Protein Family IF09555

Metagenome Isolate
177 Members
75 Samples
157 Scaffolds
310.85 Avg Length

🧬 Representative Sequence

ID
3300042648|Ga0466709_015908|Ga0466709_015908_15014_16066
Length
350 aa
Sequence
VEKTDKIFFDDRQFLDLKHISQEKVQQLSEKFSENYLPDKITKTLLITGIHGFVGSNLVSTLKENHRIYGLDIIFPEKEGVVKTYAWNDINNLPEIDTVIHLAGKAHDTKNQTKAQVYFDVNTGLTRQIFDYFLQSKAKKFIFFSSVKAAADSVEGDYLTENVVPKPVGPYGESKIKAEEYIQSKDWKGKSVYILRPCMIHGPGNKGNLNLLYHVVAKGIPWPLGAFDNLRSYMNIWNLSYIIEQLFILKNPESGIYHLADDEPLSTNELIELIAASKTQKARIWKINKSMVRAIAQIGTVCKFPLNSERLRKLTENYVVSNQKMKQALNITRLPVDVQTGLKRTLKTFD

📊 Sample Types

Isolate 11.3%
Metagenome 88.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 23.9%
Kalotermitidae 16.9%
Unclassified 9.9%
Blattidae 9.9%
Elmidae 7.0%
Drosophilidae 7.0%
Formicidae 5.6%
Armadillidiidae 5.6%
Rhinotermitidae 4.2%
Termopsidae 4.2%
Hodotermitidae 1.4%
Passalidae 1.4%
Culicidae 1.4%
Cambaridae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 172
Eukaryota 0
Viruses 1
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
2 2898741527 Sphingobacterium sp. xlx-73 Isolate
3 2904728850 Flavobacterium sp. xlx-214 Isolate
4 2820211246 Unclassified Kiritimatiellaeota Nt197P3bin96 Isolate Unclassified
5 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
6 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
7 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
8 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
9 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
10 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
11 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
12 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
13 2864822740 Chryseobacterium shigense S00064 Isolate Elmidae
14 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
15 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
16 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
17 3300005309 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut Metagenome Drosophilidae
18 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
19 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
20 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
21 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
22 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
23 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
24 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
25 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
26 3004667792 Bacteroides sp. 519 Isolate Blattidae
27 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
28 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
29 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
30 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
31 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
32 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
33 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
34 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
35 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
36 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
37 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
38 650716102 Treponema primitia ZAS-2 Isolate Unclassified
39 2922326829 Bacteroides sp. 224 Isolate Blattidae
40 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
41 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
