Protein Family IF09529
Metagenome
Isolate
268
Members
93
Samples
243
Scaffolds
164.97
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_509301|Ga0466704_509301_453_1028
- Length
- 191 aa
- Sequence
- MTESPAYRAAAFPTRMAGPSTYEKKIQEGPMKHTISALVANKAGVLYRISGLFARRGYNIDSLAVGPTDNVKISRVTIIVDGDDYIAEQVTKQLDKLIDVKKVRILPEGDITVRELVLIKVRVDEKKRGEIIDIAKIMQCEIVDISHTTLMVEFDANTDRVNLLIDLLSKYKILEIARTGSIALQKGHNSM
Sample Types
Isolate
9.3%
Metagenome
90.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
33.3%
Unclassified
26.7%
Kalotermitidae
15.6%
Termopsidae
4.4%
Tenebrionidae
4.4%
Rhinotermitidae
3.3%
Armadillidiidae
3.3%
Passalidae
2.2%
Ixodidae
1.1%
Drosophilidae
1.1%
Hodotermitidae
1.1%
Elmidae
1.1%
Apidae
1.1%
Scarabaeidae
1.1%
Taxonomy
Archaea
0
Bacteria
228
Eukaryota
0
Viruses
0
Unclassified
40
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2862075925 | Corynebacterium lactis S064 | Isolate | Ixodidae |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 12 | 2778260940 | Unclassified Fibrobacteres Mp193P3bin36 | Isolate | Unclassified |
| 13 | 2820075487 | Unclassified Proteobacteria Nt197P3bin122 | Isolate | Unclassified |
| 14 | 2820357977 | Unclassified Firmicutes Nt197P3bin136 | Isolate | Unclassified |
| 15 | 2820373881 | Unclassified Firmicutes Nt197P3bin10 | Isolate | Unclassified |
| 16 | 642555172 | Endomicrobium trichonymphae Rs-D17 | Isolate | Unclassified |
| 17 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 18 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 19 | 2820814774 | Unclassified Actinobacteria Nt197P3bin39 | Isolate | Unclassified |
| 20 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 23 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 24 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 25 | 8109397740 | Rhodococcus triatomae DSM 44892 | Isolate | Unclassified |
| 26 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 27 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 28 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 29 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 30 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 31 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 32 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 33 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 34 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 35 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 36 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 37 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 38 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 39 | 2754412483 | Unclassified Elusimicrobia Lab288P4bin38 | Isolate | Unclassified |
| 40 | 2864899338 | Mycobacteroides chelonae S00154 | Isolate | Elmidae |
| 41 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 42 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 43 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 44 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 45 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 46 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 47 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 48 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 49 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 50 | 2518645556 | Nocardiopsis alba ATCC BAA-2165 | Isolate | Apidae |
