 2773857682 Unclassified Methanosarcinaceae Lab288P3bin112 Isolate Unclassified
37 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
38 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
39 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10607743 3300010049 Bacteria 1258
2 Ga0123353_10000440 3300010167 Archaea 51481
3 Ga0123353_10825033 3300010167 Bacteria 1276
4 Ga0466691_227853 3300042593 Bacteria 1700
5 Ga0466696_093968 3300042596 Bacteria 1644
6 Ga0466714_103855 3300042603 Bacteria 1203
7 JGI24698J34947_10017537 3300002449 Bacteria 3879
8 JGI24695J34938_10017385 3300002450 Bacteria 3624
9 JGI24696J40584_12952364 3300002834 Bacteria 2339
10 Ga0466735_033214 3300042624 Bacteria 2732
11 Ga0466709_267847 3300042648 Bacteria 1547
12 Ga0466715_126027 3300042616 Bacteria 10289
13 Ga0466715_172271 3300042616 Bacteria 15758
14 Ga0466718_096085 3300042617 Bacteria 1630
15 Ga0123357_10423373 3300009784 Bacteria 1185
16 Ga0123356_10119390 3300010049 Bacteria 2561
17 Ga0466707_119676 3300042601 Bacteria 4511
18 Ga0466714_010581 3300042603 Bacteria 1444
19 JGI24698J34947_10015580 3300002449 Bacteria 4139
20 Ga0072940_1168645 3300005200 Bacteria 972
21 Ga0466705_052990 3300042612 Bacteria 1651
22 Ga0466703_430556 3300042636 Bacteria 37676
23 Ga0466704_141053 3300042643 Bacteria 1935
24 Ga0466704_423681 3300042643 Bacteria 1789
25 Ga0466727_195575 3300042655 Bacteria 1212
26 Ga0466711_418248 3300042615 Bacteria 1720
27 Ga0466715_012658 3300042616 Bacteria 2906
28 Ga0466715_636863 3300042616 Bacteria 10576
29 Ga0466723_183438 3300042618 Bacteria 2133
30 Ga0466723_208062 3300042618 Bacteria 8888
31 Ga0466726_488261 3300042619 Bacteria 1420
32 Ga0466732_220885 3300042656 Bacteria 4330
33 Ga0123357_10241481 3300009784 Bacteria 1955
34 Ga0123353_10231544 3300010167 Bacteria 2880
35 Ga0123353_11210559 3300010167 Bacteria 990
36 Ga0466735_163018 3300042624 Bacteria 1371
37 Ga0466704_094368 3300042643 Bacteria 1116
38 Ga0466709_091328 3300042648 Bacteria 3856
39 Ga0466709_285765 3300042648 Bacteria 11650
40 Ga0466715_457464 3300042616 Bacteria 1117
41 Ga0123353_10605244 3300010167 Bacteria 1565
42 Ga0466691_017642 3300042593 Bacteria 8705
43 Ga0466696_472696 3300042596 Bacteria 2398
44 Ga0466707_245525 3300042601 Bacteria 1510
45 Ga0466722_261037 3300042609 Bacteria 6975
46 Ga0466705_026607 3300042612 Bacteria 47022
47 Ga0466705_169341 3300042612 Bacteria 3967
48 Ga0466704_226745 3300042643 Bacteria 1573
49 Ga0466727_009264 3300042655 Bacteria 1344
50 Ga0466715_048495 3300042616 Bacteria 1162
51 Ga0466723_222990 3300042618 Bacteria 3556
52 Ga0123355_10066077 3300009826 Bacteria 5823
53 Ga0123353_10451550 3300010167 Bacteria 1892
54 Ga0466694_176491 3300042594 Bacteria 25053
55 Ga0466696_360847 3300042596 Bacteria 2052
56 Ga0466716_223716 3300042605 Bacteria 1715
57 Ga0466735_155549 3300042624 Bacteria 2560
58 Ga0466708_045900 3300042652 Bacteria 1602
59 Ga0466711_069934 3300042615 Bacteria 1700
60 Ga0466715_438671 3300042616 Bacteria 5066
61 Ga0123353_10495033 3300010167 Bacteria 1783
62 Ga0466716_285582 3300042605 Bacteria 2410
