Protein Family IF09555
Metagenome
Isolate
177
Members
75
Samples
157
Scaffolds
310.85
Avg Length
Representative Sequence
- ID
- 3300042648|Ga0466709_015908|Ga0466709_015908_15014_16066
- Length
- 350 aa
- Sequence
- VEKTDKIFFDDRQFLDLKHISQEKVQQLSEKFSENYLPDKITKTLLITGIHGFVGSNLVSTLKENHRIYGLDIIFPEKEGVVKTYAWNDINNLPEIDTVIHLAGKAHDTKNQTKAQVYFDVNTGLTRQIFDYFLQSKAKKFIFFSSVKAAADSVEGDYLTENVVPKPVGPYGESKIKAEEYIQSKDWKGKSVYILRPCMIHGPGNKGNLNLLYHVVAKGIPWPLGAFDNLRSYMNIWNLSYIIEQLFILKNPESGIYHLADDEPLSTNELIELIAASKTQKARIWKINKSMVRAIAQIGTVCKFPLNSERLRKLTENYVVSNQKMKQALNITRLPVDVQTGLKRTLKTFD
Sample Types
Isolate
11.3%
Metagenome
88.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
23.9%
Kalotermitidae
16.9%
Unclassified
9.9%
Blattidae
9.9%
Elmidae
7.0%
Drosophilidae
7.0%
Formicidae
5.6%
Armadillidiidae
5.6%
Rhinotermitidae
4.2%
Termopsidae
4.2%
Hodotermitidae
1.4%
Passalidae
1.4%
Culicidae
1.4%
Cambaridae
1.4%
Taxonomy
Archaea
0
Bacteria
172
Eukaryota
0
Viruses
1
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 2 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 3 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 4 | 2820211246 | Unclassified Kiritimatiellaeota Nt197P3bin96 | Isolate | Unclassified |
| 5 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 6 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 7 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 10 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 14 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 15 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 16 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 17 | 3300005309 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut | Metagenome | Drosophilidae |
| 18 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 19 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 20 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 21 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 22 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 23 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 24 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 27 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 28 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 29 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 30 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 31 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 32 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 33 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 34 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 35 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 36 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 37 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 38 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 39 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 40 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 41 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 42 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 43 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 44 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 45 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 46 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 47 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 48 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 49 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 