Protein Family IF09557

Metagenome Isolate
207 Members
77 Samples
185 Scaffolds
230.36 Avg Length

🧬 Representative Sequence

ID
3300042648|Ga0466709_026774|Ga0466709_026774_210_1019
Length
269 aa
Sequence
MGNGVLPVLTGEPLGKPMTSAAVCGGSVGFLIWGVDRMYSAEIEHMCVVAKGAYHGPAPVPEEGKWVQVKENGDISGLTHGVGWCAPQQGACKLTLNVKNGIIEEALIETIGCSGMTHSAAMAAEILQGKTLIEALNTDLVCDAINVAMRELFLQIVYGRSQTAFSEGGLPIGAGLEDLGGSLRSQIGTMYGTKAKGARYLEMAEGYVTRLALDKDNLIIGYEFVNMGKMMAAIKKGIDANDALKSSSGHYGRFTEADGAVKYIDPRKE

📊 Sample Types

Isolate 10.6%
Metagenome 89.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 37.3%
Unclassified 26.7%
Kalotermitidae 18.7%
Termopsidae 5.3%
Blattidae 4.0%
Rhinotermitidae 4.0%
Passalidae 2.7%
Hodotermitidae 1.3%

🌳 Taxonomy

Archaea 0
Bacteria 188
Eukaryota 0
Viruses 0
Unclassified 19

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820772500 Unclassified Bacteroidetes Lab288P1bin72 Isolate Unclassified
2 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
3 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
4 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
5 2740892547 Fibrobacteria bacterium GUT77 MC_77 Isolate Unclassified
6 2820209022 Unclassified Kiritimatiellaeota Th196P3bin76 Isolate Unclassified
7 2820412446 Unclassified Firmicutes Lab288P4bin39 Isolate Unclassified
8 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
9 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
10 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
11 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
12 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
13 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
14 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
15 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
16 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
17 2820357977 Unclassified Firmicutes Nt197P3bin136 Isolate Unclassified
18 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
19 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
20 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
21 2820211246 Unclassified Kiritimatiellaeota Nt197P3bin96 Isolate Unclassified
22 2820507989 Unclassified Firmicutes Lab288P1bin41 Isolate Unclassified
23 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
24 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
25 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
26 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
27 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
28 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
29 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
30 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
31 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
32 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
33 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
34 2923982719 Parabacteroides sp. 52 Isolate Blattidae
35 2030936001 Nasutitermes corniger hindgut microbial communities from Florida, USA Metagenome Termitidae
36 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
37 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
38 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
39 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
40 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
41 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
