Protein Family IF09536

Metagenome Isolate
122 Members
44 Samples
115 Scaffolds
269.7 Avg Length

🧬 Representative Sequence

ID
3300042643|Ga0466704_540667|Ga0466704_540667_3734_4621
Length
295 aa
Sequence
MPERPRLPTQMIYWKNMVDKQTQKTNFLKKRQYLKKIQSYNRLIDELLVKEEEILDTMKDDAGNYALERITLTEIMLNLASNYLVVNGVSQSILRIKNEDALNEGRKAVYKSVIYLEDTVSNFVDAAYSEYEEKLAGIEGLDAMRRYTLVRKMGLAIRLLEDAYGDNTKWKWSFVELEGRYAVVTKNLLDLKKAAASLDPHSPEYRPLTYHFRLSRRLLLQAADRYREKYELVTHNLDDFKTGILFLSALQRFLAQMGERSELEMVRKKYNIWIAKLETDSKTRIDLAIPKSTGF

📊 Sample Types

Isolate 5.7%
Metagenome 94.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 42.9%
Kalotermitidae 31.0%
Unclassified 16.7%
Termopsidae 7.1%
Passalidae 2.4%

🌳 Taxonomy

Archaea 0
Bacteria 109
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
2 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
3 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
4 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
5 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
6 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
7 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
8 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
13 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
14 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
15 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
16 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
17 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
18 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
19 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
20 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
21 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
22 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
23 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
24 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
25 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
26 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
27 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
28 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
29 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
30 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
31 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
32 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
33 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
34 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
35 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
36 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
37 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
38 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
39 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
40 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
41 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
42 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
43 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
44 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10062578 3300010049 Bacteria 3476
2 Ga0466718_015835 3300042617 Bacteria 1600
3 Ga0466691_072273 3300042593 Bacteria 9697
4 Ga0466694_253708 3300042594 Bacteria 1889
5 Ga0466699_256507 3300042597 Bacteria 1602
6 Ga0466702_143418 3300042635 Bacteria 2614
7 Ga0466727_195159 3300042655 Bacteria 3226
8 JGI24698J34947_10000513 3300002449 Bacteria 18247
9 JGI24698J34947_10076836 3300002449 Unclassified 1581
10 JGI24695J34938_10001451 3300002450 Bacteria 20065
11 Ga0072940_1033673 3300005200 Bacteria 1837
12 Ga0072940_1278768 3300005200 Bacteria 1088
13 Ga0123356_10000191 3300010049 Bacteria 70964
14 Ga0123356_10002085 3300010049 Bacteria 21580
15 Ga0123356_11059366 3300010049 Bacteria 980
16 Ga0123353_10353293 3300010167 Bacteria 2213
17 Ga0466715_617142 3300042616 Unclassified 2063
18 Ga0466718_157887 3300042617 Bacteria 21556
19 Ga0466728_022002 3300042620 Bacteria 10498
20 Ga0466720_195191 3300042607 Bacteria 24276
21 Ga0264413_104723 3300024493 Bacteria 2343
22 Ga0264413_120359 3300024493 Unclassified 6537
23 Ga0466695_211384 3300042595 Bacteria 31275
24 Ga0466704_245588 3300042643 Bacteria 25369
25 JGI24698J34947_10095795 3300002449 Bacteria 1348
26 JGI24695J34938_10048537 3300002450 Bacteria 1869