50 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 51 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 52 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 53 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 54 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 55 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 56 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 57 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 58 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 59 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 60 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 61 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 62 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 63 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 64 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 65 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 66 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 67 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 68 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 69 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 70 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 71 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 72 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 73 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 74 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 75 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160456_100073 | 3300012820 | Bacteria | 140854 |
| 2 | Ga0160433_100043 | 3300012846 | Bacteria | 143692 |
| 3 | Ga0466701_100538 | 3300042598 | Bacteria | 12874 |
| 4 | Ga0466706_018100 | 3300042599 | Bacteria | 3524 |
| 5 | Ga0466706_039353 | 3300042599 | Bacteria | 9088 |
| 6 | Ga0466706_149761 | 3300042599 | Bacteria | 6449 |
| 7 | Ga0466706_224510 | 3300042599 | Bacteria | 4579 |
| 8 | Ga0466722_064705 | 3300042609 | Bacteria | 14111 |
| 9 | Ga0123353_10077421 | 3300010167 | Bacteria | 5344 |
| 10 | Ga0160454_100001 | 3300012798 | Bacteria | 780029 |
| 11 | Ga0466711_214944 | 3300042615 | Bacteria | 2428 |
| 12 | Ga0466711_310422 | 3300042615 | Bacteria | 12503 |
| 13 | Ga0466715_100449 | 3300042616 | Bacteria | 3434 |
| 14 | Ga0466715_126324 | 3300042616 | Bacteria | 2781 |
| 15 | Ga0466715_518763 | 3300042616 | Bacteria | 23012 |
| 16 | Ga0466715_554056 | 3300042616 | Bacteria | 2296 |
| 17 | Ga0466735_097210 | 3300042624 | Bacteria | 2462 |
| 18 | Ga0466703_085787 | 3300042636 | Bacteria | 11982 |
| 19 | Ga0466704_166854 | 3300042643 | Bacteria | 12030 |
| 20 | Ga0466704_391168 | 3300042643 | Bacteria | 1791 |
| 21 | Ga0466708_015955 | 3300042652 | Bacteria | 14274 |
| 22 | Ga0466727_267487 | 3300042655 | Bacteria | 1531 |
| 23 | Ga0466705_116899 | 3300042612 | Bacteria | 2462 |
| 24 | Ga0466692_024501 | 3300042591 | Bacteria | 1813 |
| 25 | Ga0466701_002126 | 3300042598 | Bacteria | 117947 |
| 26 | Ga0466701_079539 | 3300042598 | Bacteria | 22402 |
| 27 | Ga0466706_086713 | 3300042599 | Bacteria | 3795 |
| 28 | Ga0466707_365436 | 3300042601 | Bacteria | 3160 |
| 29 | Ga0466713_041347 | 3300042602 | Bacteria | 10486 |
| 30 | Ga0466719_420064 | 3300042606 | Bacteria | 1843 |
| 31 | Ga0123353_10659363 | 3300010167 | Viruses | 1479 |
| 32 | Ga0123354_10030511 | 3300010882 | Bacteria | 8465 |
| 33 | Ga0466711_043169 | 3300042615 | Bacteria | 4174 |
