Protein Family IF09550
Metagenome
Isolate
209
Members
74
Samples
187
Scaffolds
434.89
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_608812|Ga0466704_608812_777_2273
- Length
- 498 aa
- Sequence
- MTCFSCLRLSAKSIDLVSQILACRLVGVGEYLNNLAFICFMPFSLPKCEGNAMAMLRKCGARHMRRLLMDDLLRWKNRKNRRPLILRGARQVGKSWLLNEFGKTAFEDVMSINFENAPGLKETFDGDISPQRIIDLLGALYGKRIKPQKTLLIFDEVQEIPRALTALKYFAEAAPEYAVCCAGSLLGVALHSGTSFPVGKVDFLNLQPLDFEEFLLAGGESLLIEFVRGNGMRAIPKAIADKLTDYLKLYLIIGGMPAAVSSWFDTKDHSIVESAQRDILTTYENDFSKHTPKAIVPKLRYLWDSIPSQLAKENKKFIYGLVREGARARDFEEALLWLLDSGLLRKVGRVAKAASPLKAYEDXXXFKLYHLDVGLLRVMSELPPSAILEGPKVFEEFKGALTEQFVLSELAGKDFIRNVYYWTSNGTAEVDFIFADDQSIYPVEVKASENLRSRSLQAYRSRYAPRLAIRTSLSNLRLDGGLLNVPLFALFNLENYLK
Sample Types
Isolate
10.5%
Metagenome
89.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.7%
Unclassified
32.9%
Kalotermitidae
17.8%
Termopsidae
4.1%
Rhinotermitidae
2.7%
Hodotermitidae
1.4%
Passalidae
1.4%
Taxonomy
Archaea
12
Bacteria
168
Eukaryota
0
Viruses
0
Unclassified
29
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 2 | 2820350530 | Unclassified Firmicutes Nt197P3bin37 | Isolate | Unclassified |
| 3 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 4 | 2820316744 | Unclassified Firmicutes Nt197P3bin99 | Isolate | Unclassified |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2820917597 | Unclassified Actinobacteria Emb289P3bin57 | Isolate | Unclassified |
| 14 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 15 | 2820259584 | Unclassified Firmicutes Th196P3bin43 | Isolate | Unclassified |
| 16 | 2820541116 | Unclassified Firmicutes Lab288P1bin109 | Isolate | Unclassified |
| 17 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 18 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 19 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 20 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 21 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 22 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 23 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 24 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 25 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 26 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 27 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 28 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 29 | 2820333861 | Unclassified Firmicutes Nt197P3bin72 | Isolate | Unclassified |
| 30 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 31 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 32 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 33 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 34 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 35 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 36 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 37 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 38 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 39 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 40 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 41 | 2820833147 | Unclassified Actinobacteria Lab288P4bin85 | Isolate | Unclassified |
| 42 | 2821322763 | Unclassified Actinobacteria Cu122P5bin19 | Isolate | Unclassified |
| 43 | 2820593525 | Unclassified Firmicutes Emb289P1bin7 | Isolate | Unclassified |
| 44 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 45 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 46 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 47 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 48 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 49 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 50 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 51 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 52 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 53 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 54 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 55 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 56 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 57 | 2820464928 | Unclassified Firmicutes Lab288P3bin121 | Isolate | Unclassified |