27 Ga0072941_1007233 3300005201 Unclassified 40154
28 Ga0072941_1042251 3300005201 Bacteria 3672
29 Ga0072941_1162185 3300005201 Bacteria 1390
30 Ga0123356_10018833 3300010049 Bacteria 6551
31 Ga0466698_292898 3300042610 Bacteria 9830
32 Ga0264413_101276 3300024493 Bacteria 27033
33 Ga0264413_107381 3300024493 Bacteria 14584
34 Ga0415639_242105 3300038395 Unclassified 2236
35 Ga0466690_322412 3300042590 Unclassified 2024
36 Ga0466694_097903 3300042594 Bacteria 8164
37 Ga0466696_079988 3300042596 Bacteria 8110
38 Ga0466696_094655 3300042596 Bacteria 11377
39 Ga0466696_215717 3300042596 Bacteria 8890
40 Ga0466708_430751 3300042652 Bacteria 9384
41 JGI24695J34938_10000300 3300002450 Bacteria 48880
42 JGI24695J34938_10048541 3300002450 Unclassified 1869
43 Ga0466732_004755 3300042656 Bacteria 20938
44 Ga0466712_285021 3300042614 Bacteria 1764
45 Ga0466718_094394 3300042617 Bacteria 20157
46 Ga0466718_132867 3300042617 Bacteria 1536
47 Ga0466723_044427 3300042618 Bacteria 3793
48 Ga0466723_191752 3300042618 Bacteria 6030
49 Ga0466720_024663 3300042607 Bacteria 19387
50 Ga0466720_043133 3300042607 Unclassified 5951
51 Ga0264413_106022 3300024493 Bacteria 11971
52 Ga0466703_307224 3300042636 Bacteria 3440
53 Ga0466709_165196 3300042648 Bacteria 9336
54 JGI24698J34947_10001176 3300002449 Bacteria 13650
55 JGI24698J34947_10048937 3300002449 Bacteria 2138
56 JGI24695J34938_10000146 3300002450 Bacteria 64039
57 JGI24695J34938_10000446 3300002450 Bacteria 39944
58 Ga0072941_1016635 3300005201 Bacteria 20897
59 Ga0072941_1021165 3300005201 Unclassified 4690
60 Ga0072941_1047970 3300005201 Unclassified 5804
61 Ga0466732_296830 3300042656 Bacteria 4423
62 Ga0466712_014667 3300042614 Bacteria 27818
63 Ga0466723_009536 3300042618 Bacteria 7102
64 Ga0466726_212704 3300042619 Bacteria 14720
65 Ga0466716_110060 3300042605 Bacteria 12632
66 Ga0264413_110096 3300024493 Bacteria 3494
67 Ga0466694_147668 3300042594 Unclassified 2034
68 Ga0466731_354235 3300042622 Bacteria 1111
69 Ga0466735_194186 3300042624 Bacteria 4538
70 Ga0466703_375903 3300042636 Bacteria 1376
71 Ga0466727_330944 3300042655 Bacteria 13899
72 AustNasuHG_c1018964 3300000089 Bacteria 2263
73 Ga0072941_1124291 3300005201 Bacteria 1122
74 Ga0074263_117787 3300005485 Unclassified 2684
75 Ga0123356_10002720 3300010049 Bacteria 18801
76 Ga0123356_10377308 3300010049 Bacteria 1550
77 Ga0466718_077824 3300042617 Bacteria 37727
78 Ga0466718_167124 3300042617 Bacteria 2023
79 Ga0466719_490967 3300042606 Bacteria 2122
80 Ga0264413_110063 3300024493 Bacteria 4183
81 Ga0466731_065882 3300042622 Bacteria 5364
82 Ga0466731_249476 3300042622 Bacteria 1539
83 Ga0466704_540667 3300042643 Bacteria 25259
84 JGI24695J34938_10001376 3300002450 Bacteria 20894
85 JGI24695J34938_10024727 3300002450 Bacteria 2881
86 Ga0123356_10000070 3300010049 Bacteria 107100
87 Ga0123356_10358808 3300010049 Bacteria 1584
88 Ga0123353_10046891 3300010167 Bacteria 6870
89 Ga0123353_10071615 3300010167 Bacteria 5569
90 Ga0466712_116186 3300042614 Bacteria 2671
91 Ga0466712_202175 3300042614 Bacteria 5980
92 Ga0466718_040701 3300042617 Bacteria 3903
93 Ga0466718_094065 3300042617 Bacteria 3434
94 Ga0466718_098896 3300042617 Bacteria 1527
95 Ga0466720_022983 3300042607 Bacteria 4646
96 Ga0466720_114458 3300042607 Bacteria 2512
97 Ga0264413_113871 3300024493 Bacteria 8188
98 Ga0466704_073621 3300042643 Bacteria 5969
99 IMNBGM34_c003631 3300000036 Bacteria 2117
100 JGI24695J34938_10000129 3300002450 Bacteria 68011
101 JGI24695J34938_10000845 3300002450 Bacteria 28392
102 Ga0072940_1052154 3300005200 Unclassified 2504
103 Ga0074263_110938 3300005485 Bacteria 1648
104 Ga0466705_150144 3300042612 Bacteria 5820
105 Ga0123356_10000424 3300010049 Bacteria 48165
106 Ga0123353_10761392 3300010167 Bacteria 1345
107 Ga0123353_10998328 3300010167 Bacteria 1125
108 Ga0466728_158858 3300042620 Bacteria 3710
109 Ga0466719_576151 3300042606 Bacteria 2476
110 Ga0466703_007987 3300042636 Bacteria 2519
111 Ga0466703_359189 3300042636 Bacteria 7606
112 Ga0466708_447093 3300042652 Bacteria 8546
113 AustNasuHG_c1002255 3300000089 Bacteria 6956
114 Ga0074263_107073 3300005485 Bacteria 1116
115 Ga0074263_112801 3300005485 Bacteria 5666