42 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
43 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
44 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
45 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
46 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
47 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
48 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
49 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
50 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
51 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
52 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
53 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
54 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
55 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
56 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
57 2864882932 Chryseobacterium shingense S00136 Isolate Elmidae
58 2864891731 Chryseobacterium defluvii S00151 Isolate Elmidae
59 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
60 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
61 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
62 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
63 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
64 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
65 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
66 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
67 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
68 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
69 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
70 2958471994 Flavobacterium sp. xlx-221 Isolate Cambaridae
71 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
72 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
73 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
74 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
75 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0160456_100073 3300012820 Bacteria 140854
2 Ga0160433_100043 3300012846 Bacteria 143692
3 Ga0466701_100538 3300042598 Bacteria 12874
4 Ga0466706_018100 3300042599 Bacteria 3524
5 Ga0466706_039353 3300042599 Bacteria 9088
6 Ga0466706_149761 3300042599 Bacteria 6449
7 Ga0466706_224510 3300042599 Bacteria 4579
8 Ga0466722_064705 3300042609 Bacteria 14111
9 Ga0123353_10077421 3300010167 Bacteria 5344
10 Ga0160454_100001 3300012798 Bacteria 780029
11 Ga0466711_214944 3300042615 Bacteria 2428
12 Ga0466711_310422 3300042615 Bacteria 12503
13 Ga0466715_100449 3300042616 Bacteria 3434
14 Ga0466715_126324 3300042616 Bacteria 2781
15 Ga0466715_518763 3300042616 Bacteria 23012
16 Ga0466715_554056 3300042616 Bacteria 2296
17 Ga0466735_097210 3300042624 Bacteria 2462
18 Ga0466703_085787 3300042636 Bacteria 11982
19 Ga0466704_166854 3300042643 Bacteria 12030
20 Ga0466704_391168 3300042643 Bacteria 1791
21 Ga0466708_015955 3300042652 Bacteria 14274
22 Ga0466727_267487 3300042655 Bacteria 1531
23 Ga0466705_116899 3300042612 Bacteria 2462
24 Ga0466692_024501 3300042591 Bacteria 1813
25 Ga0466701_002126 3300042598 Bacteria 117947
26 Ga0466701_079539 3300042598 Bacteria 22402
27 Ga0466706_086713 3300042599 Bacteria 3795
28 Ga0466707_365436 3300042601 Bacteria 3160
29 Ga0466713_041347 3300042602 Bacteria 10486
30 Ga0466719_420064 3300042606 Bacteria 1843
31 Ga0123353_10659363 3300010167 Viruses 1479