| 58 | 2820647881 | Unclassified Firmicutes Cu122P5bin16 | Isolate | Unclassified |
| 59 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 60 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 61 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 62 | 2772190893 | Unclassified Elusimicrobia Nt197P4_bin29 | Isolate | Unclassified |
| 63 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 64 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 65 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 66 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 67 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 68 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 69 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 70 | 2820657860 | Unclassified Firmicutes Co191P4bin15 | Isolate | Unclassified |
| 71 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 72 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 73 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 74 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | 2227555166 | 2225789004 | Bacteria | 14887 |
| 2 | JGI24702J35022_10100783 | 3300002462 | Bacteria | 1581 |
| 3 | JGI24705J35276_12238036 | 3300002504 | Bacteria | 15194 |
| 4 | JGI24696J40584_12958530 | 3300002834 | Bacteria | 4213 |
| 5 | Ga0072940_1070500 | 3300005200 | Bacteria | 5578 |
| 6 | Ga0123357_10000577 | 3300009784 | Bacteria | 36273 |
| 7 | Ga0123355_10026156 | 3300009826 | Bacteria | 9409 |
| 8 | Ga0123356_10003193 | 3300010049 | Bacteria | 17219 |
| 9 | Ga0123356_10013621 | 3300010049 | Bacteria | 7839 |
| 10 | Ga0123353_10096598 | 3300010167 | Bacteria | 4762 |
| 11 | Ga0123354_10000071 | 3300010882 | Bacteria | 76954 |
| 12 | Ga0123354_10065157 | 3300010882 | Bacteria | 5335 |
| 13 | Ga0123354_10065168 | 3300010882 | Unclassified | 5334 |
| 14 | Ga0123354_10138752 | 3300010882 | Bacteria | 3023 |
| 15 | Ga0123354_10218161 | 3300010882 | Bacteria | 2036 |
| 16 | Ga0466693_450060 | 3300042592 | Unclassified | 3782 |
| 17 | Ga0466704_329372 | 3300042643 | Unclassified | 1800 |
| 18 | Ga0466727_345555 | 3300042655 | Bacteria | 7436 |
| 19 | Ga0466706_013032 | 3300042599 | Bacteria | 25436 |
| 20 | Ga0466706_179358 | 3300042599 | Bacteria | 3947 |
| 21 | Ga0466707_409353 | 3300042601 | Unclassified | 10285 |
| 22 | Ga0466719_212239 | 3300042606 | Archaea | 1414 |
| 23 | Ga0466718_097193 | 3300042617 | Bacteria | 6836 |
| 24 | Ga0466723_253032 | 3300042618 | Unclassified | 1660 |
| 25 | JGI24702J35022_10017386 | 3300002462 | Bacteria | 3929 |
| 26 | JGI24705J35276_12221164 | 3300002504 | Bacteria | 2320 |
| 27 | Ga0123357_10001947 | 3300009784 | Bacteria | 22534 |
| 28 | Ga0123355_10061395 | 3300009826 | Bacteria | 6069 |
| 29 | Ga0123356_10000978 | 3300010049 | Bacteria | 31713 |
| 30 | Ga0123356_10174758 | 3300010049 | Unclassified | 2163 |
| 31 | Ga0123356_10192264 | 3300010049 | Bacteria | 2073 |
| 32 | Ga0123356_10263202 | 3300010049 | Bacteria | 1810 |
| 33 | Ga0123353_10092246 | 3300010167 | Bacteria | 4879 |
| 34 | Ga0123353_10312608 | 3300010167 | Bacteria | 2390 |
| 35 | Ga0466703_300625 | 3300042636 | Bacteria | 2687 |
| 36 | Ga0466708_057683 | 3300042652 | Bacteria | 13335 |
| 37 | Ga0466725_094805 | 3300042654 | Bacteria | 6072 |
| 38 | Ga0466701_024180 | 3300042598 | Bacteria | 2051 |
| 39 | Ga0466706_239019 | 3300042599 | Unclassified | 2162 |
| 40 | Ga0466700_366289 | 3300042600 | Bacteria | 1767 |
| 41 | Ga0466707_194864 | 3300042601 | Bacteria | 2410 |
| 42 | Ga0466707_232450 | 3300042601 | Bacteria | 8601 |
| 43 | Ga0466707_396251 | 3300042601 | Bacteria | 6992 |
| 44 | Ga0466721_097985 | 3300042608 | Bacteria | 27262 |
| 45 | Ga0466721_280564 | 3300042608 | Unclassified | 1754 |