| 34 | Ga0466711_452583 | 3300042615 | Bacteria | 4894 |
| 35 | Ga0466728_019567 | 3300042620 | Bacteria | 33080 |
| 36 | Ga0466729_051607 | 3300042621 | Bacteria | 2994 |
| 37 | Ga0466735_075500 | 3300042624 | Bacteria | 1392 |
| 38 | Ga0466709_015908 | 3300042648 | Bacteria | 26155 |
| 39 | Ga0466709_028387 | 3300042648 | Bacteria | 7453 |
| 40 | Ga0466724_12587 | 3300042649 | Bacteria | 88953 |
| 41 | JGI24695J34938_10000176 | 3300002450 | Bacteria | 59497 |
| 42 | Ga0102740_1000067 | 3300007140 | Bacteria | 24972 |
| 43 | Ga0104048_1000555 | 3300007143 | Bacteria | 3766 |
| 44 | Ga0104050_1200024 | 3300007153 | Bacteria | 2878 |
| 45 | Ga0466705_220935 | 3300042612 | Bacteria | 1915 |
| 46 | Ga0466733_216697 | 3300042659 | Bacteria | 189231 |
| 47 | Ga0160452_101490 | 3300012834 | Bacteria | 6601 |
| 48 | Ga0160445_103443 | 3300012847 | Bacteria | 3200 |
| 49 | Ga0466690_183075 | 3300042590 | Bacteria | 4123 |
| 50 | Ga0466696_081931 | 3300042596 | Bacteria | 3884 |
| 51 | Ga0466696_160975 | 3300042596 | Bacteria | 24065 |
| 52 | Ga0466696_274671 | 3300042596 | Bacteria | 1684 |
| 53 | Ga0466700_047546 | 3300042600 | Bacteria | 23188 |
| 54 | Ga0123354_10000040 | 3300010882 | Bacteria | 96699 |
| 55 | Ga0123354_10074067 | 3300010882 | Unclassified | 4882 |
| 56 | Ga0123354_10092502 | 3300010882 | Bacteria | 4165 |
| 57 | Ga0123354_10215861 | 3300010882 | Bacteria | 2056 |
| 58 | Ga0160470_100009 | 3300012813 | Bacteria | 464402 |
| 59 | Ga0466715_002453 | 3300042616 | Bacteria | 7344 |
| 60 | Ga0466715_627357 | 3300042616 | Bacteria | 3642 |
| 61 | Ga0466735_017443 | 3300042624 | Bacteria | 11029 |
| 62 | Ga0466703_014911 | 3300042636 | Bacteria | 3248 |
| 63 | Ga0466703_058654 | 3300042636 | Bacteria | 2525 |
| 64 | Ga0466703_086245 | 3300042636 | Bacteria | 1640 |
| 65 | Ga0466703_202952 | 3300042636 | Bacteria | 11287 |
| 66 | Ga0466703_267770 | 3300042636 | Bacteria | 2956 |
| 67 | Ga0466704_603890 | 3300042643 | Bacteria | 12803 |
| 68 | Ga0466727_136591 | 3300042655 | Bacteria | 7889 |
| 69 | Ga0074306_1118214 | 3300005309 | Bacteria | 1925 |
| 70 | Ga0104045_1004290 | 3300007085 | Unclassified | 32662 |
| 71 | Ga0123357_10001089 | 3300009784 | Bacteria | 28059 |
| 72 | Ga0466690_345763 | 3300042590 | Bacteria | 4854 |
| 73 | Ga0466695_011506 | 3300042595 | Bacteria | 2072 |
| 74 | Ga0123357_10290989 | 3300009784 | Bacteria | 1668 |
| 75 | Ga0123355_10000009 | 3300009826 | Bacteria | 191038 |
| 76 | Ga0123355_10000055 | 3300009826 | Bacteria | 117901 |
| 77 | Ga0123354_10000215 | 3300010882 | Bacteria | 50589 |
| 78 | Ga0466711_253778 | 3300042615 | Bacteria | 2108 |
| 79 | Ga0466726_205975 | 3300042619 | Bacteria | 5828 |
| 80 | Ga0466735_033348 | 3300042624 | Bacteria | 1867 |
| 81 | Ga0466703_135494 | 3300042636 | Bacteria | 14367 |
| 82 | Ga0466703_167500 | 3300042636 | Bacteria | 4970 |
| 83 | Ga0466704_035787 | 3300042643 | Bacteria | 7190 |
| 84 | Ga0466704_057265 | 3300042643 | Bacteria | 2659 |
| 85 | Ga0466704_259531 | 3300042643 | Bacteria | 11030 |
| 86 | IMNBL1DRAFT_c0005330 | 3300000062 | Bacteria | 7388 |
| 87 | IMNBL1DRAFT_c0005406 | 3300000062 | Bacteria | 7313 |
| 88 | JGI24702J35022_10015250 | 3300002462 | Bacteria | 4233 |
| 89 | JGI24696J40584_12960867 | 3300002834 | Bacteria | 8988 |
| 90 | CVPL010W_10002017 | 3300002931 | Bacteria | 31687 |
| 91 | Ga0466692_198062 | 3300042591 | Bacteria | 1041 |