32 Ga0123354_10030511 3300010882 Bacteria 8465
33 Ga0466711_043169 3300042615 Bacteria 4174
34 Ga0466711_452583 3300042615 Bacteria 4894
35 Ga0466728_019567 3300042620 Bacteria 33080
36 Ga0466729_051607 3300042621 Bacteria 2994
37 Ga0466735_075500 3300042624 Bacteria 1392
38 Ga0466709_015908 3300042648 Bacteria 26155
39 Ga0466709_028387 3300042648 Bacteria 7453
40 Ga0466724_12587 3300042649 Bacteria 88953
41 JGI24695J34938_10000176 3300002450 Bacteria 59497
42 Ga0102740_1000067 3300007140 Bacteria 24972
43 Ga0104048_1000555 3300007143 Bacteria 3766
44 Ga0104050_1200024 3300007153 Bacteria 2878
45 Ga0466705_220935 3300042612 Bacteria 1915
46 Ga0466733_216697 3300042659 Bacteria 189231
47 Ga0160452_101490 3300012834 Bacteria 6601
48 Ga0160445_103443 3300012847 Bacteria 3200
49 Ga0466690_183075 3300042590 Bacteria 4123
50 Ga0466696_081931 3300042596 Bacteria 3884
51 Ga0466696_160975 3300042596 Bacteria 24065
52 Ga0466696_274671 3300042596 Bacteria 1684
53 Ga0466700_047546 3300042600 Bacteria 23188
54 Ga0123354_10000040 3300010882 Bacteria 96699
55 Ga0123354_10074067 3300010882 Unclassified 4882
56 Ga0123354_10092502 3300010882 Bacteria 4165
57 Ga0123354_10215861 3300010882 Bacteria 2056
58 Ga0160470_100009 3300012813 Bacteria 464402
59 Ga0466715_002453 3300042616 Bacteria 7344
60 Ga0466715_627357 3300042616 Bacteria 3642
61 Ga0466735_017443 3300042624 Bacteria 11029
62 Ga0466703_014911 3300042636 Bacteria 3248
63 Ga0466703_058654 3300042636 Bacteria 2525
64 Ga0466703_086245 3300042636 Bacteria 1640
65 Ga0466703_202952 3300042636 Bacteria 11287
66 Ga0466703_267770 3300042636 Bacteria 2956
67 Ga0466704_603890 3300042643 Bacteria 12803
68 Ga0466727_136591 3300042655 Bacteria 7889
69 Ga0074306_1118214 3300005309 Bacteria 1925
70 Ga0104045_1004290 3300007085 Unclassified 32662
71 Ga0123357_10001089 3300009784 Bacteria 28059
72 Ga0466690_345763 3300042590 Bacteria 4854
73 Ga0466695_011506 3300042595 Bacteria 2072
74 Ga0123357_10290989 3300009784 Bacteria 1668
75 Ga0123355_10000009 3300009826 Bacteria 191038
76 Ga0123355_10000055 3300009826 Bacteria 117901
77 Ga0123354_10000215 3300010882 Bacteria 50589
78 Ga0466711_253778 3300042615 Bacteria 2108
79 Ga0466726_205975 3300042619 Bacteria 5828
80 Ga0466735_033348 3300042624 Bacteria 1867
81 Ga0466703_135494 3300042636 Bacteria 14367
82 Ga0466703_167500 3300042636 Bacteria 4970
83 Ga0466704_035787 3300042643 Bacteria 7190
84 Ga0466704_057265 3300042643 Bacteria 2659
85 Ga0466704_259531 3300042643 Bacteria 11030
86 IMNBL1DRAFT_c0005330 3300000062 Bacteria 7388
87 IMNBL1DRAFT_c0005406 3300000062 Bacteria 7313
88 JGI24702J35022_10015250 3300002462 Bacteria 4233
89 JGI24696J40584_12960867 3300002834 Bacteria 8988
90 CVPL010W_10002017 3300002931 Bacteria 31687
91 Ga0466692_198062 3300042591 Bacteria 1041
92 Ga0466696_076618 3300042596 Bacteria 13302
93 Ga0466696_196820 3300042596 Bacteria 5079
94 Ga0466696_347653 3300042596 Bacteria 1678
95 Ga0466701_074699 3300042598 Bacteria 21879
96 Ga0466705_470511 3300042612 Bacteria 1419
97 Ga0466711_274108 3300042615 Bacteria 11545
98 Ga0466715_014268 3300042616 Bacteria 21507
99 Ga0466728_176805 3300042620 Bacteria 1609
100 Ga0466729_082242 3300042621 Bacteria 5226
101 Ga0466729_238467 3300042621 Bacteria 1231
102 Ga0466704_186789 3300042643 Bacteria 2327
103 Ga0466704_202557 3300042643 Bacteria 2217