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2781125632 2781270852 222
2 3300042617 Ga0466718_077824 Ga0466718_077824_26723_27544 245
3 3300002450 JGI24695J34938_10000129 JGI24695J34938_1000012954 250
4 3300010049 Ga0123356_10000070 Ga0123356_100000707 250
5 3300042624 Ga0466735_194186 Ga0466735_194186_3600_4352 250
6 3300042636 Ga0466703_007987 Ga0466703_007987_1681_2436 251
7 3300005485 Ga0074263_117787 Ga0074263_1177872 252
8 3300042635 Ga0466702_143418 Ga0466702_143418_91_849 252
9 3300010167 Ga0123353_10761392 Ga0123353_107613922 259
10 3300042617 Ga0466718_098896 Ga0466718_098896_474_1286 262
11 3300042619 Ga0466726_212704 Ga0466726_212704_1911_2702 263
12 3300042597 Ga0466699_256507 Ga0466699_256507_446_1240 264
13 3300024493 Ga0264413_107381 Ga0264413_1073815 265
14 3300024493 Ga0264413_120359 Ga0264413_1203596 265
15 3300042605 Ga0466716_110060 Ga0466716_110060_3096_3893 265
16 3300042610 Ga0466698_292898 Ga0466698_292898_1387_2199 265
17 3300042618 Ga0466723_044427 Ga0466723_044427_726_1523 265
18 3300042656 Ga0466732_296830 Ga0466732_296830_3575_4372 265
19 3300005200 Ga0072940_1052154 Ga0072940_10521543 266
20 3300005485 Ga0074263_110938 Ga0074263_1109382 266
21 3300024493 Ga0264413_106022 Ga0264413_1060227 266
22 3300042595 Ga0466695_211384 Ga0466695_211384_17137_17952 266
23 3300042607 Ga0466720_022983 Ga0466720_022983_1977_2777 266
24 3300042607 Ga0466720_024663 Ga0466720_024663_11421_12221 266
25 3300042607 Ga0466720_043133 Ga0466720_043133_2321_3121 266
26 3300042607 Ga0466720_114458 Ga0466720_114458_1254_2054 266
27 3300042655 Ga0466727_330944 Ga0466727_330944_8120_8920 266
28 3300000089 AustNasuHG_c1018964 AustNasuHG_10189642 268
29 3300042594 Ga0466694_097903 Ga0466694_097903_1590_2399 269
30 3300042617 Ga0466718_094394 Ga0466718_094394_4305_5114 269
31 3300000036 IMNBGM34_c003631 IMNBGM34_0036312 270
32 3300005485 Ga0074263_107073 Ga0074263_1070732 270
33 3300024493 Ga0264413_101276 Ga0264413_10127619 270
34 3300024493 Ga0264413_104723 Ga0264413_1047232 270
35 3300024493 Ga0264413_110063 Ga0264413_1100633 270
36 3300024493 Ga0264413_110096 Ga0264413_1100962 270
37 3300024493 Ga0264413_113871 Ga0264413_1138716 270
38 3300042593 Ga0466691_072273 Ga0466691_072273_4246_5058 270
39 3300042594 Ga0466694_147668 Ga0466694_147668_963_1775 270
40 3300042594 Ga0466694_253708 Ga0466694_253708_963_1775 270
41 3300042607 Ga0466720_195191 Ga0466720_195191_3880_4692 270