42 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
43 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
44 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
45 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
46 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
47 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
48 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
49 2820767225 Unclassified Bacteroidetes Lab288P3bin34 Isolate Unclassified
50 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
51 2820001644 Unclassified Synergistetes Th196P3bin106 Isolate Unclassified
52 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
53 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
54 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
55 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
56 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
57 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
58 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
59 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
60 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
61 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
62 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
63 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
64 2820007728 Unclassified Synergistetes Lab288P3bin114 Isolate Unclassified
65 2820215626 Unclassified Kiritimatiellaeota Nt197P3bin123 Isolate Unclassified
66 2820044805 Unclassified Proteobacteria Th196P4bin15 Isolate Unclassified
67 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
68 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
69 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
70 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
71 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
72 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
73 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
74 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
75 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
76 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
77 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_129394 3300042611 Bacteria 1130
2 Ga0466705_006684 3300042612 Bacteria 2046
3 Ga0466715_018828 3300042616 Bacteria 12645
4 Ga0466715_466052 3300042616 Bacteria 1766
5 Ga0466728_162625 3300042620 Bacteria 3822
6 Ga0123357_10038466 3300009784 Bacteria 6514
7 Ga0123353_10179296 3300010167 Bacteria 3356
8 Ga0123353_10294188 3300010167 Bacteria 2483
9 Ga0466706_075947 3300042599 Bacteria 1343
10 Ga0466706_133216 3300042599 Bacteria 10131
11 Ga0466719_353782 3300042606 Unclassified 1130
12 Ga0466729_298027 3300042621 Bacteria 7436
13 Ga0466731_153018 3300042622 Bacteria 1751
14 Ga0466735_072733 3300042624 Bacteria 2082
15 Ga0466735_188098 3300042624 Unclassified 1991
16 Ga0466735_208290 3300042624 Bacteria 4635
17 Ga0466703_062258 3300042636 Bacteria 16640
18 Ga0466709_166642 3300042648 Bacteria 2890
19 Ga0466724_30294 3300042649 Bacteria 2934
20 Ga0466708_301714 3300042652 Bacteria 2945
21 Ga0466727_145543 3300042655 Unclassified 1705
22 Ga0466699_188267 3300042597 Bacteria 2948
23 Ga0072941_1004007 3300005201 Bacteria 37001
24 Ga0072941_1016622 3300005201 Bacteria 1963
25 Ga0466727_349859 3300042655 Unclassified 1071
26 Ga0466726_413471 3300042619 Bacteria 5388