| 92 | Ga0466696_076618 | 3300042596 | Bacteria | 13302 |
| 93 | Ga0466696_196820 | 3300042596 | Bacteria | 5079 |
| 94 | Ga0466696_347653 | 3300042596 | Bacteria | 1678 |
| 95 | Ga0466701_074699 | 3300042598 | Bacteria | 21879 |
| 96 | Ga0466705_470511 | 3300042612 | Bacteria | 1419 |
| 97 | Ga0466711_274108 | 3300042615 | Bacteria | 11545 |
| 98 | Ga0466715_014268 | 3300042616 | Bacteria | 21507 |
| 99 | Ga0466728_176805 | 3300042620 | Bacteria | 1609 |
| 100 | Ga0466729_082242 | 3300042621 | Bacteria | 5226 |
| 101 | Ga0466729_238467 | 3300042621 | Bacteria | 1231 |
| 102 | Ga0466704_186789 | 3300042643 | Bacteria | 2327 |
| 103 | Ga0466704_202557 | 3300042643 | Bacteria | 2217 |
| 104 | IMNBL1DRAFT_c0000063 | 3300000062 | Bacteria | 97352 |
| 105 | JGI24699J35502_11133708 | 3300002509 | Bacteria | 13934 |
| 106 | Ga0160433_101860 | 3300012846 | Bacteria | 5124 |
| 107 | Ga0466657_153142 | 3300042582 | Bacteria | 1698 |
| 108 | Ga0466692_139416 | 3300042591 | Bacteria | 1154 |
| 109 | Ga0466693_428997 | 3300042592 | Bacteria | 2213 |
| 110 | Ga0466701_040622 | 3300042598 | Bacteria | 282607 |
| 111 | Ga0466706_083884 | 3300042599 | Bacteria | 22267 |
| 112 | Ga0466700_332393 | 3300042600 | Bacteria | 18740 |
| 113 | Ga0466707_370636 | 3300042601 | Bacteria | 22490 |
| 114 | Ga0466722_004630 | 3300042609 | Bacteria | 3116 |
| 115 | Ga0466722_017622 | 3300042609 | Bacteria | 3167 |
| 116 | Ga0123357_10082312 | 3300009784 | Bacteria | 4227 |
| 117 | Ga0466711_108610 | 3300042615 | Bacteria | 4010 |
| 118 | Ga0466723_016957 | 3300042618 | Bacteria | 3510 |
| 119 | Ga0466726_057973 | 3300042619 | Bacteria | 4069 |
| 120 | Ga0466726_492028 | 3300042619 | Bacteria | 2741 |
| 121 | Ga0466734_030989 | 3300042623 | Bacteria | 1577 |
| 122 | Ga0466724_08812 | 3300042649 | Bacteria | 122658 |
| 123 | Ga0103263_103216 | 3300007042 | Bacteria | 1963 |
| 124 | Ga0104050_1033489 | 3300007153 | Bacteria | 3423 |
| 125 | Ga0123357_10000737 | 3300009784 | Bacteria | 32968 |
| 126 | Ga0466733_167068 | 3300042659 | Bacteria | 13722 |
| 127 | Ga0466692_180919 | 3300042591 | Bacteria | 1058 |
| 128 | Ga0466701_093289 | 3300042598 | Bacteria | 14763 |
| 129 | Ga0466706_168917 | 3300042599 | Bacteria | 75730 |
| 130 | Ga0466719_090469 | 3300042606 | Bacteria | 2315 |
| 131 | Ga0466719_344739 | 3300042606 | Bacteria | 2601 |
| 132 | Ga0466719_448477 | 3300042606 | Bacteria | 1521 |
| 133 | Ga0466698_266299 | 3300042610 | Bacteria | 1281 |
| 134 | Ga0466711_071277 | 3300042615 | Bacteria | 7742 |
| 135 | Ga0466735_133352 | 3300042624 | Bacteria | 6024 |
| 136 | Ga0466704_378746 | 3300042643 | Bacteria | 4294 |
| 137 | Ga0466704_590855 | 3300042643 | Bacteria | 2596 |
| 138 | Ga0466708_053368 | 3300042652 | Bacteria | 11241 |
| 139 | Ga0466727_277193 | 3300042655 | Bacteria | 1721 |
| 140 | Ga0102735_1000427 | 3300007080 | Bacteria | 14017 |
| 141 | Ga0104045_1001234 | 3300007085 | Unclassified | 12353 |
| 142 | Ga0104048_1025218 | 3300007143 | Unclassified | 3160 |
| 143 | Ga0104019_1003029 | 3300007150 | Bacteria | 4668 |
| 144 | Ga0123357_10000423 | 3300009784 | Bacteria | 40429 |
| 145 | Ga0160444_106478 | 3300012841 | Bacteria | 1525 |
| 146 | Ga0160445_100287 | 3300012847 | Bacteria | 32890 |
| 147 | Ga0160445_100453 | 3300012847 | Bacteria | 21164 |
| 148 | Ga0466690_132253 | 3300042590 | Bacteria | 7282 |
| 149 | Ga0466707_245048 | 3300042601 | Bacteria | 33561 |