| 51 | 2772190894 | Unclassified Elusimicrobia Th196P4_bin33 | Isolate | Unclassified |
| 52 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 53 | 2820387566 | Unclassified Firmicutes Nt197P1bin1 | Isolate | Unclassified |
| 54 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 55 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 56 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 57 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 58 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 59 | 2772190892 | Unclassified Elusimicrobia Lab288P3_bin37 | Isolate | Unclassified |
| 60 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 61 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 62 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 63 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 64 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 65 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 66 | 2772190891 | Unclassified Elusimicrobia Emb289P1_bin41 | Isolate | Unclassified |
| 67 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 68 | 2820110010 | Unclassified Proteobacteria Emb289P4bin35 | Isolate | Unclassified |
| 69 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 70 | 2820412446 | Unclassified Firmicutes Lab288P4bin39 | Isolate | Unclassified |
| 71 | 2888667245 | Corynebacterium diphtheriae FRC0190 | Isolate | Unclassified |
| 72 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 73 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 74 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 75 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 76 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 77 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 78 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 79 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 80 | 2754412482 | Unclassified Elusimicrobia Emb289P3bin85 | Isolate | Unclassified |
| 81 | 2820922474 | Unclassified Actinobacteria Emb289P3bin154 | Isolate | Unclassified |
| 82 | 2837204985 | Lysinimonas sp. 2DFWR-13 | Isolate | Scarabaeidae |
| 83 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 84 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 85 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 86 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 87 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 88 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 89 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 90 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 91 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 92 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 93 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_115441 | 3300042612 | Unclassified | 2184 |
| 2 | Ga0466705_319436 | 3300042612 | Unclassified | 1361 |
| 3 | Ga0466733_137485 | 3300042659 | Bacteria | 11316 |
| 4 | Ga0562375_0029 | 3300056856 | Bacteria | 703534 |
| 5 | Ga0466707_173160 | 3300042601 | Bacteria | 1116 |
| 6 | Ga0466713_051810 | 3300042602 | Bacteria | 1126 |
| 7 | Ga0466713_148925 | 3300042602 | Bacteria | 109604 |
| 8 | Ga0466722_026475 | 3300042609 | Unclassified | 3809 |
| 9 | Ga0466698_451092 | 3300042610 | Bacteria | 10353 |