42 3300042614 Ga0466712_014667 Ga0466712_014667_6275_7087 270
43 3300042614 Ga0466712_116186 Ga0466712_116186_1211_2023 270
44 3300042614 Ga0466712_285021 Ga0466712_285021_83_895 270
45 3300042617 Ga0466718_015835 Ga0466718_015835_274_1086 270
46 3300042617 Ga0466718_040701 Ga0466718_040701_1368_2180 270
47 3300042617 Ga0466718_094065 Ga0466718_094065_944_1756 270
48 3300042617 Ga0466718_157887 Ga0466718_157887_10120_10932 270
49 3300042622 Ga0466731_065882 Ga0466731_065882_573_1385 270
50 3300042622 Ga0466731_354235 Ga0466731_354235_27_839 270
51 3300042643 Ga0466704_245588 Ga0466704_245588_19898_20710 270
52 3300042652 Ga0466708_430751 Ga0466708_430751_1685_2497 270
53 3300042656 Ga0466732_004755 Ga0466732_004755_7844_8656 270
54 iso_pr_bacteria 2781125637 2781282715 270
55 iso_pr_bacteria 2781125647 2781303768 270
56 iso_pr_bacteria 2781125660 2781331267 270
57 iso_pr_bacteria 2781125663 2781337750 270
58 3300000089 AustNasuHG_c1002255 AustNasuHG_10022555 271
59 3300002449 JGI24698J34947_10001176 JGI24698J34947_1000117610 271
60 3300002450 JGI24695J34938_10000446 JGI24695J34938_100004464 271
61 3300002450 JGI24695J34938_10000845 JGI24695J34938_100008457 271
62 3300002450 JGI24695J34938_10001376 JGI24695J34938_100013766 271
63 3300002450 JGI24695J34938_10001451 JGI24695J34938_1000145111 271
64 3300002450 JGI24695J34938_10024727 JGI24695J34938_100247272 271
65 3300002450 JGI24695J34938_10048537 JGI24695J34938_100485372 271
66 3300002450 JGI24695J34938_10048541 JGI24695J34938_100485412 271
67 3300005200 Ga0072940_1033673 Ga0072940_10336732 271
68 3300005200 Ga0072940_1278768 Ga0072940_12787681 271
69 3300005201 Ga0072941_1007233 Ga0072941_100723310 271
70 3300005201 Ga0072941_1016635 Ga0072941_101663510 271
71 3300005201 Ga0072941_1047970 Ga0072941_10479703 271
72 3300005485 Ga0074263_112801 Ga0074263_1128013 271
73 3300010049 Ga0123356_10000424 Ga0123356_1000042410 271
74 3300010049 Ga0123356_10002085 Ga0123356_1000208512 271
75 3300010049 Ga0123356_10018833 Ga0123356_100188336 271
76 3300010049 Ga0123356_10062578 Ga0123356_100625782 271
77 3300010049 Ga0123356_10377308 Ga0123356_103773082 271
78 3300010167 Ga0123353_10046891 Ga0123353_100468911 271
79 3300038395 Ga0415639_242105 Ga0415639_242105_842_1657 271
80 3300042614 Ga0466712_202175 Ga0466712_202175_3417_4232 271
81 3300042616 Ga0466715_617142 Ga0466715_617142_1069_1884 271
82 3300042617 Ga0466718_132867 Ga0466718_132867_41_856 271
83 3300042617 Ga0466718_167124 Ga0466718_167124_15_830 271