27 Ga0123357_10237198 3300009784 Bacteria 1984
28 Ga0123356_10187739 3300010049 Bacteria 2095
29 Ga0123356_10611759 3300010049 Bacteria 1255
30 Ga0123356_10800459 3300010049 Bacteria 1113
31 Ga0123353_10014647 3300010167 Bacteria 11319
32 Ga0123353_11121745 3300010167 Bacteria 1042
33 Ga0466707_252337 3300042601 Bacteria 19824
34 Ga0466713_013389 3300042602 Bacteria 5006
35 Ga0466716_272319 3300042605 Bacteria 3863
36 Ga0466721_285597 3300042608 Bacteria 2500
37 Ga0466698_421500 3300042610 Bacteria 1218
38 Ga0466698_453437 3300042610 Bacteria 1280
39 Ga0466704_457394 3300042643 Unclassified 2690
40 Ga0466708_282915 3300042652 Bacteria 14159
41 Ga0466727_035395 3300042655 Bacteria 1565
42 Ga0466727_302838 3300042655 Unclassified 1230
43 Ga0466727_317733 3300042655 Bacteria 2894
44 Ga0466692_097561 3300042591 Bacteria 53967
45 Ga0466692_168144 3300042591 Bacteria 8010
46 Ga0466694_082023 3300042594 Bacteria 1488
47 Nasutiter_Contig16724 2030936001 Bacteria 1182
48 JGI24702J35022_10004580 3300002462 Bacteria 8199
49 JGI24702J35022_10136621 3300002462 Bacteria 1365
50 Ga0466715_568039 3300042616 Bacteria 3454
51 Ga0466726_413375 3300042619 Bacteria 1157
52 Ga0466728_255535 3300042620 Bacteria 3161
53 Ga0123353_10020281 3300010167 Bacteria 9922
54 Ga0123354_10013040 3300010882 Bacteria 12874
55 Ga0466707_280907 3300042601 Bacteria 2267
56 Ga0466707_400679 3300042601 Bacteria 3544
57 Ga0466707_405512 3300042601 Bacteria 1445
58 Ga0466720_015515 3300042607 Bacteria 13320
59 Ga0466720_100020 3300042607 Bacteria 31760
60 Ga0466722_064425 3300042609 Bacteria 50073
61 Ga0466722_121337 3300042609 Bacteria 64639
62 Ga0466731_094150 3300042622 Bacteria 14819
63 Ga0466734_136644 3300042623 Bacteria 2310
64 Ga0466735_043479 3300042624 Bacteria 1348
65 Ga0466735_163031 3300042624 Bacteria 2835
66 Ga0466703_232610 3300042636 Bacteria 1101
67 Ga0466704_038953 3300042643 Bacteria 1650
68 Ga0415639_088166 3300038395 Bacteria 1282
69 Ga0466690_246245 3300042590 Bacteria 1438
70 Ga0466696_170163 3300042596 Bacteria 2694
71 Ga0072941_1269176 3300005201 Bacteria 1703
72 Ga0466712_234008 3300042614 Bacteria 1977
73 Ga0466715_001151 3300042616 Bacteria 10830
74 Ga0123357_10661808 3300009784 Bacteria 767
75 Ga0123356_10073023 3300010049 Bacteria 3225
76 Ga0123356_10867161 3300010049 Bacteria 1074
77 Ga0123356_10902221 3300010049 Bacteria 1055
78 Ga0123353_10043922 3300010167 Bacteria 7082
79 Ga0123353_10324004 3300010167 Bacteria 2337
80 Ga0123353_10870865 3300010167 Bacteria 1231
81 Ga0466714_011689 3300042603 Bacteria 41248
82 Ga0466719_083211 3300042606 Bacteria 2894
83 Ga0466729_266214 3300042621 Bacteria 68016
84 Ga0466735_011609 3300042624 Bacteria 1447
85 Ga0466735_189863 3300042624 Bacteria 1822
86 Ga0466703_214791 3300042636 Bacteria 4491
87 Ga0466704_252044 3300042643 Bacteria 4479
88 Ga0466709_026774 3300042648 Bacteria 5285
89 Ga0466727_122834 3300042655 Bacteria 3488
90 Ga0466727_343331 3300042655 Bacteria 2164
91 Ga0264413_122069 3300024493 Bacteria 11894
92 Ga0466691_026137 3300042593 Unclassified 6264
93 AustNasuHG_c1004179 3300000089 Bacteria 5190
94 Ga0068302_10040336 3300005071 Bacteria 15583
95 Ga0466705_422882 3300042612 Unclassified 1316
96 Ga0466705_504428 3300042612 Bacteria 3292
97 Ga0466712_016163 3300042614 Bacteria 2714