| 10 | Ga0466692_085023 | 3300042591 | Bacteria | 2624 |
| 11 | Ga0123355_10074582 | 3300009826 | Bacteria | 5435 |
| 12 | Ga0123356_10004461 | 3300010049 | Bacteria | 14469 |
| 13 | Ga0123356_10039259 | 3300010049 | Bacteria | 4411 |
| 14 | Ga0123356_10041122 | 3300010049 | Bacteria | 4308 |
| 15 | Ga0123356_10206531 | 3300010049 | Bacteria | 2008 |
| 16 | Ga0123356_10395656 | 3300010049 | Bacteria | 1518 |
| 17 | Ga0123356_10456129 | 3300010049 | Bacteria | 1427 |
| 18 | Ga0466726_084384 | 3300042619 | Bacteria | 28979 |
| 19 | Ga0466735_008827 | 3300042624 | Bacteria | 2503 |
| 20 | Ga0466703_058274 | 3300042636 | Bacteria | 13690 |
| 21 | Ga0466704_380487 | 3300042643 | Unclassified | 3392 |
| 22 | Ga0466704_619883 | 3300042643 | Unclassified | 16198 |
| 23 | Ga0466708_077145 | 3300042652 | Bacteria | 85692 |
| 24 | JGI24698J34947_10005156 | 3300002449 | Bacteria | 7161 |
| 25 | JGI24702J35022_10074183 | 3300002462 | Bacteria | 1836 |
| 26 | JGI24703J35330_11748630 | 3300002501 | Bacteria | 22804 |
| 27 | Ga0068305_10232389 | 3300005083 | Bacteria | 11298 |
| 28 | Ga0104050_1203095 | 3300007153 | Bacteria | 1519 |
| 29 | Ga0562378_0051 | 3300056814 | Bacteria | 353762 |
| 30 | Ga0562375_0083 | 3300056856 | Bacteria | 300930 |
| 31 | Ga0466713_147168 | 3300042602 | Bacteria | 19246 |
| 32 | Ga0466717_180712 | 3300042604 | Bacteria | 1270 |
| 33 | Ga0466722_082706 | 3300042609 | Bacteria | 1094 |
| 34 | Ga0160456_107853 | 3300012820 | Unclassified | 1178 |
| 35 | Ga0160430_107904 | 3300012852 | Bacteria | 2075 |
| 36 | Ga0466690_071057 | 3300042590 | Bacteria | 30962 |
| 37 | Ga0466691_004808 | 3300042593 | Bacteria | 2645 |
| 38 | Ga0466696_341062 | 3300042596 | Bacteria | 3563 |
| 39 | Ga0466696_437833 | 3300042596 | Bacteria | 2440 |
| 40 | Ga0123356_10015463 | 3300010049 | Bacteria | 7311 |
| 41 | Ga0123356_10266470 | 3300010049 | Bacteria | 1800 |
| 42 | Ga0123353_10000676 | 3300010167 | Bacteria | 41652 |
| 43 | Ga0123353_10053811 | 3300010167 | Bacteria | 6433 |
| 44 | Ga0123353_11078140 | 3300010167 | Bacteria | 1069 |
| 45 | Ga0123354_10001015 | 3300010882 | Unclassified | 32082 |
| 46 | Ga0466705_423614 | 3300042612 | Bacteria | 2087 |
| 47 | Ga0466705_494069 | 3300042612 | Bacteria | 6385 |
| 48 | Ga0466710_077315 | 3300042613 | Bacteria | 25875 |
| 49 | Ga0466711_355777 | 3300042615 | Unclassified | 2276 |
| 50 | Ga0466715_001270 | 3300042616 | Bacteria | 2856 |
| 51 | Ga0466715_034925 | 3300042616 | Bacteria | 8870 |
| 52 | Ga0466715_219573 | 3300042616 | Bacteria | 21570 |
| 53 | Ga0466715_419328 | 3300042616 | Bacteria | 2608 |
| 54 | Ga0466726_266534 | 3300042619 | Unclassified | 1007 |
| 55 | Ga0466729_026352 | 3300042621 | Bacteria | 5810 |
| 56 | Ga0466729_194929 | 3300042621 | Bacteria | 12458 |
| 57 | Ga0466734_068026 | 3300042623 | Bacteria | 2738 |
| 58 | Ga0466735_128617 | 3300042624 | Bacteria | 2401 |
| 59 | Ga0466703_197391 | 3300042636 | Bacteria | 14762 |
| 60 | Ga0466703_199385 | 3300042636 | Bacteria | 18136 |
| 61 | Ga0466704_363778 | 3300042643 | Bacteria | 101687 |
| 62 | Ga0466704_509301 | 3300042643 | Bacteria | 1048 |
| 63 | Ga0466709_056114 | 3300042648 | Unclassified | 17009 |
| 64 | Ga0466725_259113 | 3300042654 | Bacteria | 1001 |
| 65 | Ga0466725_321139 | 3300042654 | Bacteria | 9967 |