| 150 | Ga0123354_10001156 | 3300010882 | Bacteria | 30896 |
| 151 | Ga0466711_433741 | 3300042615 | Bacteria | 1897 |
| 152 | Ga0466726_360780 | 3300042619 | Bacteria | 2740 |
| 153 | Ga0466726_434840 | 3300042619 | Bacteria | 2934 |
| 154 | Ga0466724_37932 | 3300042649 | Bacteria | 325221 |
| 155 | Ga0466724_60383 | 3300042649 | Bacteria | 43950 |
| 156 | Ga0466727_172594 | 3300042655 | Bacteria | 4463 |
| 157 | Ga0104045_1075457 | 3300007085 | Bacteria | 1968 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300012841 | Ga0160444_106478 | Ga0160444_1064782 | 264 |
| 2 | 3300007143 | Ga0104048_1025218 | Ga0104048_10252182 | 267 |
| 3 | 3300042612 | Ga0466705_470511 | Ga0466705_470511_562_1407 | 281 |
| 4 | 3300042616 | Ga0466715_126324 | Ga0466715_126324_117_1058 | 290 |
| 5 | 3300042643 | Ga0466704_603890 | Ga0466704_603890_1329_2258 | 292 |
| 6 | 3300012820 | Ga0160456_100073 | Ga0160456_10007368 | 294 |
| 7 | 3300009784 | Ga0123357_10290989 | Ga0123357_102909892 | 295 |
| 8 | 3300002462 | JGI24702J35022_10015250 | JGI24702J35022_100152502 | 296 |
| 9 | iso_pr_bacteria | 2904728850 | 2904729245 | 296 |
| 10 | iso_pr_bacteria | 2958471994 | 2958472488 | 296 |
| 11 | 3300042598 | Ga0466701_040622 | Ga0466701_040622_232131_233027 | 298 |
| 12 | 3300042636 | Ga0466703_085787 | Ga0466703_085787_643_1539 | 298 |
| 13 | iso_pr_bacteria | 2864891731 | 2864893200 | 298 |
| 14 | 3300042620 | Ga0466728_019567 | Ga0466728_019567_17525_18481 | 299 |
| 15 | 3300042636 | Ga0466703_014911 | Ga0466703_014911_1555_2454 | 299 |
| 16 | iso_pr_bacteria | 2864822740 | 2864825992 | 299 |
| 17 | iso_pr_bacteria | 2864882932 | 2864886601 | 299 |
| 18 | 3300012846 | Ga0160433_101860 | Ga0160433_1018603 | 300 |
| 19 | 3300042596 | Ga0466696_274671 | Ga0466696_274671_753_1655 | 300 |
| 20 | 3300005309 | Ga0074306_1118214 | Ga0074306_11182142 | 301 |
| 21 | 3300007080 | Ga0102735_1000427 | Ga0102735_10004273 | 301 |
| 22 | 3300012834 | Ga0160452_101490 | Ga0160452_1014907 | 301 |
| 23 | 3300012847 | Ga0160445_100287 | Ga0160445_10028711 | 301 |
| 24 | 3300042598 | Ga0466701_002126 | Ga0466701_002126_70866_71771 | 301 |
| 25 | 3300042598 | Ga0466701_093289 | Ga0466701_093289_12317_13222 | 301 |
| 26 | 3300042619 | Ga0466726_205975 | Ga0466726_205975_2542_3507 | 301 |
| 27 | 3300042649 | Ga0466724_12587 | Ga0466724_12587_44661_45566 | 301 |
| 28 | 3300007042 | Ga0103263_103216 | Ga0103263_1032162 | 302 |
| 29 | 3300007085 | Ga0104045_1001234 | Ga0104045_10012342 | 302 |
| 30 | 3300007085 | Ga0104045_1075457 | Ga0104045_10754572 | 302 |
| 31 | 3300007140 | Ga0102740_1000067 | Ga0102740_100006722 | 302 |
| 32 | 3300007143 | Ga0104048_1000555 | Ga0104048_10005552 | 302 |
| 33 | 3300007153 | Ga0104050_1033489 | Ga0104050_10334892 | 302 |
| 34 | 3300007153 | Ga0104050_1200024 | Ga0104050_12000243 | 302 |
| 35 | 3300042598 | Ga0466701_074699 | Ga0466701_074699_19228_20136 | 302 |
| 36 | 3300042649 | Ga0466724_37932 | Ga0466724_37932_133207_134115 | 302 |
| 37 | iso_pr_bacteria | 2898741527 | 2898745199 | 302 |
| 38 | 3300007085 | Ga0104045_1004290 | Ga0104045_10042903 | 303 |
| 39 | 3300007150 | Ga0104019_1003029 | Ga0104019_10030293 | 303 |
| 40 | 3300042636 | Ga0466703_135494 | Ga0466703_135494_7494_8405 | 303 |
| 41 | 3300042649 | Ga0466724_08812 | Ga0466724_08812_102850_103761 | 303 |
| 42 | 3300012813 | Ga0160470_100009 | Ga0160470_100009297 | 304 |