98 Ga0466712_187039 3300042614 Bacteria 13572
99 Ga0123354_10459872 3300010882 Bacteria 1023
100 Ga0466706_147616 3300042599 Bacteria 3046
101 Ga0466707_009194 3300042601 Bacteria 11194
102 Ga0466707_051106 3300042601 Bacteria 3696
103 Ga0466707_197521 3300042601 Bacteria 4438
104 Ga0466714_140401 3300042603 Bacteria 1329
105 Ga0466714_141473 3300042603 Bacteria 59209
106 Ga0466719_541623 3300042606 Bacteria 2336
107 Ga0466720_150015 3300042607 Bacteria 24917
108 Ga0466708_088051 3300042652 Bacteria 36758
109 Ga0466727_284870 3300042655 Unclassified 2618
110 Ga0466727_321802 3300042655 Bacteria 4845
111 Ga0466692_033982 3300042591 Bacteria 1175
112 Ga0466693_267555 3300042592 Unclassified 1663
113 Ga0466696_365074 3300042596 Bacteria 2884
114 2227289989 2225789004 Bacteria 1242
115 AustNasuHG_c1000806 3300000089 Bacteria 11240
116 JGI24702J35022_10011274 3300002462 Bacteria 4984
117 Ga0072941_1016621 3300005201 Bacteria 3383
118 Ga0466733_145421 3300042659 Bacteria 2289
119 Ga0466711_376431 3300042615 Bacteria 48940
120 Ga0466715_119601 3300042616 Unclassified 4360
121 Ga0466718_110244 3300042617 Bacteria 2114
122 Ga0466723_203988 3300042618 Bacteria 2174
123 Ga0466726_025306 3300042619 Bacteria 8410
124 Ga0123357_10581943 3300009784 Bacteria 871
125 Ga0123353_10317576 3300010167 Unclassified 2366
126 Ga0123353_10351856 3300010167 Bacteria 2219
127 Ga0123353_10887308 3300010167 Bacteria 1216
128 Ga0466706_211464 3300042599 Unclassified 6640
129 Ga0466706_260242 3300042599 Bacteria 4909
130 Ga0466707_177041 3300042601 Bacteria 6870
131 Ga0466707_357269 3300042601 Unclassified 3058
132 Ga0466713_100108 3300042602 Bacteria 8290
133 Ga0466717_158828 3300042604 Bacteria 1269
134 Ga0466731_256925 3300042622 Bacteria 2322
135 Ga0466734_081512 3300042623 Bacteria 1672
136 Ga0466735_065887 3300042624 Bacteria 1044
137 Ga0466702_431578 3300042635 Bacteria 1304
138 Ga0466704_068859 3300042643 Unclassified 5716
139 JGI24698J34947_10057131 3300002449 Bacteria 1937
140 JGI24702J35022_10043948 3300002462 Bacteria 2380
141 Ga0466705_244644 3300042612 Unclassified 1176
142 Ga0466705_357180 3300042612 Bacteria 1569
143 Ga0466705_358529 3300042612 Bacteria 6674
144 Ga0466710_091057 3300042613 Bacteria 1149
145 Ga0466726_128587 3300042619 Bacteria 12711
146 Ga0466726_209537 3300042619 Bacteria 1894
147 Ga0466726_315074 3300042619 Bacteria 2224
148 Ga0466726_321841 3300042619 Bacteria 25117
149 Ga0466713_114885 3300042602 Bacteria 24347
150 Ga0466714_032413 3300042603 Bacteria 17943
151 Ga0466719_479846 3300042606 Bacteria 2388
152 Ga0466722_023576 3300042609 Bacteria 3553
153 Ga0466735_014248 3300042624 Unclassified 4331
154 Ga0466735_198713 3300042624 Bacteria 1345
155 Ga0466703_331515 3300042636 Bacteria 4192
156 Ga0466727_174727 3300042655 Bacteria 2165
157 Ga0466693_106972 3300042592 Bacteria 1519
158 Ga0466691_007209 3300042593 Bacteria 1242
159 Ga0466696_362103 3300042596 Bacteria 1517
160 IMNBL1DRAFT_c0000639 3300000062 Bacteria 28033
161 Ga0466710_186610 3300042613 Bacteria 1387
162 Ga0466715_024662 3300042616 Bacteria 23560
163 Ga0466726_301839 3300042619 Bacteria 1981
164 Ga0466728_192774 3300042620 Bacteria 2170
165 Ga0466729_167110 3300042621 Bacteria 6450
166 Ga0466701_081324 3300042598 Bacteria 1057
167 Ga0466701_099047 3300042598 Bacteria 3735
168 Ga0466706_219638 3300042599 Bacteria 29525