| 66 | JGI24702J35022_10272831 | 3300002462 | Bacteria | 990 |
| 67 | Ga0466705_110769 | 3300042612 | Bacteria | 1351 |
| 68 | Ga0466707_149726 | 3300042601 | Bacteria | 7954 |
| 69 | Ga0466720_165612 | 3300042607 | Bacteria | 1456 |
| 70 | Ga0466656_228157 | 3300042550 | Unclassified | 1215 |
| 71 | Ga0466694_302536 | 3300042594 | Bacteria | 1024 |
| 72 | Ga0466696_008088 | 3300042596 | Bacteria | 2426 |
| 73 | Ga0466696_436013 | 3300042596 | Unclassified | 2277 |
| 74 | Ga0123355_10585307 | 3300009826 | Bacteria | 1332 |
| 75 | Ga0123356_10623349 | 3300010049 | Bacteria | 1244 |
| 76 | Ga0123353_10085849 | 3300010167 | Bacteria | 5069 |
| 77 | Ga0123353_10223470 | 3300010167 | Bacteria | 2942 |
| 78 | Ga0123353_10340876 | 3300010167 | Bacteria | 2264 |
| 79 | Ga0123353_10911179 | 3300010167 | Bacteria | 1195 |
| 80 | Ga0123354_10000387 | 3300010882 | Bacteria | 42194 |
| 81 | Ga0123354_10005771 | 3300010882 | Bacteria | 18135 |
| 82 | Ga0466705_415057 | 3300042612 | Bacteria | 28108 |
| 83 | Ga0466715_095543 | 3300042616 | Unclassified | 4695 |
| 84 | Ga0466715_169080 | 3300042616 | Bacteria | 66239 |
| 85 | Ga0466715_368032 | 3300042616 | Bacteria | 3412 |
| 86 | Ga0466734_002244 | 3300042623 | Bacteria | 1047 |
| 87 | Ga0466735_023249 | 3300042624 | Bacteria | 20584 |
| 88 | Ga0466735_034700 | 3300042624 | Bacteria | 11742 |
| 89 | Ga0466703_292797 | 3300042636 | Unclassified | 1661 |
| 90 | Ga0466704_307663 | 3300042643 | Bacteria | 23999 |
| 91 | Ga0466724_42971 | 3300042649 | Bacteria | 3969 |
| 92 | Ga0466727_305768 | 3300042655 | Unclassified | 1112 |
| 93 | JGI24705J35276_12209380 | 3300002504 | Bacteria | 1796 |
| 94 | Ga0466697_140221 | 3300042611 | Bacteria | 4516 |
| 95 | Ga0466697_192953 | 3300042611 | Unclassified | 3702 |
| 96 | Ga0466732_018800 | 3300042656 | Unclassified | 2738 |
| 97 | Ga0562374_0462 | 3300057007 | Bacteria | 69221 |
| 98 | Ga0466706_037575 | 3300042599 | Bacteria | 87054 |
| 99 | Ga0466700_011552 | 3300042600 | Bacteria | 1598 |
| 100 | Ga0466700_377631 | 3300042600 | Bacteria | 4749 |
| 101 | Ga0466707_321644 | 3300042601 | Bacteria | 1221 |
| 102 | Ga0466713_001957 | 3300042602 | Bacteria | 23137 |
| 103 | Ga0466714_165425 | 3300042603 | Bacteria | 52676 |
| 104 | Ga0466719_349854 | 3300042606 | Bacteria | 27287 |
| 105 | Ga0466719_404444 | 3300042606 | Bacteria | 6265 |
| 106 | Ga0466722_243021 | 3300042609 | Bacteria | 3876 |
| 107 | Ga0160457_1011052 | 3300012858 | Bacteria | 1282 |
| 108 | Ga0264413_153412 | 3300024493 | Unclassified | 7316 |
| 109 | Ga0466657_130917 | 3300042582 | Unclassified | 1568 |
| 110 | Ga0466696_437361 | 3300042596 | Bacteria | 3885 |
| 111 | Ga0123356_10473950 | 3300010049 | Bacteria | 1404 |
| 112 | Ga0466726_085163 | 3300042619 | Bacteria | 5254 |
| 113 | Ga0466729_191344 | 3300042621 | Bacteria | 1932 |
| 114 | Ga0466703_250320 | 3300042636 | Bacteria | 592480 |
| 115 | Ga0466703_300663 | 3300042636 | Bacteria | 29743 |
| 116 | Ga0466704_408371 | 3300042643 | Unclassified | 7392 |
| 117 | Ga0466704_468556 | 3300042643 | Bacteria | 6698 |
| 118 | Ga0466708_160390 | 3300042652 | Bacteria | 8842 |
| 119 | Ga0466727_217954 | 3300042655 | Bacteria | 23087 |
| 120 | IMNBL1DRAFT_c0000002 | 3300000062 | Bacteria | 288751 |
| 121 | Ga0072941_1156122 | 3300005201 | Bacteria | 5506 |