| 43 | 3300012846 | Ga0160433_100043 | Ga0160433_10004318 | 304 |
| 44 | 3300042598 | Ga0466701_079539 | Ga0466701_079539_7409_8323 | 304 |
| 45 | 3300042624 | Ga0466735_075500 | Ga0466735_075500_245_1225 | 304 |
| 46 | 3300042643 | Ga0466704_590855 | Ga0466704_590855_1291_2229 | 304 |
| 47 | 3300042659 | Ga0466733_167068 | Ga0466733_167068_7439_8377 | 304 |
| 48 | iso_pr_bacteria | 2864878056 | 2864881726 | 304 |
| 49 | iso_pr_bacteria | 2864886855 | 2864890636 | 304 |
| 50 | 3300042636 | Ga0466703_058654 | Ga0466703_058654_191_1108 | 305 |
| 51 | 3300042636 | Ga0466703_167500 | Ga0466703_167500_194_1111 | 305 |
| 52 | 3300042636 | Ga0466703_202952 | Ga0466703_202952_910_1827 | 305 |
| 53 | 3300042649 | Ga0466724_60383 | Ga0466724_60383_36127_37044 | 305 |
| 54 | 3300012798 | Ga0160454_100001 | Ga0160454_100001429 | 306 |
| 55 | 3300042612 | Ga0466705_220935 | Ga0466705_220935_791_1711 | 306 |
| 56 | 3300042624 | Ga0466735_133352 | Ga0466735_133352_2587_3507 | 306 |
| 57 | 3300042655 | Ga0466727_267487 | Ga0466727_267487_342_1262 | 306 |
| 58 | iso_pr_bacteria | 650716102 | 650880987 | 306 |
| 59 | 3300042590 | Ga0466690_345763 | Ga0466690_345763_66_989 | 307 |
| 60 | 3300042599 | Ga0466706_149761 | Ga0466706_149761_950_1873 | 307 |
| 61 | 3300042652 | Ga0466708_053368 | Ga0466708_053368_1063_1986 | 307 |
| 62 | 3300042599 | Ga0466706_083884 | Ga0466706_083884_21005_21931 | 308 |
| 63 | 3300042609 | Ga0466722_004630 | Ga0466722_004630_1025_1951 | 308 |
| 64 | 3300042616 | Ga0466715_002453 | Ga0466715_002453_5441_6367 | 308 |
| 65 | 3300042616 | Ga0466715_100449 | Ga0466715_100449_2121_3047 | 308 |
| 66 | 3300042590 | Ga0466690_132253 | Ga0466690_132253_5390_6319 | 309 |
| 67 | 3300042612 | Ga0466705_116899 | Ga0466705_116899_998_1927 | 309 |
| 68 | 3300042618 | Ga0466723_016957 | Ga0466723_016957_1773_2702 | 309 |
| 69 | 3300042643 | Ga0466704_035787 | Ga0466704_035787_613_1542 | 309 |
| 70 | 3300042643 | Ga0466704_186789 | Ga0466704_186789_347_1276 | 309 |
| 71 | 3300042643 | Ga0466704_202557 | Ga0466704_202557_200_1129 | 309 |
| 72 | 3300042643 | Ga0466704_378746 | Ga0466704_378746_330_1259 | 309 |
| 73 | iso_pr_bacteria | 2820741847 | 2820743530 | 309 |
| 74 | 3300012847 | Ga0160445_103443 | Ga0160445_1034433 | 310 |
| 75 | 3300042596 | Ga0466696_347653 | Ga0466696_347653_723_1655 | 310 |
| 76 | 3300042599 | Ga0466706_018100 | Ga0466706_018100_2080_3045 | 310 |
| 77 | 3300042621 | Ga0466729_051607 | Ga0466729_051607_557_1489 | 310 |
| 78 | 3300042636 | Ga0466703_267770 | Ga0466703_267770_1818_2750 | 310 |
| 79 | 3300042652 | Ga0466708_015955 | Ga0466708_015955_4438_5370 | 310 |
| 80 | iso_pr_bacteria | 2910949487 | 2910952332 | 310 |
| 81 | 3300010167 | Ga0123353_10659363 | Ga0123353_106593632 | 311 |
| 82 | 3300042591 | Ga0466692_024501 | Ga0466692_024501_722_1657 | 311 |
| 83 | 3300042595 | Ga0466695_011506 | Ga0466695_011506_1073_2008 | 311 |
| 84 | 3300042601 | Ga0466707_370636 | Ga0466707_370636_7415_8350 | 311 |
| 85 | 3300042609 | Ga0466722_064705 | Ga0466722_064705_960_1895 | 311 |
| 86 | 3300000062 | IMNBL1DRAFT_c0000063 | IMNBL1DRAFT_000006326 | 312 |
| 87 | 3300042591 | Ga0466692_180919 | Ga0466692_180919_18_956 | 312 |
| 88 | 3300042599 | Ga0466706_086713 | Ga0466706_086713_1569_2507 | 312 |
| 89 | 3300042606 | Ga0466719_344739 | Ga0466719_344739_966_1904 | 312 |
| 90 | 3300042615 | Ga0466711_310422 | Ga0466711_310422_2663_3601 | 312 |