63 Ga0466719_054345 3300042606 Bacteria 28152
64 Ga0466719_282506 3300042606 Bacteria 3078
65 JGI24702J35022_10062804 3300002462 Bacteria 1990
66 Ga0466705_174665 3300042612 Bacteria 8491
67 Ga0466705_296411 3300042612 Bacteria 1109
68 Ga0466705_335120 3300042612 Bacteria 4052
69 Ga0466704_312654 3300042643 Bacteria 1715
70 Ga0466715_206189 3300042616 Bacteria 1769
71 Ga0466715_217038 3300042616 Bacteria 3212
72 Ga0466715_461974 3300042616 Bacteria 1679
73 Ga0466715_647065 3300042616 Bacteria 5468
74 Ga0466728_250287 3300042620 Archaea 1792
75 Ga0123356_10034164 3300010049 Bacteria 4755
76 Ga0123356_10045386 3300010049 Bacteria 4089
77 Ga0466692_167727 3300042591 Bacteria 5007
78 Ga0466691_067090 3300042593 Bacteria 8953
79 Ga0466696_044336 3300042596 Bacteria 1731
80 Ga0466716_280235 3300042605 Bacteria 1596
81 AustNasuHG_c1017851 3300000089 Bacteria 2351
82 AustNasuHG_c1023165 3300000089 Bacteria 1986
83 JGI24698J34947_10005883 3300002449 Bacteria 6720
84 JGI24695J34938_10001158 3300002450 Bacteria 23472
85 JGI24696J40584_12950916 3300002834 Bacteria 2192
86 Ga0466705_003554 3300042612 Bacteria 16887
87 Ga0466731_296096 3300042622 Bacteria 1023
88 Ga0466709_058461 3300042648 Bacteria 10458
89 Ga0466709_269253 3300042648 Bacteria 1088
90 Ga0466711_076609 3300042615 Bacteria 16760
91 Ga0466728_130456 3300042620 Bacteria 4946
92 Ga0123356_10358514 3300010049 Bacteria 1584
93 Ga0123356_10383772 3300010049 Bacteria 1538
94 Ga0123353_10468574 3300010167 Bacteria 1848
95 Ga0466691_010251 3300042593 Bacteria 1023
96 Ga0466691_107459 3300042593 Bacteria 2278
97 Ga0466696_084923 3300042596 Bacteria 2378
98 Ga0466696_450419 3300042596 Bacteria 1199
99 Ga0466699_218460 3300042597 Bacteria 1032
100 Ga0466707_109923 3300042601 Bacteria 1570
101 JGI24696J40584_12871200 3300002834 Bacteria 1046
102 Ga0466705_052436 3300042612 Bacteria 1603
103 Ga0466735_100229 3300042624 Bacteria 1389
104 Ga0466708_205908 3300042652 Bacteria 27823
105 Ga0466712_019680 3300042614 Bacteria 1192
106 Ga0466712_169037 3300042614 Bacteria 19748
107 Ga0466715_273981 3300042616 Bacteria 60871
108 Ga0466718_051110 3300042617 Bacteria 4871

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042601 Ga0466707_109923 Ga0466707_109923_1021_1557 170
2 3300042620 Ga0466728_250287 Ga0466728_250287_516_1157 182
3 3300042616 Ga0466715_126027 Ga0466715_126027_9514_10101 187
4 3300042594 Ga0466694_176491 Ga0466694_176491_14327_14923 190
5 3300042593 Ga0466691_107459 Ga0466691_107459_1677_2261 194
6 3300042593 Ga0466691_227853 Ga0466691_227853_467_1051 194
7 3300042596 Ga0466696_044336 Ga0466696_044336_781_1365 194
8 3300042596 Ga0466696_084923 Ga0466696_084923_1605_2189 194
9 3300042596 Ga0466696_093968 Ga0466696_093968_126_710 194
10 3300042596 Ga0466696_360847 Ga0466696_360847_597_1181 194
11 3300042596 Ga0466696_472696 Ga0466696_472696_665_1249 194
12 3300042601 Ga0466707_119676 Ga0466707_119676_1799_2383 194
13 3300042603 Ga0466714_010581 Ga0466714_010581_505_1089 194
14 3300042603 Ga0466714_103855 Ga0466714_103855_74_658 194
15 3300042612 Ga0466705_003554 Ga0466705_003554_6807_7391 194