84 3300042636 Ga0466703_359189 Ga0466703_359189_4533_5348 271
85 iso_pr_bacteria 2781125681 2781406976 271
86 3300002449 JGI24698J34947_10000513 JGI24698J34947_100005137 272
87 3300002449 JGI24698J34947_10048937 JGI24698J34947_100489373 272
88 3300002449 JGI24698J34947_10076836 JGI24698J34947_100768362 272
89 3300002449 JGI24698J34947_10095795 JGI24698J34947_100957952 272
90 3300002450 JGI24695J34938_10000146 JGI24695J34938_1000014649 272
91 3300005201 Ga0072941_1021165 Ga0072941_10211652 272
92 3300005201 Ga0072941_1042251 Ga0072941_10422513 272
93 3300005201 Ga0072941_1162185 Ga0072941_11621852 272
94 3300010049 Ga0123356_10000191 Ga0123356_1000019121 272
95 3300010049 Ga0123356_10002720 Ga0123356_1000272010 272
96 3300010049 Ga0123356_11059366 Ga0123356_110593661 272
97 3300010167 Ga0123353_10071615 Ga0123353_100716152 272
98 3300010167 Ga0123353_10353293 Ga0123353_103532932 272
99 3300005201 Ga0072941_1124291 Ga0072941_11242911 273
100 3300042620 Ga0466728_158858 Ga0466728_158858_2476_3297 273
101 3300042636 Ga0466703_375903 Ga0466703_375903_210_1031 273
102 3300042655 Ga0466727_195159 Ga0466727_195159_1000_1824 274
103 3300010167 Ga0123353_10998328 Ga0123353_109983281 275
104 3300042596 Ga0466696_094655 Ga0466696_094655_6596_7423 275
105 3300042596 Ga0466696_215717 Ga0466696_215717_3392_4219 275
106 3300042620 Ga0466728_022002 Ga0466728_022002_5433_6260 275
107 3300042596 Ga0466696_079988 Ga0466696_079988_4602_5435 277
108 3300042606 Ga0466719_576151 Ga0466719_576151_326_1159 277
109 3300042612 Ga0466705_150144 Ga0466705_150144_604_1437 277
110 3300042618 Ga0466723_009536 Ga0466723_009536_3987_4820 277
111 3300042643 Ga0466704_073621 Ga0466704_073621_10_843 277
112 3300042652 Ga0466708_447093 Ga0466708_447093_545_1378 277
113 3300010049 Ga0123356_10358808 Ga0123356_103588082 278
114 3300042590 Ga0466690_322412 Ga0466690_322412_1007_1843 278
115 3300042618 Ga0466723_191752 Ga0466723_191752_3561_4397 278
116 iso_pr_bacteria 2781125644 2781295881 278
117 3300002450 JGI24695J34938_10000300 JGI24695J34938_100003007 279
118 3300042648 Ga0466709_165196 Ga0466709_165196_6366_7211 281
119 3300042606 Ga0466719_490967 Ga0466719_490967_14_865 283
120 3300042636 Ga0466703_307224 Ga0466703_307224_308_1159 283
121 3300042622 Ga0466731_249476 Ga0466731_249476_603_1478 291
122 3300042643 Ga0466704_540667 Ga0466704_540667_3734_4621 295

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.