| 46 | Ga0466697_092988 | 3300042611 | Archaea | 2057 |
| 47 | Ga0466710_431334 | 3300042613 | Bacteria | 5432 |
| 48 | Ga0466711_293688 | 3300042615 | Bacteria | 10569 |
| 49 | Ga0466715_196071 | 3300042616 | Bacteria | 3573 |
| 50 | Ga0466715_380822 | 3300042616 | Bacteria | 1637 |
| 51 | Ga0466732_178619 | 3300042656 | Bacteria | 3701 |
| 52 | JGI24702J35022_10035655 | 3300002462 | Unclassified | 2661 |
| 53 | JGI24702J35022_10063308 | 3300002462 | Bacteria | 1981 |
| 54 | JGI24702J35022_10074732 | 3300002462 | Unclassified | 1830 |
| 55 | JGI24702J35022_10079070 | 3300002462 | Archaea | 1780 |
| 56 | Ga0068305_10023995 | 3300005083 | Unclassified | 4166 |
| 57 | Ga0123357_10000026 | 3300009784 | Bacteria | 128045 |
| 58 | Ga0123357_10095571 | 3300009784 | Bacteria | 3852 |
| 59 | Ga0123357_10096856 | 3300009784 | Bacteria | 3820 |
| 60 | Ga0123356_10110414 | 3300010049 | Bacteria | 2655 |
| 61 | Ga0123356_10461891 | 3300010049 | Unclassified | 1419 |
| 62 | Ga0123354_10275843 | 3300010882 | Unclassified | 1644 |
| 63 | Ga0264413_112857 | 3300024493 | Unclassified | 1610 |
| 64 | Ga0466690_325515 | 3300042590 | Bacteria | 3834 |
| 65 | Ga0466704_608812 | 3300042643 | Bacteria | 2945 |
| 66 | Ga0466708_092239 | 3300042652 | Bacteria | 3479 |
| 67 | Ga0466727_169006 | 3300042655 | Bacteria | 2607 |
| 68 | Ga0466706_028673 | 3300042599 | Bacteria | 25582 |
| 69 | Ga0466706_221683 | 3300042599 | Bacteria | 16996 |
| 70 | Ga0466707_314727 | 3300042601 | Bacteria | 2105 |
| 71 | Ga0466716_530278 | 3300042605 | Bacteria | 4304 |
| 72 | Ga0466721_100978 | 3300042608 | Bacteria | 228571 |
| 73 | Ga0466722_105694 | 3300042609 | Bacteria | 2172 |
| 74 | Ga0466698_273853 | 3300042610 | Unclassified | 1720 |
| 75 | Ga0466711_485222 | 3300042615 | Bacteria | 2029 |
| 76 | Ga0466715_109660 | 3300042616 | Bacteria | 4223 |
| 77 | Ga0466726_462787 | 3300042619 | Archaea | 2325 |
| 78 | Ga0466728_070262 | 3300042620 | Bacteria | 1745 |
| 79 | JGI24702J35022_10062455 | 3300002462 | Bacteria | 1995 |
| 80 | Ga0068305_10046751 | 3300005083 | Bacteria | 29879 |
| 81 | Ga0123355_10128474 | 3300009826 | Archaea | 3910 |
| 82 | Ga0123356_10033472 | 3300010049 | Bacteria | 4805 |
| 83 | Ga0123353_10005786 | 3300010167 | Bacteria | 16321 |
| 84 | Ga0123353_10218195 | 3300010167 | Bacteria | 2985 |
| 85 | Ga0123353_10360160 | 3300010167 | Archaea | 2186 |
| 86 | Ga0466656_183376 | 3300042550 | Bacteria | 1889 |
| 87 | Ga0466694_405291 | 3300042594 | Bacteria | 10333 |
| 88 | Ga0466696_078957 | 3300042596 | Unclassified | 1925 |
| 89 | Ga0466731_142113 | 3300042622 | Bacteria | 2480 |
| 90 | Ga0466704_228126 | 3300042643 | Archaea | 2203 |
| 91 | Ga0466705_490117 | 3300042612 | Bacteria | 18099 |
| 92 | Ga0466715_508115 | 3300042616 | Bacteria | 18878 |
| 93 | Ga0466715_552884 | 3300042616 | Bacteria | 6361 |
| 94 | Ga0123357_10039852 | 3300009784 | Bacteria | 6396 |
| 95 | Ga0123357_10056388 | 3300009784 | Bacteria | 5284 |
| 96 | Ga0123355_10210487 | 3300009826 | Bacteria | 2819 |
| 97 | Ga0123355_10219155 | 3300009826 | Archaea | 2740 |
| 98 | Ga0123356_10210935 | 3300010049 | Bacteria | 1991 |
| 99 | Ga0123353_10012367 | 3300010167 | Bacteria | 12125 |
| 100 | Ga0123353_10184143 | 3300010167 | Bacteria | 3303 |
| 101 | Ga0415639_001789 | 3300038395 | Bacteria | 72751 |
| 102 | Ga0466734_097414 | 3300042623 | Bacteria | 3194 |
| 103 | Ga0466735_213241 | 3300042624 | Bacteria | 1773 |
| 104 | Ga0466701_088523 | 3300042598 | Unclassified | 2229 |
| 105 | Ga0466706_230305 | 3300042599 | Archaea | 2480 |
| 106 | Ga0466700_294941 | 3300042600 | Bacteria | 1891 |
| 107 | Ga0466707_226106 | 3300042601 | Bacteria | 45923 |
| 108 | Ga0466713_037721 | 3300042602 | Bacteria | 42636 |
| 109 | Ga0466713_052610 | 3300042602 | Bacteria | 20946 |
| 110 | Ga0466722_249580 | 3300042609 | Bacteria | 2224 |
| 111 | Ga0466697_024218 | 3300042611 | Bacteria | 2018 |
| 112 | Ga0466705_349003 | 3300042612 | Bacteria | 11767 |