| 91 | 3300042616 | Ga0466715_627357 | Ga0466715_627357_2037_2975 | 312 |
| 92 | 3300042621 | Ga0466729_082242 | Ga0466729_082242_1549_2487 | 312 |
| 93 | 3300042648 | Ga0466709_028387 | Ga0466709_028387_1109_2047 | 312 |
| 94 | 3300042659 | Ga0466733_216697 | Ga0466733_216697_173813_174751 | 312 |
| 95 | iso_pr_bacteria | 2940244548 | 2940245241 | 312 |
| 96 | iso_pr_bacteria | 2940248789 | 2940249481 | 312 |
| 97 | iso_pr_bacteria | 2940253009 | 2940253591 | 312 |
| 98 | iso_pr_bacteria | 2940257232 | 2940257446 | 312 |
| 99 | 3300012847 | Ga0160445_100453 | Ga0160445_1004535 | 313 |
| 100 | 3300042596 | Ga0466696_160975 | Ga0466696_160975_1385_2326 | 313 |
| 101 | 3300042599 | Ga0466706_224510 | Ga0466706_224510_3128_4069 | 313 |
| 102 | 3300042602 | Ga0466713_041347 | Ga0466713_041347_2930_3871 | 313 |
| 103 | 3300042615 | Ga0466711_253778 | Ga0466711_253778_124_1065 | 313 |
| 104 | 3300042615 | Ga0466711_433741 | Ga0466711_433741_482_1423 | 313 |
| 105 | 3300042615 | Ga0466711_452583 | Ga0466711_452583_3540_4481 | 313 |
| 106 | 3300042621 | Ga0466729_238467 | Ga0466729_238467_17_958 | 313 |
| 107 | 3300042643 | Ga0466704_259531 | Ga0466704_259531_4466_5407 | 313 |
| 108 | 3300009784 | Ga0123357_10082312 | Ga0123357_100823124 | 314 |
| 109 | 3300010882 | Ga0123354_10001156 | Ga0123354_1000115614 | 314 |
| 110 | 3300010882 | Ga0123354_10092502 | Ga0123354_100925023 | 314 |
| 111 | 3300042606 | Ga0466719_420064 | Ga0466719_420064_834_1778 | 314 |
| 112 | 3300042610 | Ga0466698_266299 | Ga0466698_266299_255_1199 | 314 |
| 113 | 3300042616 | Ga0466715_554056 | Ga0466715_554056_203_1147 | 314 |
| 114 | 3300042623 | Ga0466734_030989 | Ga0466734_030989_528_1472 | 314 |
| 115 | 3300042624 | Ga0466735_033348 | Ga0466735_033348_53_997 | 314 |
| 116 | 3300042643 | Ga0466704_391168 | Ga0466704_391168_119_1063 | 314 |
| 117 | iso_pr_bacteria | 2820788205 | 2820788492 | 314 |
| 118 | iso_pr_bacteria | 3004667792 | 3004670417 | 314 |
| 119 | 3300000062 | IMNBL1DRAFT_c0005406 | IMNBL1DRAFT_00054064 | 315 |
| 120 | 3300002834 | JGI24696J40584_12960867 | JGI24696J40584_129608675 | 315 |
| 121 | 3300009826 | Ga0123355_10000055 | Ga0123355_1000005566 | 315 |
| 122 | 3300042596 | Ga0466696_196820 | Ga0466696_196820_4061_5008 | 315 |
| 123 | 3300042615 | Ga0466711_071277 | Ga0466711_071277_5749_6696 | 315 |
| 124 | 3300042619 | Ga0466726_057973 | Ga0466726_057973_1123_2070 | 315 |
| 125 | 3300042619 | Ga0466726_360780 | Ga0466726_360780_1143_2090 | 315 |
| 126 | iso_pr_bacteria | 2967483437 | 2967483749 | 315 |
| 127 | 3300010167 | Ga0123353_10077421 | Ga0123353_100774215 | 316 |
| 128 | 3300042596 | Ga0466696_076618 | Ga0466696_076618_10142_11092 | 316 |
| 129 | 3300042609 | Ga0466722_017622 | Ga0466722_017622_1755_2705 | 316 |
| 130 | 3300042615 | Ga0466711_043169 | Ga0466711_043169_2414_3364 | 316 |
| 131 | 3300042619 | Ga0466726_492028 | Ga0466726_492028_333_1283 | 316 |
| 132 | 3300042643 | Ga0466704_057265 | Ga0466704_057265_174_1124 | 316 |
| 133 | 3300009784 | Ga0123357_10000737 | Ga0123357_1000073710 | 317 |
| 134 | 3300009784 | Ga0123357_10001089 | Ga0123357_100010894 | 317 |
| 135 | 3300010882 | Ga0123354_10000040 | Ga0123354_1000004048 | 317 |
| 136 | 3300010882 | Ga0123354_10215861 | Ga0123354_102158611 | 317 |
| 137 | 3300042600 | Ga0466700_047546 | Ga0466700_047546_10011_10964 | 317 |
| 138 | 3300042606 | Ga0466719_090469 | Ga0466719_090469_133_1086 | 317 |