| 122 | Ga0466705_042717 | 3300042612 | Bacteria | 21329 |
| 123 | Ga0466705_106709 | 3300042612 | Unclassified | 1475 |
| 124 | Ga0466705_281125 | 3300042612 | Bacteria | 1715 |
| 125 | Ga0466733_073751 | 3300042659 | Bacteria | 2261 |
| 126 | Ga0466706_167168 | 3300042599 | Bacteria | 1092 |
| 127 | Ga0466706_260726 | 3300042599 | Bacteria | 2639 |
| 128 | Ga0466713_010250 | 3300042602 | Bacteria | 3031 |
| 129 | Ga0466713_134711 | 3300042602 | Bacteria | 7763 |
| 130 | Ga0466719_233762 | 3300042606 | Bacteria | 9801 |
| 131 | Ga0466722_039316 | 3300042609 | Bacteria | 5915 |
| 132 | Ga0466698_398242 | 3300042610 | Bacteria | 2200 |
| 133 | Ga0160443_100018 | 3300012848 | Bacteria | 423460 |
| 134 | Ga0415639_225647 | 3300038395 | Bacteria | 1140 |
| 135 | Ga0466657_025673 | 3300042582 | Bacteria | 20758 |
| 136 | Ga0466692_147164 | 3300042591 | Bacteria | 2895 |
| 137 | Ga0466696_151642 | 3300042596 | Unclassified | 5544 |
| 138 | Ga0123356_10029039 | 3300010049 | Bacteria | 5181 |
| 139 | Ga0123356_10395044 | 3300010049 | Unclassified | 1519 |
| 140 | Ga0123353_10273160 | 3300010167 | Bacteria | 2602 |
| 141 | Ga0123353_11018344 | 3300010167 | Unclassified | 1110 |
| 142 | Ga0466735_176045 | 3300042624 | Unclassified | 6967 |
| 143 | Ga0466703_099817 | 3300042636 | Bacteria | 10974 |
| 144 | Ga0466704_374867 | 3300042643 | Bacteria | 1597 |
| 145 | Ga0466709_380814 | 3300042648 | Bacteria | 24713 |
| 146 | Ga0068302_10052705 | 3300005071 | Bacteria | 7254 |
| 147 | Ga0068305_10001041 | 3300005083 | Bacteria | 17061 |
| 148 | Ga0466732_220550 | 3300042656 | Unclassified | 1475 |
| 149 | Ga0466707_140172 | 3300042601 | Bacteria | 4806 |
| 150 | Ga0466707_186188 | 3300042601 | Bacteria | 29049 |
| 151 | Ga0466707_216150 | 3300042601 | Bacteria | 6839 |
| 152 | Ga0466713_045730 | 3300042602 | Bacteria | 108789 |
| 153 | Ga0466717_228991 | 3300042604 | Bacteria | 1557 |
| 154 | Ga0466716_023451 | 3300042605 | Bacteria | 7237 |
| 155 | Ga0466722_222865 | 3300042609 | Bacteria | 5797 |
| 156 | Ga0466692_004119 | 3300042591 | Bacteria | 15497 |
| 157 | Ga0466691_161769 | 3300042593 | Unclassified | 5906 |
| 158 | Ga0123356_10020322 | 3300010049 | Bacteria | 6285 |
| 159 | Ga0123356_10063844 | 3300010049 | Bacteria | 3442 |
| 160 | Ga0123353_10678812 | 3300010167 | Unclassified | 1451 |
| 161 | Ga0123353_11785142 | 3300010167 | Bacteria | 765 |
| 162 | Ga0466723_344680 | 3300042618 | Bacteria | 3370 |
| 163 | Ga0466735_091370 | 3300042624 | Unclassified | 2416 |
| 164 | Ga0466730_087152 | 3300042625 | Bacteria | 16844 |
| 165 | Ga0466727_044104 | 3300042655 | Bacteria | 9751 |
| 166 | 2227356072 | 2225789004 | Bacteria | 1134 |
| 167 | Ga0068305_10000168 | 3300005083 | Bacteria | 304006 |
| 168 | Ga0068305_10010337 | 3300005083 | Unclassified | 7837 |
| 169 | Ga0466705_141644 | 3300042612 | Bacteria | 18872 |
| 170 | Ga0466705_202667 | 3300042612 | Bacteria | 1910 |
| 171 | Ga0466705_223657 | 3300042612 | Bacteria | 8232 |
| 172 | Ga0562377_1211 | 3300056842 | Bacteria | 29421 |
| 173 | Ga0466707_228583 | 3300042601 | Bacteria | 2491 |
| 174 | Ga0466707_298598 | 3300042601 | Bacteria | 65618 |
| 175 | Ga0466713_126050 | 3300042602 | Bacteria | 7816 |
| 176 | Ga0466722_268760 | 3300042609 | Bacteria | 1781 |