| 113 | Ga0466711_425360 | 3300042615 | Bacteria | 14894 |
| 114 | Ga0466715_361307 | 3300042616 | Bacteria | 18941 |
| 115 | Ga0466723_311998 | 3300042618 | Unclassified | 2207 |
| 116 | Ga0466723_369006 | 3300042618 | Bacteria | 15939 |
| 117 | Ga0466729_133317 | 3300042621 | Unclassified | 4789 |
| 118 | JGI24702J35022_10065994 | 3300002462 | Bacteria | 1942 |
| 119 | Ga0072940_1054166 | 3300005200 | Bacteria | 3222 |
| 120 | Ga0123357_10246136 | 3300009784 | Bacteria | 1925 |
| 121 | Ga0123355_10015459 | 3300009826 | Bacteria | 11992 |
| 122 | Ga0123355_10051162 | 3300009826 | Bacteria | 6706 |
| 123 | Ga0123353_10000008 | 3300010167 | Bacteria | 264409 |
| 124 | Ga0466656_330106 | 3300042550 | Bacteria | 5051 |
| 125 | Ga0466690_061295 | 3300042590 | Unclassified | 1639 |
| 126 | Ga0466729_227291 | 3300042621 | Bacteria | 2008 |
| 127 | Ga0466706_115959 | 3300042599 | Bacteria | 5210 |
| 128 | Ga0466706_151105 | 3300042599 | Bacteria | 6180 |
| 129 | Ga0466700_078425 | 3300042600 | Archaea | 1608 |
| 130 | Ga0466700_491888 | 3300042600 | Bacteria | 1185 |
| 131 | Ga0466716_120115 | 3300042605 | Bacteria | 3169 |
| 132 | Ga0466705_406463 | 3300042612 | Bacteria | 27717 |
| 133 | Ga0466711_299775 | 3300042615 | Bacteria | 11132 |
| 134 | Ga0466711_352154 | 3300042615 | Bacteria | 2260 |
| 135 | Ga0466711_479688 | 3300042615 | Bacteria | 3100 |
| 136 | Ga0466723_111617 | 3300042618 | Unclassified | 2054 |
| 137 | Ga0466726_400438 | 3300042619 | Bacteria | 4855 |
| 138 | JGI24698J34947_10055460 | 3300002449 | Bacteria | 1974 |
| 139 | JGI24702J35022_10040388 | 3300002462 | Bacteria | 2488 |
| 140 | JGI24705J35276_12238739 | 3300002504 | Bacteria | 48451 |
| 141 | Ga0123356_10182491 | 3300010049 | Bacteria | 2122 |
| 142 | Ga0123356_10237867 | 3300010049 | Bacteria | 1890 |
| 143 | Ga0123353_10000237 | 3300010167 | Bacteria | 69845 |
| 144 | Ga0123353_10021081 | 3300010167 | Bacteria | 9767 |
| 145 | Ga0123354_10171941 | 3300010882 | Bacteria | 2516 |
| 146 | Ga0466656_324362 | 3300042550 | Bacteria | 1970 |
| 147 | Ga0466694_273608 | 3300042594 | Bacteria | 1280 |
| 148 | Ga0466699_101483 | 3300042597 | Bacteria | 1515 |
| 149 | Ga0466701_010696 | 3300042598 | Bacteria | 3155 |
| 150 | Ga0466703_284633 | 3300042636 | Bacteria | 3384 |
| 151 | Ga0466703_366442 | 3300042636 | Bacteria | 2089 |
| 152 | Ga0466725_317320 | 3300042654 | Bacteria | 1869 |
| 153 | Ga0466701_102982 | 3300042598 | Bacteria | 4224 |
| 154 | Ga0466713_099914 | 3300042602 | Bacteria | 22310 |
| 155 | Ga0466714_065131 | 3300042603 | Bacteria | 171349 |
| 156 | Ga0466717_302903 | 3300042604 | Archaea | 1916 |
| 157 | Ga0466720_156324 | 3300042607 | Bacteria | 70548 |
| 158 | Ga0466721_022258 | 3300042608 | Bacteria | 6974 |
| 159 | Ga0466722_127330 | 3300042609 | Bacteria | 3305 |
| 160 | Ga0466697_053937 | 3300042611 | Unclassified | 4634 |
| 161 | Ga0466705_124126 | 3300042612 | Bacteria | 27175 |
| 162 | Ga0466711_156819 | 3300042615 | Bacteria | 42889 |
| 163 | JGI24702J35022_10002545 | 3300002462 | Bacteria | 11089 |
| 164 | JGI24702J35022_10056866 | 3300002462 | Unclassified | 2087 |
| 165 | JGI24696J40584_12961202 | 3300002834 | Bacteria | 11957 |
| 166 | Ga0123355_10012231 | 3300009826 | Bacteria | 13291 |
| 167 | Ga0123356_10026185 | 3300010049 | Bacteria | 5479 |
| 168 | Ga0123356_10471446 | 3300010049 | Unclassified | 1407 |
| 169 | Ga0123353_10096338 | 3300010167 | Bacteria | 4769 |
| 170 | Ga0123353_10140181 | 3300010167 | Unclassified | 3874 |
| 171 | Ga0123353_10295588 | 3300010167 | Unclassified | 2476 |
| 172 | Ga0123353_10613337 | 3300010167 | Bacteria | 1551 |
| 173 | Ga0123354_10082054 | 3300010882 | Bacteria | 4548 |
| 174 | Ga0415639_005633 | 3300038395 | Bacteria | 44118 |
| 175 | Ga0415639_007166 | 3300038395 | Archaea | 3409 |
| 176 | Ga0415639_033545 | 3300038395 | Bacteria | 2659 |
| 177 | Ga0466731_272939 | 3300042622 | Unclassified | 4105 |