16 3300042612 Ga0466705_296411 Ga0466705_296411_299_883 194
17 3300042612 Ga0466705_335120 Ga0466705_335120_2006_2590 194
18 3300042615 Ga0466711_069934 Ga0466711_069934_218_802 194
19 3300042616 Ga0466715_172271 Ga0466715_172271_13232_13816 194
20 3300042616 Ga0466715_461974 Ga0466715_461974_373_957 194
21 3300042618 Ga0466723_183438 Ga0466723_183438_777_1361 194
22 3300042620 Ga0466728_130456 Ga0466728_130456_4268_4852 194
23 3300042643 Ga0466704_094368 Ga0466704_094368_327_911 194
24 3300042643 Ga0466704_141053 Ga0466704_141053_696_1280 194
25 3300042655 Ga0466727_195575 Ga0466727_195575_125_709 194
26 3300042656 Ga0466732_220885 Ga0466732_220885_431_1015 194
27 iso_pr_bacteria 2820285501 2820287492 194
28 iso_pu_archaea 2773857682 2774154684 194
29 3300000089 AustNasuHG_c1023165 AustNasuHG_10231652 195
30 3300002834 JGI24696J40584_12871200 JGI24696J40584_128712002 195
31 3300009784 Ga0123357_10241481 Ga0123357_102414812 195
32 3300009784 Ga0123357_10423373 Ga0123357_104233732 195
33 3300009826 Ga0123355_10066077 Ga0123355_1006607712 195
34 3300010049 Ga0123356_10045386 Ga0123356_100453865 195
35 3300010167 Ga0123353_10000440 Ga0123353_1000044035 195
36 3300010167 Ga0123353_10451550 Ga0123353_104515502 195
37 3300010167 Ga0123353_10605244 Ga0123353_106052442 195
38 3300010167 Ga0123353_11210559 Ga0123353_112105592 195
39 3300042591 Ga0466692_167727 Ga0466692_167727_3300_3890 196
40 3300042614 Ga0466712_019680 Ga0466712_019680_254_844 196
41 3300042614 Ga0466712_169037 Ga0466712_169037_8285_8875 196
42 3300042616 Ga0466715_206189 Ga0466715_206189_325_915 196
43 3300042617 Ga0466718_051110 Ga0466718_051110_2192_2782 196
44 3300042655 Ga0466727_009264 Ga0466727_009264_463_1053 196
45 3300002449 JGI24698J34947_10017537 JGI24698J34947_100175373 197
46 3300002834 JGI24696J40584_12952364 JGI24696J40584_129523642 197
47 3300042597 Ga0466699_218460 Ga0466699_218460_264_857 197
48 3300042612 Ga0466705_052990 Ga0466705_052990_556_1149 197
49 3300042643 Ga0466704_312654 Ga0466704_312654_449_1042 197
50 iso_pr_bacteria 2781125694 2781435491 197
51 3300000089 AustNasuHG_c1017851 AustNasuHG_10178512 198
52 3300002450 JGI24695J34938_10001158 JGI24695J34938_100011588 198
53 3300002450 JGI24695J34938_10017385 JGI24695J34938_100173852 198
54 3300042606 Ga0466719_282506 Ga0466719_282506_837_1433 198
55 3300042612 Ga0466705_174665 Ga0466705_174665_5117_5713 198
56 3300042624 Ga0466735_163018 Ga0466735_163018_316_912 198
57 3300002834 JGI24696J40584_12950916 JGI24696J40584_129509164 199
58 3300005200 Ga0072940_1168645 Ga0072940_11686451 199
59 3300010167 Ga0123353_10231544 Ga0123353_102315442 199
60 3300010167 Ga0123353_10468574 Ga0123353_104685742 199
61 3300010167 Ga0123353_10495033 Ga0123353_104950332 199
62 3300010167 Ga0123353_10825033 Ga0123353_108250331 199
63 3300042616 Ga0466715_647065 Ga0466715_647065_2555_3154 199
64 3300002449 JGI24698J34947_10015580 JGI24698J34947_100155803 200
65 3300002462 JGI24702J35022_10062804 JGI24702J35022_100628043 200
66 3300010049 Ga0123356_10607743 Ga0123356_106077432 200