169 Ga0466707_213815 3300042601 Bacteria 28177
170 Ga0466698_480019 3300042610 Bacteria 1633
171 Ga0466729_206008 3300042621 Bacteria 4714
172 Ga0466735_020891 3300042624 Unclassified 1059
173 Ga0466702_457741 3300042635 Bacteria 2667
174 Ga0466704_076792 3300042643 Bacteria 27953
175 Ga0466704_231274 3300042643 Unclassified 2808
176 Ga0466709_240281 3300042648 Bacteria 1041
177 Ga0466725_442121 3300042654 Bacteria 1915
178 Ga0466727_218944 3300042655 Bacteria 1219
179 Ga0466727_254850 3300042655 Bacteria 2666
180 Ga0466727_280584 3300042655 Bacteria 2239
181 Ga0466692_037403 3300042591 Bacteria 10167
182 Ga0466694_082521 3300042594 Bacteria 1067
183 Ga0466696_460737 3300042596 Bacteria 5297
184 JGI24698J34947_10058733 3300002449 Bacteria 1904
185 JGI24702J35022_10000164 3300002462 Bacteria 34496

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300009784 Ga0123357_10581943 Ga0123357_105819431 220
2 3300038395 Ga0415639_088166 Ga0415639_088166_591_1256 221
3 3300042590 Ga0466690_246245 Ga0466690_246245_127_792 221
4 3300042591 Ga0466692_168144 Ga0466692_168144_4103_4768 221
5 3300042593 Ga0466691_026137 Ga0466691_026137_1141_1806 221
6 3300042598 Ga0466701_081324 Ga0466701_081324_16_681 221
7 3300042601 Ga0466707_177041 Ga0466707_177041_4094_4759 221
8 3300042602 Ga0466713_100108 Ga0466713_100108_1239_1904 221
9 3300042605 Ga0466716_272319 Ga0466716_272319_2426_3091 221
10 3300042606 Ga0466719_353782 Ga0466719_353782_48_713 221
11 3300042615 Ga0466711_376431 Ga0466711_376431_39253_39918 221
12 3300042618 Ga0466723_203988 Ga0466723_203988_402_1067 221
13 3300042619 Ga0466726_025306 Ga0466726_025306_3082_3774 221
14 3300042621 Ga0466729_298027 Ga0466729_298027_1811_2476 221
15 3300042622 Ga0466731_094150 Ga0466731_094150_12131_12796 221
16 3300042643 Ga0466704_231274 Ga0466704_231274_1944_2609 221
17 3300042655 Ga0466727_174727 Ga0466727_174727_746_1411 221
18 3300042659 Ga0466733_145421 Ga0466733_145421_40_705 221
19 3300000062 IMNBL1DRAFT_c0000639 IMNBL1DRAFT_00006393 222
20 3300010167 Ga0123353_10043922 Ga0123353_100439228 222
21 3300042592 Ga0466693_106972 Ga0466693_106972_413_1081 222
22 3300005201 Ga0072941_1004007 Ga0072941_100400734 223
23 3300042614 Ga0466712_016163 Ga0466712_016163_1222_1893 223
24 3300042592 Ga0466693_267555 Ga0466693_267555_173_847 224
25 3300042601 Ga0466707_051106 Ga0466707_051106_2928_3602 224
26 3300042602 Ga0466713_114885 Ga0466713_114885_20381_21055 224
27 3300042606 Ga0466719_083211 Ga0466719_083211_524_1198 224
28 3300042607 Ga0466720_100020 Ga0466720_100020_7136_7810 224
29 3300042616 Ga0466715_119601 Ga0466715_119601_16_690 224
30 3300042619 Ga0466726_128587 Ga0466726_128587_3339_4013 224
31 3300042623 Ga0466734_081512 Ga0466734_081512_860_1534 224
32 3300042624 Ga0466735_072733 Ga0466735_072733_976_1650 224
33 3300042624 Ga0466735_188098 Ga0466735_188098_16_690 224
34 3300042655 Ga0466727_218944 Ga0466727_218944_253_927 224
35 3300042655 Ga0466727_254850 Ga0466727_254850_1742_2416 224
36 3300010049 Ga0123356_10867161 Ga0123356_108671612 225
37 3300010167 Ga0123353_10179296 Ga0123353_101792962 225
38 3300010167 Ga0123353_10317576 Ga0123353_103175762 225
39 3300010167 Ga0123353_10324004 Ga0123353_103240044 225
40 3300042599 Ga0466706_133216 Ga0466706_133216_69_770 225
41 iso_pr_bacteria 2740892547 2743913114 226