| 177 | Ga0415639_188490 | 3300038395 | Bacteria | 1092 |
| 178 | Ga0466692_109783 | 3300042591 | Bacteria | 19456 |
| 179 | Ga0466696_071885 | 3300042596 | Bacteria | 8048 |
| 180 | Ga0466696_434912 | 3300042596 | Unclassified | 1947 |
| 181 | Ga0466696_478070 | 3300042596 | Bacteria | 7532 |
| 182 | Ga0123356_10066920 | 3300010049 | Bacteria | 3364 |
| 183 | Ga0123353_10012748 | 3300010167 | Bacteria | 11986 |
| 184 | Ga0123353_10203004 | 3300010167 | Unclassified | 3116 |
| 185 | Ga0123353_10276604 | 3300010167 | Unclassified | 2582 |
| 186 | Ga0123353_10557845 | 3300010167 | Bacteria | 1650 |
| 187 | Ga0123354_10556200 | 3300010882 | Bacteria | 862 |
| 188 | Ga0466711_097566 | 3300042615 | Bacteria | 5069 |
| 189 | Ga0466715_333068 | 3300042616 | Bacteria | 5600 |
| 190 | Ga0466715_554078 | 3300042616 | Bacteria | 1684 |
| 191 | Ga0466726_078640 | 3300042619 | Bacteria | 41565 |
| 192 | Ga0466728_130712 | 3300042620 | Unclassified | 1458 |
| 193 | Ga0466728_179624 | 3300042620 | Bacteria | 26098 |
| 194 | Ga0466728_371669 | 3300042620 | Bacteria | 1467 |
| 195 | Ga0466729_187605 | 3300042621 | Bacteria | 1879 |
| 196 | Ga0466735_001646 | 3300042624 | Unclassified | 1789 |
| 197 | Ga0466703_125883 | 3300042636 | Bacteria | 5997 |
| 198 | Ga0466704_569961 | 3300042643 | Unclassified | 1670 |
| 199 | Ga0466724_54317 | 3300042649 | Bacteria | 1044 |
| 200 | Ga0466708_321961 | 3300042652 | Bacteria | 10654 |
| 201 | Ga0466725_074171 | 3300042654 | Bacteria | 22500 |
| 202 | Ga0068302_10142115 | 3300005071 | Bacteria | 3383 |
| 203 | Ga0123357_10001212 | 3300009784 | Unclassified | 26979 |
| 204 | Ga0466705_226599 | 3300042612 | Bacteria | 58567 |
| 205 | Ga0466705_322115 | 3300042612 | Bacteria | 15896 |
| 206 | Ga0562375_0918 | 3300056856 | Bacteria | 47625 |
| 207 | Ga0562375_2614 | 3300056856 | Bacteria | 19518 |
| 208 | Ga0466707_180176 | 3300042601 | Bacteria | 19494 |
| 209 | Ga0466707_406450 | 3300042601 | Bacteria | 13516 |
| 210 | Ga0466713_112217 | 3300042602 | Bacteria | 4156 |
| 211 | Ga0466719_145533 | 3300042606 | Unclassified | 2158 |
| 212 | Ga0466722_022567 | 3300042609 | Bacteria | 8324 |
| 213 | Ga0466690_134528 | 3300042590 | Bacteria | 7538 |
| 214 | Ga0466691_122348 | 3300042593 | Bacteria | 2467 |
| 215 | Ga0466694_042634 | 3300042594 | Bacteria | 1143 |
| 216 | Ga0466699_012840 | 3300042597 | Bacteria | 1383 |
| 217 | Ga0123357_10071358 | 3300009784 | Bacteria | 4606 |
| 218 | Ga0123356_10000416 | 3300010049 | Bacteria | 48609 |
| 219 | Ga0123356_10006945 | 3300010049 | Bacteria | 11366 |
| 220 | Ga0123356_12664189 | 3300010049 | Bacteria | 626 |
| 221 | Ga0123353_10018476 | 3300010167 | Bacteria | 10313 |
| 222 | Ga0123353_10096690 | 3300010167 | Bacteria | 4759 |
| 223 | Ga0123353_10098636 | 3300010167 | Bacteria | 4708 |
| 224 | Ga0123353_10279427 | 3300010167 | Bacteria | 2566 |
| 225 | Ga0123354_10135350 | 3300010882 | Unclassified | 3085 |
| 226 | Ga0466705_463124 | 3300042612 | Bacteria | 3776 |
| 227 | Ga0466712_135434 | 3300042614 | Bacteria | 1739 |
| 228 | Ga0466715_519361 | 3300042616 | Bacteria | 1459 |
| 229 | Ga0466718_034656 | 3300042617 | Bacteria | 3625 |
| 230 | Ga0466723_022972 | 3300042618 | Bacteria | 101765 |
| 231 | Ga0466723_145616 | 3300042618 | Bacteria | 21579 |
| 232 | Ga0466723_155978 | 3300042618 | Bacteria | 1823 |