104 IMNBL1DRAFT_c0000063 3300000062 Bacteria 97352
105 JGI24699J35502_11133708 3300002509 Bacteria 13934
106 Ga0160433_101860 3300012846 Bacteria 5124
107 Ga0466657_153142 3300042582 Bacteria 1698
108 Ga0466692_139416 3300042591 Bacteria 1154
109 Ga0466693_428997 3300042592 Bacteria 2213
110 Ga0466701_040622 3300042598 Bacteria 282607
111 Ga0466706_083884 3300042599 Bacteria 22267
112 Ga0466700_332393 3300042600 Bacteria 18740
113 Ga0466707_370636 3300042601 Bacteria 22490
114 Ga0466722_004630 3300042609 Bacteria 3116
115 Ga0466722_017622 3300042609 Bacteria 3167
116 Ga0123357_10082312 3300009784 Bacteria 4227
117 Ga0466711_108610 3300042615 Bacteria 4010
118 Ga0466723_016957 3300042618 Bacteria 3510
119 Ga0466726_057973 3300042619 Bacteria 4069
120 Ga0466726_492028 3300042619 Bacteria 2741
121 Ga0466734_030989 3300042623 Bacteria 1577
122 Ga0466724_08812 3300042649 Bacteria 122658
123 Ga0103263_103216 3300007042 Bacteria 1963
124 Ga0104050_1033489 3300007153 Bacteria 3423
125 Ga0123357_10000737 3300009784 Bacteria 32968
126 Ga0466733_167068 3300042659 Bacteria 13722
127 Ga0466692_180919 3300042591 Bacteria 1058
128 Ga0466701_093289 3300042598 Bacteria 14763
129 Ga0466706_168917 3300042599 Bacteria 75730
130 Ga0466719_090469 3300042606 Bacteria 2315
131 Ga0466719_344739 3300042606 Bacteria 2601
132 Ga0466719_448477 3300042606 Bacteria 1521
133 Ga0466698_266299 3300042610 Bacteria 1281
134 Ga0466711_071277 3300042615 Bacteria 7742
135 Ga0466735_133352 3300042624 Bacteria 6024
136 Ga0466704_378746 3300042643 Bacteria 4294
137 Ga0466704_590855 3300042643 Bacteria 2596
138 Ga0466708_053368 3300042652 Bacteria 11241
139 Ga0466727_277193 3300042655 Bacteria 1721
140 Ga0102735_1000427 3300007080 Bacteria 14017
141 Ga0104045_1001234 3300007085 Unclassified 12353
142 Ga0104048_1025218 3300007143 Unclassified 3160
143 Ga0104019_1003029 3300007150 Bacteria 4668
144 Ga0123357_10000423 3300009784 Bacteria 40429
145 Ga0160444_106478 3300012841 Bacteria 1525
146 Ga0160445_100287 3300012847 Bacteria 32890
147 Ga0160445_100453 3300012847 Bacteria 21164
148 Ga0466690_132253 3300042590 Bacteria 7282
149 Ga0466707_245048 3300042601 Bacteria 33561
150 Ga0123354_10001156 3300010882 Bacteria 30896
151 Ga0466711_433741 3300042615 Bacteria 1897
152 Ga0466726_360780 3300042619 Bacteria 2740
153 Ga0466726_434840 3300042619 Bacteria 2934
154 Ga0466724_37932 3300042649 Bacteria 325221
155 Ga0466724_60383 3300042649 Bacteria 43950
156 Ga0466727_172594 3300042655 Bacteria 4463
157 Ga0104045_1075457 3300007085 Bacteria 1968

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300012841 Ga0160444_106478 Ga0160444_1064782 264
2 3300007143 Ga0104048_1025218 Ga0104048_10252182 267
3 3300042612 Ga0466705_470511 Ga0466705_470511_562_1407 281
4 3300042616 Ga0466715_126324 Ga0466715_126324_117_1058 290
5 3300042643 Ga0466704_603890 Ga0466704_603890_1329_2258 292
6 3300012820 Ga0160456_100073 Ga0160456_10007368 294
7 3300009784 Ga0123357_10290989 Ga0123357_102909892 295
8 3300002462 JGI24702J35022_10015250 JGI24702J35022_100152502 296
9 iso_pr_bacteria 2904728850 2904729245 296
10 iso_pr_bacteria 2958471994 2958472488 296
11 3300042598 Ga0466701_040622 Ga0466701_040622_232131_233027 298
12 3300042636 Ga0466703_085787 Ga0466703_085787_643_1539 298
13 iso_pr_bacteria 2864891731 2864893200 298
14 3300042620 Ga0466728_019567 Ga0466728_019567_17525_18481 299