42 3300042612 Ga0466705_422882 Ga0466705_422882_347_1036 229
43 3300042624 Ga0466735_189863 Ga0466735_189863_288_977 229
44 3300005071 Ga0068302_10040336 Ga0068302_1004033611 230
45 3300042591 Ga0466692_037403 Ga0466692_037403_449_1141 230
46 3300042594 Ga0466694_082023 Ga0466694_082023_72_764 230
47 3300042594 Ga0466694_082521 Ga0466694_082521_72_764 230
48 3300042596 Ga0466696_362103 Ga0466696_362103_441_1133 230
49 3300042596 Ga0466696_365074 Ga0466696_365074_834_1526 230
50 3300042596 Ga0466696_460737 Ga0466696_460737_742_1434 230
51 3300042597 Ga0466699_188267 Ga0466699_188267_940_1632 230
52 3300042599 Ga0466706_211464 Ga0466706_211464_4275_4967 230
53 3300042599 Ga0466706_260242 Ga0466706_260242_3396_4088 230
54 3300042601 Ga0466707_009194 Ga0466707_009194_6529_7221 230
55 3300042601 Ga0466707_197521 Ga0466707_197521_2340_3032 230
56 3300042601 Ga0466707_213815 Ga0466707_213815_3996_4688 230
57 3300042601 Ga0466707_252337 Ga0466707_252337_2887_3579 230
58 3300042601 Ga0466707_357269 Ga0466707_357269_1752_2444 230
59 3300042601 Ga0466707_405512 Ga0466707_405512_625_1317 230
60 3300042602 Ga0466713_013389 Ga0466713_013389_22_714 230
61 3300042603 Ga0466714_011689 Ga0466714_011689_24447_25139 230
62 3300042603 Ga0466714_032413 Ga0466714_032413_1310_2002 230
63 3300042603 Ga0466714_141473 Ga0466714_141473_11210_11902 230
64 3300042604 Ga0466717_158828 Ga0466717_158828_541_1233 230
65 3300042606 Ga0466719_479846 Ga0466719_479846_1651_2343 230
66 3300042609 Ga0466722_064425 Ga0466722_064425_27944_28636 230
67 3300042609 Ga0466722_121337 Ga0466722_121337_18637_19329 230
68 3300042610 Ga0466698_453437 Ga0466698_453437_173_865 230
69 3300042610 Ga0466698_480019 Ga0466698_480019_487_1179 230
70 3300042611 Ga0466697_129394 Ga0466697_129394_161_853 230
71 3300042612 Ga0466705_006684 Ga0466705_006684_296_988 230
72 3300042612 Ga0466705_244644 Ga0466705_244644_208_900 230
73 3300042612 Ga0466705_357180 Ga0466705_357180_145_837 230
74 3300042612 Ga0466705_358529 Ga0466705_358529_646_1338 230
75 3300042612 Ga0466705_504428 Ga0466705_504428_366_1058 230
76 3300042613 Ga0466710_091057 Ga0466710_091057_213_905 230
77 3300042614 Ga0466712_187039 Ga0466712_187039_5737_6429 230
78 3300042616 Ga0466715_001151 Ga0466715_001151_6733_7425 230
79 3300042616 Ga0466715_018828 Ga0466715_018828_3192_3884 230
80 3300042616 Ga0466715_024662 Ga0466715_024662_21221_21913 230
81 3300042616 Ga0466715_466052 Ga0466715_466052_204_896 230
82 3300042619 Ga0466726_321841 Ga0466726_321841_23472_24164 230
83 3300042620 Ga0466728_192774 Ga0466728_192774_130_822 230
84 3300042621 Ga0466729_167110 Ga0466729_167110_40_732 230
85 3300042621 Ga0466729_206008 Ga0466729_206008_517_1209 230
86 3300042622 Ga0466731_153018 Ga0466731_153018_1004_1696 230
87 3300042622 Ga0466731_256925 Ga0466731_256925_649_1341 230
88 3300042623 Ga0466734_136644 Ga0466734_136644_381_1073 230
89 3300042635 Ga0466702_431578 Ga0466702_431578_302_994 230
90 3300042635 Ga0466702_457741 Ga0466702_457741_1558_2250 230
91 3300042636 Ga0466703_062258 Ga0466703_062258_12100_12792 230
92 3300042636 Ga0466703_214791 Ga0466703_214791_518_1210 230
93 3300042636 Ga0466703_232610 Ga0466703_232610_120_812 230
94 3300042636 Ga0466703_331515 Ga0466703_331515_2825_3517 230
95 3300042643 Ga0466704_038953 Ga0466704_038953_931_1623 230