| 139 | 3300042615 | Ga0466711_108610 | Ga0466711_108610_1120_2073 | 317 |
| 140 | 3300042615 | Ga0466711_274108 | Ga0466711_274108_1308_2261 | 317 |
| 141 | 3300009826 | Ga0123355_10000009 | Ga0123355_10000009150 | 318 |
| 142 | 3300042596 | Ga0466696_081931 | Ga0466696_081931_2463_3419 | 318 |
| 143 | 3300042599 | Ga0466706_168917 | Ga0466706_168917_17237_18193 | 318 |
| 144 | 3300042655 | Ga0466727_277193 | Ga0466727_277193_609_1565 | 318 |
| 145 | 3300042598 | Ga0466701_100538 | Ga0466701_100538_11727_12686 | 319 |
| 146 | 3300042599 | Ga0466706_039353 | Ga0466706_039353_5028_5987 | 319 |
| 147 | 3300042620 | Ga0466728_176805 | Ga0466728_176805_25_984 | 319 |
| 148 | 3300042643 | Ga0466704_166854 | Ga0466704_166854_10048_11007 | 319 |
| 149 | 3300002450 | JGI24695J34938_10000176 | JGI24695J34938_1000017620 | 320 |
| 150 | 3300042606 | Ga0466719_448477 | Ga0466719_448477_227_1189 | 320 |
| 151 | 3300042615 | Ga0466711_214944 | Ga0466711_214944_1427_2389 | 320 |
| 152 | 3300042636 | Ga0466703_086245 | Ga0466703_086245_30_992 | 320 |
| 153 | 3300042591 | Ga0466692_139416 | Ga0466692_139416_163_1128 | 321 |
| 154 | 3300042591 | Ga0466692_198062 | Ga0466692_198062_50_1015 | 321 |
| 155 | 3300042616 | Ga0466715_014268 | Ga0466715_014268_291_1259 | 322 |
| 156 | 3300042624 | Ga0466735_097210 | Ga0466735_097210_63_1031 | 322 |
| 157 | 3300002931 | CVPL010W_10002017 | CVPL010W_1000201727 | 323 |
| 158 | 3300010882 | Ga0123354_10030511 | Ga0123354_100305112 | 323 |
| 159 | 3300042619 | Ga0466726_434840 | Ga0466726_434840_1280_2251 | 323 |
| 160 | 3300042655 | Ga0466727_136591 | Ga0466727_136591_6460_7431 | 323 |
| 161 | iso_pr_bacteria | 2922326829 | 2922326873 | 323 |
| 162 | 3300010882 | Ga0123354_10000215 | Ga0123354_1000021530 | 324 |
| 163 | 3300042590 | Ga0466690_183075 | Ga0466690_183075_2955_3929 | 324 |
| 164 | 3300042616 | Ga0466715_518763 | Ga0466715_518763_14113_15087 | 324 |
| 165 | 3300010882 | Ga0123354_10074067 | Ga0123354_100740672 | 325 |
| 166 | 3300042582 | Ga0466657_153142 | Ga0466657_153142_546_1523 | 325 |
| 167 | 3300042592 | Ga0466693_428997 | Ga0466693_428997_656_1633 | 325 |
| 168 | 3300000062 | IMNBL1DRAFT_c0005330 | IMNBL1DRAFT_00053304 | 326 |
| 169 | 3300009784 | Ga0123357_10000423 | Ga0123357_1000042316 | 328 |
| 170 | 3300042655 | Ga0466727_172594 | Ga0466727_172594_1697_2683 | 328 |
| 171 | 3300042601 | Ga0466707_245048 | Ga0466707_245048_19431_20420 | 329 |
| 172 | 3300042601 | Ga0466707_365436 | Ga0466707_365436_864_1853 | 329 |
| 173 | iso_pr_bacteria | 2820211246 | 2820213122 | 332 |
| 174 | 3300002509 | JGI24699J35502_11133708 | JGI24699J35502_111337082 | 334 |
| 175 | 3300042624 | Ga0466735_017443 | Ga0466735_017443_1543_2547 | 334 |
| 176 | 3300042600 | Ga0466700_332393 | Ga0466700_332393_10243_11271 | 342 |
| 177 | 3300042648 | Ga0466709_015908 | Ga0466709_015908_15014_16066 | 350 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01370 | Epimerase | NAD dependent epimerase/dehydratase family | 46 | 217 | 0.82 |
| PF07993 | NAD_binding_4 | Male sterility protein | 94 | 210 | 0.81 |
| PF01073 | 3Beta_HSD | 3-beta hydroxysteroid dehydrogenase/isomerase family | 46 | 240 | 0.81 |
| PF04321 | RmlD_sub_bind | RmlD substrate binding domain | 44 | 298 | 0.78 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.85 | 0.89 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.