15 3300042636 Ga0466703_014911 Ga0466703_014911_1555_2454 299
16 iso_pr_bacteria 2864822740 2864825992 299
17 iso_pr_bacteria 2864882932 2864886601 299
18 3300012846 Ga0160433_101860 Ga0160433_1018603 300
19 3300042596 Ga0466696_274671 Ga0466696_274671_753_1655 300
20 3300005309 Ga0074306_1118214 Ga0074306_11182142 301
21 3300007080 Ga0102735_1000427 Ga0102735_10004273 301
22 3300012834 Ga0160452_101490 Ga0160452_1014907 301
23 3300012847 Ga0160445_100287 Ga0160445_10028711 301
24 3300042598 Ga0466701_002126 Ga0466701_002126_70866_71771 301
25 3300042598 Ga0466701_093289 Ga0466701_093289_12317_13222 301
26 3300042619 Ga0466726_205975 Ga0466726_205975_2542_3507 301
27 3300042649 Ga0466724_12587 Ga0466724_12587_44661_45566 301
28 3300007042 Ga0103263_103216 Ga0103263_1032162 302
29 3300007085 Ga0104045_1001234 Ga0104045_10012342 302
30 3300007085 Ga0104045_1075457 Ga0104045_10754572 302
31 3300007140 Ga0102740_1000067 Ga0102740_100006722 302
32 3300007143 Ga0104048_1000555 Ga0104048_10005552 302
33 3300007153 Ga0104050_1033489 Ga0104050_10334892 302
34 3300007153 Ga0104050_1200024 Ga0104050_12000243 302
35 3300042598 Ga0466701_074699 Ga0466701_074699_19228_20136 302
36 3300042649 Ga0466724_37932 Ga0466724_37932_133207_134115 302
37 iso_pr_bacteria 2898741527 2898745199 302
38 3300007085 Ga0104045_1004290 Ga0104045_10042903 303
39 3300007150 Ga0104019_1003029 Ga0104019_10030293 303
40 3300042636 Ga0466703_135494 Ga0466703_135494_7494_8405 303
41 3300042649 Ga0466724_08812 Ga0466724_08812_102850_103761 303
42 3300012813 Ga0160470_100009 Ga0160470_100009297 304
43 3300012846 Ga0160433_100043 Ga0160433_10004318 304
44 3300042598 Ga0466701_079539 Ga0466701_079539_7409_8323 304
45 3300042624 Ga0466735_075500 Ga0466735_075500_245_1225 304
46 3300042643 Ga0466704_590855 Ga0466704_590855_1291_2229 304
47 3300042659 Ga0466733_167068 Ga0466733_167068_7439_8377 304
48 iso_pr_bacteria 2864878056 2864881726 304
49 iso_pr_bacteria 2864886855 2864890636 304
50 3300042636 Ga0466703_058654 Ga0466703_058654_191_1108 305
51 3300042636 Ga0466703_167500 Ga0466703_167500_194_1111 305
52 3300042636 Ga0466703_202952 Ga0466703_202952_910_1827 305
53 3300042649 Ga0466724_60383 Ga0466724_60383_36127_37044 305
54 3300012798 Ga0160454_100001 Ga0160454_100001429 306
55 3300042612 Ga0466705_220935 Ga0466705_220935_791_1711 306
56 3300042624 Ga0466735_133352 Ga0466735_133352_2587_3507 306
57 3300042655 Ga0466727_267487 Ga0466727_267487_342_1262 306
58 iso_pr_bacteria 650716102 650880987 306
59 3300042590 Ga0466690_345763 Ga0466690_345763_66_989 307
60 3300042599 Ga0466706_149761 Ga0466706_149761_950_1873 307
61 3300042652 Ga0466708_053368 Ga0466708_053368_1063_1986 307
62 3300042599 Ga0466706_083884 Ga0466706_083884_21005_21931 308
63 3300042609 Ga0466722_004630 Ga0466722_004630_1025_1951 308
64 3300042616 Ga0466715_002453 Ga0466715_002453_5441_6367 308
65 3300042616 Ga0466715_100449 Ga0466715_100449_2121_3047 308
66 3300042590 Ga0466690_132253 Ga0466690_132253_5390_6319 309
67 3300042612 Ga0466705_116899 Ga0466705_116899_998_1927 309
68 3300042618 Ga0466723_016957 Ga0466723_016957_1773_2702 309
69 3300042643 Ga0466704_035787 Ga0466704_035787_613_1542 309
70 3300042643 Ga0466704_186789 Ga0466704_186789_347_1276 309
71 3300042643 Ga0466704_202557 Ga0466704_202557_200_1129 309
72 3300042643 Ga0466704_378746 Ga0466704_378746_330_1259 309