96 3300042643 Ga0466704_068859 Ga0466704_068859_2727_3419 230
97 3300042643 Ga0466704_252044 Ga0466704_252044_827_1519 230
98 3300042643 Ga0466704_457394 Ga0466704_457394_1418_2110 230
99 3300042652 Ga0466708_282915 Ga0466708_282915_1726_2418 230
100 3300042652 Ga0466708_301714 Ga0466708_301714_1391_2083 230
101 3300042654 Ga0466725_442121 Ga0466725_442121_282_974 230
102 3300042655 Ga0466727_145543 Ga0466727_145543_739_1431 230
103 3300042655 Ga0466727_284870 Ga0466727_284870_1752_2444 230
104 3300042655 Ga0466727_317733 Ga0466727_317733_1684_2376 230
105 iso_pr_bacteria 2781125651 2781310621 230
106 iso_pr_bacteria 2820001644 2820002233 230
107 iso_pr_bacteria 2820007728 2820007886 230
108 iso_pr_bacteria 2820044805 2820046239 230
109 iso_pr_bacteria 2820272499 2820274285 230
110 iso_pr_bacteria 2820272499 2820275291 230
111 iso_pr_bacteria 2820277137 2820279945 230
112 iso_pr_bacteria 2820357977 2820358318 230
113 iso_pr_bacteria 2820412446 2820413046 230
114 iso_pr_bacteria 2820507989 2820509615 230
115 iso_pr_bacteria 2820740053 2820741242 230
116 iso_pr_bacteria 2820767225 2820768202 230
117 iso_pr_bacteria 2820772500 2820772889 230
118 iso_pr_bacteria 2820789850 2820791733 230
119 iso_pr_bacteria 2923982719 2923983640 230
120 iso_pr_bacteria 2940202316 2940204651 230
121 iso_pr_bacteria 2940371297 2940371571 230
122 3300002449 JGI24698J34947_10058733 JGI24698J34947_100587332 231
123 3300002462 JGI24702J35022_10000164 JGI24702J35022_1000016410 231
124 3300002462 JGI24702J35022_10011274 JGI24702J35022_100112746 231
125 3300002462 JGI24702J35022_10043948 JGI24702J35022_100439482 231
126 3300005201 Ga0072941_1016621 Ga0072941_10166212 231
127 3300005201 Ga0072941_1016622 Ga0072941_10166223 231
128 3300005201 Ga0072941_1269176 Ga0072941_12691762 231
129 3300009784 Ga0123357_10038466 Ga0123357_100384664 231
130 3300009784 Ga0123357_10237198 Ga0123357_102371982 231
131 3300009784 Ga0123357_10661808 Ga0123357_106618081 231
132 3300010049 Ga0123356_10187739 Ga0123356_101877391 231
133 3300010049 Ga0123356_10611759 Ga0123356_106117592 231
134 3300010049 Ga0123356_10800459 Ga0123356_108004592 231
135 3300010167 Ga0123353_10014647 Ga0123353_1001464712 231
136 3300010167 Ga0123353_10294188 Ga0123353_102941882 231
137 3300010167 Ga0123353_10351856 Ga0123353_103518562 231
138 3300010167 Ga0123353_10870865 Ga0123353_108708652 231
139 3300010167 Ga0123353_11121745 Ga0123353_111217452 231
140 3300010882 Ga0123354_10013040 Ga0123354_1001304013 231
141 3300010882 Ga0123354_10459872 Ga0123354_104598722 231
142 3300042614 Ga0466712_234008 Ga0466712_234008_60_755 231
143 3300010049 Ga0123356_10073023 Ga0123356_100730233 232
144 2030936001 Nasutiter_Contig16724 Nasutiterm_1416350 233
145 3300002449 JGI24698J34947_10057131 JGI24698J34947_100571313 233
146 3300024493 Ga0264413_122069 Ga0264413_1220694 233
147 3300042591 Ga0466692_033982 Ga0466692_033982_240_941 233
148 3300042591 Ga0466692_097561 Ga0466692_097561_22262_22963 233
149 3300042596 Ga0466696_170163 Ga0466696_170163_647_1348 233
150 3300042599 Ga0466706_075947 Ga0466706_075947_21_722 233
151 3300042601 Ga0466707_280907 Ga0466707_280907_941_1642 233
152 3300042606 Ga0466719_541623 Ga0466719_541623_1080_1781 233
153 3300042607 Ga0466720_015515 Ga0466720_015515_10396_11097 233
154 3300042607 Ga0466720_150015 Ga0466720_150015_21995_22696 233