| 178 | Ga0466735_189823 | 3300042624 | Bacteria | 1800 |
| 179 | Ga0466735_228356 | 3300042624 | Bacteria | 8705 |
| 180 | Ga0466709_037454 | 3300042648 | Unclassified | 1510 |
| 181 | Ga0466725_115711 | 3300042654 | Bacteria | 23801 |
| 182 | Ga0466706_289324 | 3300042599 | Bacteria | 8218 |
| 183 | Ga0466707_048581 | 3300042601 | Bacteria | 5385 |
| 184 | Ga0466714_036550 | 3300042603 | Unclassified | 1802 |
| 185 | Ga0466722_008723 | 3300042609 | Bacteria | 1686 |
| 186 | Ga0466705_096121 | 3300042612 | Bacteria | 2764 |
| 187 | Ga0466705_279878 | 3300042612 | Bacteria | 2396 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042600 | Ga0466700_491888 | Ga0466700_491888_21_1115 | 364 |
| 2 | 3300024493 | Ga0264413_112857 | Ga0264413_1128572 | 377 |
| 3 | 3300042590 | Ga0466690_061295 | Ga0466690_061295_478_1626 | 382 |
| 4 | 3300042618 | Ga0466723_253032 | Ga0466723_253032_457_1635 | 392 |
| 5 | 3300042594 | Ga0466694_273608 | Ga0466694_273608_17_1207 | 396 |
| 6 | 3300002462 | JGI24702J35022_10062455 | JGI24702J35022_100624551 | 404 |
| 7 | 3300010882 | Ga0123354_10065157 | Ga0123354_100651572 | 410 |
| 8 | 3300042613 | Ga0466710_431334 | Ga0466710_431334_292_1608 | 411 |
| 9 | 3300042643 | Ga0466704_228126 | Ga0466704_228126_789_2081 | 411 |
| 10 | 3300042599 | Ga0466706_013032 | Ga0466706_013032_16647_17966 | 414 |
| 11 | 3300042608 | Ga0466721_022258 | Ga0466721_022258_5244_6551 | 414 |
| 12 | 3300042592 | Ga0466693_450060 | Ga0466693_450060_1680_2978 | 417 |
| 13 | 3300042612 | Ga0466705_406463 | Ga0466705_406463_11737_13044 | 417 |
| 14 | 3300010167 | Ga0123353_10360160 | Ga0123353_103601602 | 419 |
| 15 | 3300042599 | Ga0466706_151105 | Ga0466706_151105_4513_5829 | 419 |
| 16 | 3300042599 | Ga0466706_289324 | Ga0466706_289324_1962_3281 | 419 |
| 17 | 3300010167 | Ga0123353_10218195 | Ga0123353_102181953 | 421 |
| 18 | 3300002462 | JGI24702J35022_10040388 | JGI24702J35022_100403881 | 422 |
| 19 | 3300005083 | Ga0068305_10023995 | Ga0068305_100239952 | 422 |
| 20 | 3300009826 | Ga0123355_10026156 | Ga0123355_100261569 | 422 |
| 21 | 3300010167 | Ga0123353_10005786 | Ga0123353_100057862 | 422 |
| 22 | 3300042612 | Ga0466705_279878 | Ga0466705_279878_731_2041 | 422 |
| 23 | 3300042652 | Ga0466708_057683 | Ga0466708_057683_6427_7734 | 422 |
| 24 | 3300042599 | Ga0466706_230305 | Ga0466706_230305_494_1801 | 423 |
| 25 | 3300042611 | Ga0466697_092988 | Ga0466697_092988_179_1498 | 424 |
| 26 | 3300002462 | JGI24702J35022_10074732 | JGI24702J35022_100747321 | 425 |
| 27 | 3300042643 | Ga0466704_329372 | Ga0466704_329372_229_1509 | 426 |
| 28 | 3300042608 | Ga0466721_100978 | Ga0466721_100978_8438_9721 | 427 |
| 29 | 3300042616 | Ga0466715_508115 | Ga0466715_508115_17293_18576 | 427 |
| 30 | iso_pr_bacteria | 2820778767 | 2820781110 | 427 |
| 31 | 3300002449 | JGI24698J34947_10055460 | JGI24698J34947_100554601 | 428 |
| 32 | 3300010049 | Ga0123356_10210935 | Ga0123356_102109351 | 428 |
| 33 | 3300042619 | Ga0466726_462787 | Ga0466726_462787_773_2089 | 428 |
| 34 | 3300042656 | Ga0466732_178619 | Ga0466732_178619_1071_2357 | 428 |
| 35 | iso_pr_bacteria | 2820778767 | 2820781194 | 428 |
| 36 | 3300009784 | Ga0123357_10039852 | Ga0123357_100398525 | 429 |
| 37 | 3300009784 | Ga0123357_10246136 | Ga0123357_102461362 | 429 |
| 38 | 3300010049 | Ga0123356_10013621 | Ga0123356_1001362110 | 429 |
| 39 | 3300010167 | Ga0123353_10184143 | Ga0123353_101841432 | 429 |
| 40 | 3300042607 | Ga0466720_156324 | Ga0466720_156324_57281_58570 | 429 |
| 41 | 3300042612 | Ga0466705_349003 | Ga0466705_349003_9961_11250 | 429 |
| 42 | iso_pr_bacteria | 2772190893 | 2773437278 | 429 |
| 43 | iso_pr_bacteria | 2820316744 | 2820317722 | 429 |
| 44 | 3300002504 | JGI24705J35276_12238739 | JGI24705J35276_1223873916 | 430 |
| 45 | 3300005200 | Ga0072940_1054166 | Ga0072940_10541662 | 430 |
| 46 | 3300009784 | Ga0123357_10000577 | Ga0123357_1000057727 | 430 |