73 iso_pr_bacteria 2820741847 2820743530 309
74 3300012847 Ga0160445_103443 Ga0160445_1034433 310
75 3300042596 Ga0466696_347653 Ga0466696_347653_723_1655 310
76 3300042599 Ga0466706_018100 Ga0466706_018100_2080_3045 310
77 3300042621 Ga0466729_051607 Ga0466729_051607_557_1489 310
78 3300042636 Ga0466703_267770 Ga0466703_267770_1818_2750 310
79 3300042652 Ga0466708_015955 Ga0466708_015955_4438_5370 310
80 iso_pr_bacteria 2910949487 2910952332 310
81 3300010167 Ga0123353_10659363 Ga0123353_106593632 311
82 3300042591 Ga0466692_024501 Ga0466692_024501_722_1657 311
83 3300042595 Ga0466695_011506 Ga0466695_011506_1073_2008 311
84 3300042601 Ga0466707_370636 Ga0466707_370636_7415_8350 311
85 3300042609 Ga0466722_064705 Ga0466722_064705_960_1895 311
86 3300000062 IMNBL1DRAFT_c0000063 IMNBL1DRAFT_000006326 312
87 3300042591 Ga0466692_180919 Ga0466692_180919_18_956 312
88 3300042599 Ga0466706_086713 Ga0466706_086713_1569_2507 312
89 3300042606 Ga0466719_344739 Ga0466719_344739_966_1904 312
90 3300042615 Ga0466711_310422 Ga0466711_310422_2663_3601 312
91 3300042616 Ga0466715_627357 Ga0466715_627357_2037_2975 312
92 3300042621 Ga0466729_082242 Ga0466729_082242_1549_2487 312
93 3300042648 Ga0466709_028387 Ga0466709_028387_1109_2047 312
94 3300042659 Ga0466733_216697 Ga0466733_216697_173813_174751 312
95 iso_pr_bacteria 2940244548 2940245241 312
96 iso_pr_bacteria 2940248789 2940249481 312
97 iso_pr_bacteria 2940253009 2940253591 312
98 iso_pr_bacteria 2940257232 2940257446 312
99 3300012847 Ga0160445_100453 Ga0160445_1004535 313
100 3300042596 Ga0466696_160975 Ga0466696_160975_1385_2326 313
101 3300042599 Ga0466706_224510 Ga0466706_224510_3128_4069 313
102 3300042602 Ga0466713_041347 Ga0466713_041347_2930_3871 313
103 3300042615 Ga0466711_253778 Ga0466711_253778_124_1065 313
104 3300042615 Ga0466711_433741 Ga0466711_433741_482_1423 313
105 3300042615 Ga0466711_452583 Ga0466711_452583_3540_4481 313
106 3300042621 Ga0466729_238467 Ga0466729_238467_17_958 313
107 3300042643 Ga0466704_259531 Ga0466704_259531_4466_5407 313
108 3300009784 Ga0123357_10082312 Ga0123357_100823124 314
109 3300010882 Ga0123354_10001156 Ga0123354_1000115614 314
110 3300010882 Ga0123354_10092502 Ga0123354_100925023 314
111 3300042606 Ga0466719_420064 Ga0466719_420064_834_1778 314
112 3300042610 Ga0466698_266299 Ga0466698_266299_255_1199 314
113 3300042616 Ga0466715_554056 Ga0466715_554056_203_1147 314
114 3300042623 Ga0466734_030989 Ga0466734_030989_528_1472 314
115 3300042624 Ga0466735_033348 Ga0466735_033348_53_997 314
116 3300042643 Ga0466704_391168 Ga0466704_391168_119_1063 314
117 iso_pr_bacteria 2820788205 2820788492 314
118 iso_pr_bacteria 3004667792 3004670417 314
119 3300000062 IMNBL1DRAFT_c0005406 IMNBL1DRAFT_00054064 315
120 3300002834 JGI24696J40584_12960867 JGI24696J40584_129608675 315
121 3300009826 Ga0123355_10000055 Ga0123355_1000005566 315
122 3300042596 Ga0466696_196820 Ga0466696_196820_4061_5008 315
123 3300042615 Ga0466711_071277 Ga0466711_071277_5749_6696 315
124 3300042619 Ga0466726_057973 Ga0466726_057973_1123_2070 315
125 3300042619 Ga0466726_360780 Ga0466726_360780_1143_2090 315
126 iso_pr_bacteria 2967483437 2967483749 315
127 3300010167 Ga0123353_10077421 Ga0123353_100774215 316
128 3300042596 Ga0466696_076618 Ga0466696_076618_10142_11092 316
129 3300042609 Ga0466722_017622 Ga0466722_017622_1755_2705 316