155 3300042608 Ga0466721_285597 Ga0466721_285597_1781_2482 233
156 3300042609 Ga0466722_023576 Ga0466722_023576_542_1243 233
157 3300042610 Ga0466698_421500 Ga0466698_421500_169_870 233
158 3300042616 Ga0466715_568039 Ga0466715_568039_2359_3060 233
159 3300042617 Ga0466718_110244 Ga0466718_110244_656_1357 233
160 3300042619 Ga0466726_209537 Ga0466726_209537_627_1328 233
161 3300042619 Ga0466726_301839 Ga0466726_301839_1063_1764 233
162 3300042619 Ga0466726_413375 Ga0466726_413375_373_1074 233
163 3300042620 Ga0466728_255535 Ga0466728_255535_554_1255 233
164 3300042621 Ga0466729_266214 Ga0466729_266214_20730_21431 233
165 3300042624 Ga0466735_011609 Ga0466735_011609_644_1345 233
166 3300042624 Ga0466735_014248 Ga0466735_014248_3606_4307 233
167 3300042624 Ga0466735_020891 Ga0466735_020891_277_978 233
168 3300042624 Ga0466735_043479 Ga0466735_043479_516_1217 233
169 3300042624 Ga0466735_065887 Ga0466735_065887_18_719 233
170 3300042624 Ga0466735_163031 Ga0466735_163031_335_1036 233
171 3300042624 Ga0466735_198713 Ga0466735_198713_485_1186 233
172 3300042624 Ga0466735_208290 Ga0466735_208290_1180_1881 233
173 3300042643 Ga0466704_076792 Ga0466704_076792_3458_4159 233
174 3300042648 Ga0466709_166642 Ga0466709_166642_1583_2284 233
175 3300042648 Ga0466709_240281 Ga0466709_240281_222_923 233
176 3300042655 Ga0466727_035395 Ga0466727_035395_488_1189 233
177 3300042655 Ga0466727_122834 Ga0466727_122834_1091_1792 233
178 3300042655 Ga0466727_280584 Ga0466727_280584_1463_2164 233
179 3300042655 Ga0466727_302838 Ga0466727_302838_107_808 233
180 3300042655 Ga0466727_321802 Ga0466727_321802_2892_3593 233
181 3300042655 Ga0466727_349859 Ga0466727_349859_149_850 233
182 iso_pr_bacteria 2967483437 2967485485 233
183 3300000089 AustNasuHG_c1000806 AustNasuHG_10008066 234
184 3300000089 AustNasuHG_c1004179 AustNasuHG_10041796 234
185 3300002462 JGI24702J35022_10136621 JGI24702J35022_101366212 234
186 3300042593 Ga0466691_007209 Ga0466691_007209_287_991 234
187 3300042601 Ga0466707_400679 Ga0466707_400679_1452_2156 234
188 3300042599 Ga0466706_147616 Ga0466706_147616_2064_2771 235
189 3300042613 Ga0466710_186610 Ga0466710_186610_60_770 236
190 2225789004 2227289989 2227741006 237
191 3300042598 Ga0466701_099047 Ga0466701_099047_2188_2901 237
192 3300042603 Ga0466714_140401 Ga0466714_140401_596_1309 237
193 iso_pr_bacteria 2820209022 2820209725 237
194 iso_pr_bacteria 2820211246 2820212381 237
195 iso_pr_bacteria 2820215626 2820216844 237
196 3300002462 JGI24702J35022_10004580 JGI24702J35022_100045802 238
197 3300010049 Ga0123356_10902221 Ga0123356_109022211 238
198 3300010167 Ga0123353_10020281 Ga0123353_100202812 238
199 3300010167 Ga0123353_10887308 Ga0123353_108873082 238
200 3300042620 Ga0466728_162625 Ga0466728_162625_156_875 239
201 3300042652 Ga0466708_088051 Ga0466708_088051_16249_16968 239
202 3300042619 Ga0466726_315074 Ga0466726_315074_908_1630 240
203 3300042619 Ga0466726_413471 Ga0466726_413471_2427_3149 240
204 3300042649 Ga0466724_30294 Ga0466724_30294_1434_2162 242
205 3300042655 Ga0466727_343331 Ga0466727_343331_1258_1986 242
206 3300042599 Ga0466706_219638 Ga0466706_219638_13766_14554 262
207 3300042648 Ga0466709_026774 Ga0466709_026774_210_1019 269

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.62 0.73 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.