67 3300042616 Ga0466715_636863 Ga0466715_636863_814_1416 200
68 3300010049 Ga0123356_10358514 Ga0123356_103585142 201
69 3300010049 Ga0123356_10119390 Ga0123356_101193902 202
70 3300042605 Ga0466716_285582 Ga0466716_285582_145_753 202
71 3300042619 Ga0466726_488261 Ga0466726_488261_189_797 202
72 3300042624 Ga0466735_033214 Ga0466735_033214_885_1493 202
73 3300042624 Ga0466735_155549 Ga0466735_155549_589_1197 202
74 3300042648 Ga0466709_285765 Ga0466709_285765_8018_8626 202
75 3300042652 Ga0466708_045900 Ga0466708_045900_735_1343 202
76 3300042652 Ga0466708_205908 Ga0466708_205908_16090_16698 202
77 3300010049 Ga0123356_10034164 Ga0123356_100341645 203
78 3300042612 Ga0466705_052436 Ga0466705_052436_458_1069 203
79 3300042617 Ga0466718_096085 Ga0466718_096085_930_1541 203
80 3300042624 Ga0466735_100229 Ga0466735_100229_726_1337 203
81 3300042601 Ga0466707_245525 Ga0466707_245525_643_1257 204
82 3300042615 Ga0466711_076609 Ga0466711_076609_2241_2855 204
83 3300042622 Ga0466731_296096 Ga0466731_296096_370_984 204
84 3300042636 Ga0466703_430556 Ga0466703_430556_1272_1886 204
85 3300042643 Ga0466704_226745 Ga0466704_226745_51_665 204
86 3300042593 Ga0466691_017642 Ga0466691_017642_6131_6748 205
87 3300042593 Ga0466691_067090 Ga0466691_067090_6502_7119 205
88 3300042618 Ga0466723_208062 Ga0466723_208062_4472_5089 205
89 3300042605 Ga0466716_223716 Ga0466716_223716_887_1507 206
90 3300002449 JGI24698J34947_10005883 JGI24698J34947_100058838 207
91 3300042593 Ga0466691_010251 Ga0466691_010251_290_916 208
92 3300042596 Ga0466696_450419 Ga0466696_450419_407_1033 208
93 3300042612 Ga0466705_169341 Ga0466705_169341_2137_2766 209
94 3300042618 Ga0466723_222990 Ga0466723_222990_388_1020 210
95 3300042648 Ga0466709_269253 Ga0466709_269253_245_877 210
96 3300042606 Ga0466719_054345 Ga0466719_054345_15376_16050 213
97 3300042616 Ga0466715_012658 Ga0466715_012658_1636_2277 213
98 3300042643 Ga0466704_423681 Ga0466704_423681_457_1098 213
99 3300042616 Ga0466715_273981 Ga0466715_273981_54994_55638 214
100 3300042616 Ga0466715_457464 Ga0466715_457464_217_861 214
101 3300042615 Ga0466711_418248 Ga0466711_418248_601_1248 215
102 3300042616 Ga0466715_438671 Ga0466715_438671_3804_4451 215
103 3300042616 Ga0466715_048495 Ga0466715_048495_172_822 216
104 3300042616 Ga0466715_217038 Ga0466715_217038_1121_1774 217
105 3300042612 Ga0466705_026607 Ga0466705_026607_32331_32987 218
106 3300010049 Ga0123356_10383772 Ga0123356_103837722 219
107 3300042609 Ga0466722_261037 Ga0466722_261037_1417_2082 221
108 3300042648 Ga0466709_267847 Ga0466709_267847_322_990 222
109 3300042648 Ga0466709_058461 Ga0466709_058461_8233_8910 225
110 3300042605 Ga0466716_280235 Ga0466716_280235_862_1560 232
111 3300042648 Ga0466709_091328 Ga0466709_091328_2187_2891 234

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03358 FMN_red NADPH-dependent FMN reductase 13 118 0.82
PF02525 Flavodoxin_2 Flavodoxin-like fold 14 144 0.78

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF03358 GO:0016491 oxidoreductase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.