130 3300042615 Ga0466711_043169 Ga0466711_043169_2414_3364 316
131 3300042619 Ga0466726_492028 Ga0466726_492028_333_1283 316
132 3300042643 Ga0466704_057265 Ga0466704_057265_174_1124 316
133 3300009784 Ga0123357_10000737 Ga0123357_1000073710 317
134 3300009784 Ga0123357_10001089 Ga0123357_100010894 317
135 3300010882 Ga0123354_10000040 Ga0123354_1000004048 317
136 3300010882 Ga0123354_10215861 Ga0123354_102158611 317
137 3300042600 Ga0466700_047546 Ga0466700_047546_10011_10964 317
138 3300042606 Ga0466719_090469 Ga0466719_090469_133_1086 317
139 3300042615 Ga0466711_108610 Ga0466711_108610_1120_2073 317
140 3300042615 Ga0466711_274108 Ga0466711_274108_1308_2261 317
141 3300009826 Ga0123355_10000009 Ga0123355_10000009150 318
142 3300042596 Ga0466696_081931 Ga0466696_081931_2463_3419 318
143 3300042599 Ga0466706_168917 Ga0466706_168917_17237_18193 318
144 3300042655 Ga0466727_277193 Ga0466727_277193_609_1565 318
145 3300042598 Ga0466701_100538 Ga0466701_100538_11727_12686 319
146 3300042599 Ga0466706_039353 Ga0466706_039353_5028_5987 319
147 3300042620 Ga0466728_176805 Ga0466728_176805_25_984 319
148 3300042643 Ga0466704_166854 Ga0466704_166854_10048_11007 319
149 3300002450 JGI24695J34938_10000176 JGI24695J34938_1000017620 320
150 3300042606 Ga0466719_448477 Ga0466719_448477_227_1189 320
151 3300042615 Ga0466711_214944 Ga0466711_214944_1427_2389 320
152 3300042636 Ga0466703_086245 Ga0466703_086245_30_992 320
153 3300042591 Ga0466692_139416 Ga0466692_139416_163_1128 321
154 3300042591 Ga0466692_198062 Ga0466692_198062_50_1015 321
155 3300042616 Ga0466715_014268 Ga0466715_014268_291_1259 322
156 3300042624 Ga0466735_097210 Ga0466735_097210_63_1031 322
157 3300002931 CVPL010W_10002017 CVPL010W_1000201727 323
158 3300010882 Ga0123354_10030511 Ga0123354_100305112 323
159 3300042619 Ga0466726_434840 Ga0466726_434840_1280_2251 323
160 3300042655 Ga0466727_136591 Ga0466727_136591_6460_7431 323
161 iso_pr_bacteria 2922326829 2922326873 323
162 3300010882 Ga0123354_10000215 Ga0123354_1000021530 324
163 3300042590 Ga0466690_183075 Ga0466690_183075_2955_3929 324
164 3300042616 Ga0466715_518763 Ga0466715_518763_14113_15087 324
165 3300010882 Ga0123354_10074067 Ga0123354_100740672 325
166 3300042582 Ga0466657_153142 Ga0466657_153142_546_1523 325
167 3300042592 Ga0466693_428997 Ga0466693_428997_656_1633 325
168 3300000062 IMNBL1DRAFT_c0005330 IMNBL1DRAFT_00053304 326
169 3300009784 Ga0123357_10000423 Ga0123357_1000042316 328
170 3300042655 Ga0466727_172594 Ga0466727_172594_1697_2683 328
171 3300042601 Ga0466707_245048 Ga0466707_245048_19431_20420 329
172 3300042601 Ga0466707_365436 Ga0466707_365436_864_1853 329
173 iso_pr_bacteria 2820211246 2820213122 332
174 3300002509 JGI24699J35502_11133708 JGI24699J35502_111337082 334
175 3300042624 Ga0466735_017443 Ga0466735_017443_1543_2547 334
176 3300042600 Ga0466700_332393 Ga0466700_332393_10243_11271 342
177 3300042648 Ga0466709_015908 Ga0466709_015908_15014_16066 350

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01370 Epimerase NAD dependent epimerase/dehydratase family 46 217 0.82
PF07993 NAD_binding_4 Male sterility protein 94 210 0.81
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 46 240 0.81
PF04321 RmlD_sub_bind RmlD substrate binding domain 44 298 0.78

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.