| 47 | 3300009826 | Ga0123355_10128474 | Ga0123355_101284743 | 430 |
| 48 | 3300010049 | Ga0123356_10110414 | Ga0123356_101104143 | 430 |
| 49 | 3300010167 | Ga0123353_10000237 | Ga0123353_1000023719 | 430 |
| 50 | iso_pr_bacteria | 2820783511 | 2820783685 | 430 |
| 51 | 3300010049 | Ga0123356_10000978 | Ga0123356_1000097825 | 431 |
| 52 | 3300010167 | Ga0123353_10613337 | Ga0123353_106133371 | 431 |
| 53 | 3300038395 | Ga0415639_005633 | Ga0415639_005633_35629_36942 | 431 |
| 54 | 3300042550 | Ga0466656_330106 | Ga0466656_330106_1610_2905 | 431 |
| 55 | 3300042597 | Ga0466699_101483 | Ga0466699_101483_154_1449 | 431 |
| 56 | 3300042600 | Ga0466700_366289 | Ga0466700_366289_345_1640 | 431 |
| 57 | 3300042609 | Ga0466722_105694 | Ga0466722_105694_632_1927 | 431 |
| 58 | 3300042609 | Ga0466722_127330 | Ga0466722_127330_1833_3128 | 431 |
| 59 | iso_pr_bacteria | 2820593525 | 2820593975 | 431 |
| 60 | 3300005083 | Ga0068305_10046751 | Ga0068305_100467515 | 432 |
| 61 | 3300010049 | Ga0123356_10237867 | Ga0123356_102378671 | 432 |
| 62 | 3300042594 | Ga0466694_405291 | Ga0466694_405291_8613_9911 | 432 |
| 63 | 3300042601 | Ga0466707_314727 | Ga0466707_314727_508_1806 | 432 |
| 64 | 3300042602 | Ga0466713_099914 | Ga0466713_099914_184_1482 | 432 |
| 65 | 3300042624 | Ga0466735_189823 | Ga0466735_189823_292_1590 | 432 |
| 66 | 3300042636 | Ga0466703_300625 | Ga0466703_300625_29_1327 | 432 |
| 67 | iso_pr_bacteria | 2820781750 | 2820782217 | 432 |
| 68 | 3300002504 | JGI24705J35276_12221164 | JGI24705J35276_122211642 | 433 |
| 69 | 3300009826 | Ga0123355_10219155 | Ga0123355_102191553 | 433 |
| 70 | 3300010049 | Ga0123356_10003193 | Ga0123356_100031937 | 433 |
| 71 | 3300010049 | Ga0123356_10174758 | Ga0123356_101747582 | 433 |
| 72 | 3300042601 | Ga0466707_048581 | Ga0466707_048581_440_1741 | 433 |
| 73 | 3300042605 | Ga0466716_530278 | Ga0466716_530278_2071_3372 | 433 |
| 74 | 3300042612 | Ga0466705_124126 | Ga0466705_124126_14928_16229 | 433 |
| 75 | 3300042616 | Ga0466715_361307 | Ga0466715_361307_17269_18570 | 433 |
| 76 | iso_pr_bacteria | 2820917597 | 2820918173 | 433 |
| 77 | 3300002462 | JGI24702J35022_10017386 | JGI24702J35022_100173863 | 434 |
| 78 | 3300038395 | Ga0415639_007166 | Ga0415639_007166_1916_3316 | 434 |
| 79 | 3300042600 | Ga0466700_078425 | Ga0466700_078425_153_1457 | 434 |
| 80 | 3300042602 | Ga0466713_052610 | Ga0466713_052610_799_2103 | 434 |
| 81 | 3300042605 | Ga0466716_120115 | Ga0466716_120115_385_1689 | 434 |
| 82 | 3300042608 | Ga0466721_097985 | Ga0466721_097985_2419_3774 | 434 |
| 83 | 3300042615 | Ga0466711_479688 | Ga0466711_479688_515_1819 | 434 |
| 84 | 3300042616 | Ga0466715_380822 | Ga0466715_380822_266_1570 | 434 |
| 85 | 3300042621 | Ga0466729_133317 | Ga0466729_133317_292_1596 | 434 |
| 86 | 3300042621 | Ga0466729_227291 | Ga0466729_227291_67_1371 | 434 |
| 87 | iso_pr_bacteria | 2820464928 | 2820464946 | 434 |
| 88 | 3300002462 | JGI24702J35022_10063308 | JGI24702J35022_100633083 | 435 |
| 89 | 3300010167 | Ga0123353_10295588 | Ga0123353_102955881 | 435 |
| 90 | 3300010882 | Ga0123354_10138752 | Ga0123354_101387522 | 435 |
| 91 | 3300042598 | Ga0466701_010696 | Ga0466701_010696_1597_2946 | 435 |
| 92 | 3300042604 | Ga0466717_302903 | Ga0466717_302903_427_1734 | 435 |
| 93 | 3300042617 | Ga0466718_097193 | Ga0466718_097193_5101_6408 | 435 |
| 94 | 3300042622 | Ga0466731_272939 | Ga0466731_272939_534_1883 | 435 |
| 95 | 3300042655 | Ga0466727_169006 | Ga0466727_169006_539_1846 | 435 |
| 96 | iso_pr_bacteria | 2781125693 | 2781433751 | 435 |
| 97 | iso_pr_bacteria | 2820333861 | 2820334629 | 435 |
| 98 | iso_pr_bacteria | 2820541116 | 2820543997 | 435 |
| 99 | 3300009784 | Ga0123357_10000026 | Ga0123357_100000265 | 436 |
| 100 | 3300010049 | Ga0123356_10026185 | Ga0123356_100261855 | 436 |
| 101 | 3300042599 | Ga0466706_221683 | Ga0466706_221683_12058_13368 | 436 |
| 102 | 3300042601 | Ga0466707_409353 | Ga0466707_409353_228_1538 | 436 |
| 103 | 3300042654 | Ga0466725_115711 | Ga0466725_115711_21871_23181 | 436 |
| 104 | iso_pr_bacteria | 2820350530 | 2820352552 | 436 |
| 105 | iso_pr_bacteria | 2820551407 | 2820553413 | 436 |
| 106 | iso_pr_bacteria | 2820785563 | 2820786909 | 436 |
| 107 | 2225789004 | 2227555166 | 2228087615 | 437 |
| 108 | 3300009826 | Ga0123355_10210487 | Ga0123355_102104872 | 437 |
| 109 | 3300010049 | Ga0123356_10192264 | Ga0123356_101922641 | 437 |
| 110 | 3300010167 | Ga0123353_10092246 | Ga0123353_100922462 | 437 |
| 111 | 3300010882 | Ga0123354_10218161 | Ga0123354_102181612 | 437 |
| 112 | 3300038395 | Ga0415639_001789 | Ga0415639_001789_49029_50342 | 437 |
| 113 | 3300042590 | Ga0466690_325515 | Ga0466690_325515_2011_3324 | 437 |
| 114 | 3300042601 | Ga0466707_232450 | Ga0466707_232450_5927_7240 | 437 |
| 115 | 3300042601 | Ga0466707_396251 | Ga0466707_396251_2822_4135 | 437 |
| 116 | 3300042606 | Ga0466719_212239 | Ga0466719_212239_19_1332 | 437 |
| 117 | 3300042616 | Ga0466715_552884 | Ga0466715_552884_983_2296 | 437 |
| 118 | 3300042618 | Ga0466723_369006 | Ga0466723_369006_1129_2442 | 437 |
| 119 | 3300042654 | Ga0466725_317320 | Ga0466725_317320_129_1442 | 437 |
| 120 | iso_pr_bacteria | 2820657860 | 2820660571 | 437 |
| 121 | 3300002834 | JGI24696J40584_12961202 | JGI24696J40584_129612024 | 438 |
| 122 | 3300010049 | Ga0123356_10471446 | Ga0123356_104714461 | 438 |
| 123 | 3300010167 | Ga0123353_10312608 | Ga0123353_103126084 | 438 |
| 124 | 3300042550 | Ga0466656_183376 | Ga0466656_183376_290_1606 | 438 |
| 125 | 3300042550 | Ga0466656_324362 | Ga0466656_324362_426_1742 | 438 |
| 126 | 3300042596 | Ga0466696_078957 | Ga0466696_078957_317_1633 | 438 |
| 127 | 3300042598 | Ga0466701_024180 | Ga0466701_024180_300_1616 | 438 |
| 128 | 3300042598 | Ga0466701_088523 | Ga0466701_088523_341_1657 | 438 |
| 129 | 3300042598 | Ga0466701_102982 | Ga0466701_102982_2171_3487 | 438 |
| 130 | 3300042599 | Ga0466706_028673 | Ga0466706_028673_4860_6176 | 438 |
| 131 | 3300042599 | Ga0466706_115959 | Ga0466706_115959_3544_4860 | 438 |
| 132 | 3300042599 | Ga0466706_239019 | Ga0466706_239019_33_1349 | 438 |
| 133 | 3300042601 | Ga0466707_194864 | Ga0466707_194864_92_1408 | 438 |
| 134 | 3300042603 | Ga0466714_065131 | Ga0466714_065131_46288_47604 | 438 |
| 135 | 3300042608 | Ga0466721_280564 | Ga0466721_280564_193_1509 | 438 |
| 136 | 3300042609 | Ga0466722_008723 | Ga0466722_008723_257_1573 | 438 |
| 137 | 3300042609 | Ga0466722_249580 | Ga0466722_249580_556_1872 | 438 |
| 138 | 3300042610 | Ga0466698_273853 | Ga0466698_273853_164_1480 | 438 |
| 139 | 3300042611 | Ga0466697_024218 | Ga0466697_024218_340_1656 | 438 |
| 140 | 3300042611 | Ga0466697_053937 | Ga0466697_053937_2163_3479 | 438 |
| 141 | 3300042615 | Ga0466711_425360 | Ga0466711_425360_12172_13488 | 438 |
| 142 | 3300042620 | Ga0466728_070262 | Ga0466728_070262_175_1491 | 438 |
| 143 | 3300042622 | Ga0466731_142113 | Ga0466731_142113_954_2270 | 438 |
| 144 | 3300042624 | Ga0466735_213241 | Ga0466735_213241_176_1492 | 438 |
| 145 | iso_pr_bacteria | 2820259584 | 2820260668 | 438 |
| 146 | iso_pr_bacteria | 2820744581 | 2820746345 | 438 |
| 147 | iso_pr_bacteria | 2820748953 | 2820750103 | 438 |
| 148 | 3300002462 | JGI24702J35022_10002545 | JGI24702J35022_100025452 | 439 |
| 149 | 3300002504 | JGI24705J35276_12238036 | JGI24705J35276_122380364 | 439 |
| 150 | 3300009784 | Ga0123357_10095571 | Ga0123357_100955712 | 439 |
| 151 | 3300009826 | Ga0123355_10051162 | Ga0123355_100511625 | 439 |
| 152 | 3300010049 | Ga0123356_10263202 | Ga0123356_102632022 | 439 |
| 153 | 3300010049 | Ga0123356_10461891 | Ga0123356_104618911 | 439 |
| 154 | 3300010882 | Ga0123354_10171941 | Ga0123354_101719413 | 439 |
| 155 | 3300042603 | Ga0466714_036550 | Ga0466714_036550_58_1377 | 439 |
| 156 | 3300042612 | Ga0466705_096121 | Ga0466705_096121_1200_2519 | 439 |
| 157 | 3300042612 | Ga0466705_490117 | Ga0466705_490117_16742_18061 | 439 |
| 158 | 3300042615 | Ga0466711_293688 | Ga0466711_293688_4908_6227 | 439 |
| 159 | 3300042615 | Ga0466711_299775 | Ga0466711_299775_9106_10425 | 439 |
| 160 | 3300042616 | Ga0466715_196071 | Ga0466715_196071_108_1427 | 439 |
| 161 | 3300042618 | Ga0466723_311998 | Ga0466723_311998_340_1659 | 439 |
| 162 | 3300042624 | Ga0466735_228356 | Ga0466735_228356_146_1465 | 439 |
| 163 | 3300002462 | JGI24702J35022_10065994 | JGI24702J35022_100659942 | 441 |
| 164 | 3300002462 | JGI24702J35022_10100783 | JGI24702J35022_101007832 | 441 |
| 165 | 3300009826 | Ga0123355_10015459 | Ga0123355_1001545911 | 441 |
| 166 | 3300010049 | Ga0123356_10033472 | Ga0123356_100334723 | 441 |
| 167 | 3300010167 | Ga0123353_10012367 | Ga0123353_100123675 | 441 |
| 168 | 3300042600 | Ga0466700_294941 | Ga0466700_294941_362_1687 | 441 |
| 169 | 3300042618 | Ga0466723_111617 | Ga0466723_111617_537_1865 | 442 |
| 170 | 3300042648 | Ga0466709_037454 | Ga0466709_037454_137_1465 | 442 |
| 171 | 3300002462 | JGI24702J35022_10056866 | JGI24702J35022_100568661 | 443 |
| 172 | 3300042623 | Ga0466734_097414 | Ga0466734_097414_1586_2950 | 443 |
| 173 | 3300002462 | JGI24702J35022_10079070 | JGI24702J35022_100790702 | 444 |
| 174 | 3300009784 | Ga0123357_10001947 | Ga0123357_1000194723 | 444 |
| 175 | 3300009826 | Ga0123355_10061395 | Ga0123355_100613955 | 444 |
| 176 | 3300038395 | Ga0415639_033545 | Ga0415639_033545_237_1571 | 444 |
| 177 | iso_pr_bacteria | 2820647881 | 2820651471 | 444 |
| 178 | 3300002462 | JGI24702J35022_10035655 | JGI24702J35022_100356552 | 445 |
| 179 | 3300010167 | Ga0123353_10096598 | Ga0123353_100965986 | 445 |
| 180 | 3300010167 | Ga0123353_10140181 | Ga0123353_101401812 | 445 |
| 181 | 3300042615 | Ga0466711_352154 | Ga0466711_352154_422_1759 | 445 |
| 182 | 3300042652 | Ga0466708_092239 | Ga0466708_092239_1875_3212 | 445 |
| 183 | 3300042654 | Ga0466725_094805 | Ga0466725_094805_1896_3233 | 445 |
| 184 | iso_pr_bacteria | 2821322763 | 2821322967 | 445 |
| 185 | 3300002834 | JGI24696J40584_12958530 | JGI24696J40584_129585303 | 446 |
| 186 | 3300010049 | Ga0123356_10182491 | Ga0123356_101824912 | 446 |
| 187 | 3300010167 | Ga0123353_10000008 | Ga0123353_1000000869 | 446 |
| 188 | 3300042599 | Ga0466706_179358 | Ga0466706_179358_1844_3184 | 446 |
| 189 | 3300042616 | Ga0466715_109660 | Ga0466715_109660_2135_3475 | 446 |
| 190 | 3300009784 | Ga0123357_10096856 | Ga0123357_100968562 | 447 |
| 191 | 3300010882 | Ga0123354_10065168 | Ga0123354_100651681 | 447 |
| 192 | 3300042619 | Ga0466726_400438 | Ga0466726_400438_779_2122 | 447 |
| 193 | 3300042636 | Ga0466703_366442 | Ga0466703_366442_569_1912 | 447 |
| 194 | 3300042601 | Ga0466707_226106 | Ga0466707_226106_825_2171 | 448 |
| 195 | 3300010882 | Ga0123354_10082054 | Ga0123354_100820543 | 449 |
| 196 | 3300009784 | Ga0123357_10056388 | Ga0123357_100563882 | 451 |
| 197 | 3300010882 | Ga0123354_10275843 | Ga0123354_102758431 | 451 |
| 198 | 3300042602 | Ga0466713_037721 | Ga0466713_037721_190_1545 | 451 |
| 199 | 3300010167 | Ga0123353_10096338 | Ga0123353_100963383 | 452 |
| 200 | 3300042655 | Ga0466727_345555 | Ga0466727_345555_1765_3123 | 452 |
| 201 | iso_pr_bacteria | 2820833147 | 2820833666 | 452 |
| 202 | 3300010882 | Ga0123354_10000071 | Ga0123354_1000007168 | 453 |
| 203 | 3300005200 | Ga0072940_1070500 | Ga0072940_10705002 | 454 |
| 204 | 3300009826 | Ga0123355_10012231 | Ga0123355_100122319 | 454 |
| 205 | 3300042615 | Ga0466711_485222 | Ga0466711_485222_476_1840 | 454 |
| 206 | 3300042615 | Ga0466711_156819 | Ga0466711_156819_21365_22756 | 463 |
| 207 | 3300042636 | Ga0466703_284633 | Ga0466703_284633_1461_2930 | 466 |
| 208 | 3300010167 | Ga0123353_10021081 | Ga0123353_100210816 | 486 |
| 209 | 3300042643 | Ga0466704_608812 | Ga0466704_608812_777_2273 | 498 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.84 | 0.89 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.