| 233 | Ga0466728_168858 | 3300042620 | Bacteria | 3593 |
| 234 | Ga0466728_335941 | 3300042620 | Bacteria | 9051 |
| 235 | Ga0466735_167646 | 3300042624 | Bacteria | 1320 |
| 236 | Ga0466735_172137 | 3300042624 | Bacteria | 3520 |
| 237 | Ga0466735_187983 | 3300042624 | Bacteria | 3582 |
| 238 | Ga0466703_402166 | 3300042636 | Unclassified | 4551 |
| 239 | Ga0466704_220900 | 3300042643 | Bacteria | 15289 |
| 240 | Ga0466727_039034 | 3300042655 | Bacteria | 4730 |
| 241 | JGI24702J35022_10000284 | 3300002462 | Bacteria | 29622 |
| 242 | Ga0072940_1061258 | 3300005200 | Bacteria | 5042 |
| 243 | Ga0123357_10002811 | 3300009784 | Bacteria | 19646 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300009826 | Ga0123355_10074582 | Ga0123355_100745824 | 153 |
| 2 | 3300042624 | Ga0466735_187983 | Ga0466735_187983_761_1225 | 154 |
| 3 | 3300042593 | Ga0466691_122348 | Ga0466691_122348_1066_1563 | 155 |
| 4 | 3300042612 | Ga0466705_226599 | Ga0466705_226599_5424_5918 | 155 |
| 5 | 3300042621 | Ga0466729_194929 | Ga0466729_194929_7821_8306 | 155 |
| 6 | 3300042609 | Ga0466722_082706 | Ga0466722_082706_286_759 | 157 |
| 7 | 3300042624 | Ga0466735_023249 | Ga0466735_023249_16248_16721 | 157 |
| 8 | 3300042624 | Ga0466735_091370 | Ga0466735_091370_1131_1604 | 157 |
| 9 | iso_pr_bacteria | 642555172 | 642791487 | 157 |
| 10 | 2225789004 | 2227356072 | 2227800989 | 158 |
| 11 | 3300042654 | Ga0466725_259113 | Ga0466725_259113_139_615 | 158 |
| 12 | iso_pr_bacteria | 2820075487 | 2820076179 | 158 |
| 13 | 3300010049 | Ga0123356_10206531 | Ga0123356_102065312 | 159 |
| 14 | 3300010167 | Ga0123353_10276604 | Ga0123353_102766042 | 159 |
| 15 | 3300010167 | Ga0123353_11078140 | Ga0123353_110781402 | 159 |
| 16 | 3300038395 | Ga0415639_188490 | Ga0415639_188490_148_627 | 159 |
| 17 | 3300042612 | Ga0466705_042717 | Ga0466705_042717_4376_4855 | 159 |
| 18 | 3300042614 | Ga0466712_135434 | Ga0466712_135434_266_745 | 159 |
| 19 | 3300042619 | Ga0466726_078640 | Ga0466726_078640_34692_35171 | 159 |
| 20 | 3300042624 | Ga0466735_001646 | Ga0466735_001646_498_977 | 159 |
| 21 | 3300042624 | Ga0466735_008827 | Ga0466735_008827_976_1455 | 159 |
| 22 | 3300042624 | Ga0466735_176045 | Ga0466735_176045_4773_5252 | 159 |
| 23 | 3300042643 | Ga0466704_380487 | Ga0466704_380487_308_787 | 159 |
| 24 | 3300042652 | Ga0466708_160390 | Ga0466708_160390_6561_7091 | 159 |
| 25 | 3300042656 | Ga0466732_220550 | Ga0466732_220550_514_993 | 159 |
| 26 | iso_pr_bacteria | 2754412482 | 2755215522 | 159 |
| 27 | iso_pr_bacteria | 2754412483 | 2755216891 | 159 |
| 28 | iso_pr_bacteria | 2772190891 | 2773434481 | 159 |
| 29 | iso_pr_bacteria | 2772190892 | 2773436238 | 159 |
| 30 | iso_pr_bacteria | 2772190894 | 2773439204 | 159 |
| 31 | iso_pr_bacteria | 2778260940 | 2778357373 | 159 |
| 32 | 3300002449 | JGI24698J34947_10005156 | JGI24698J34947_100051562 | 160 |
| 33 | 3300002462 | JGI24702J35022_10000284 | JGI24702J35022_1000028419 | 160 |
| 34 | 3300010167 | Ga0123353_10000676 | Ga0123353_1000067642 | 160 |
| 35 | 3300010167 | Ga0123353_10018476 | Ga0123353_100184767 | 160 |
| 36 | 3300010882 | Ga0123354_10000387 | Ga0123354_100003878 | 160 |
| 37 | 3300010882 | Ga0123354_10001015 | Ga0123354_100010156 | 160 |
| 38 | 3300024493 | Ga0264413_153412 | Ga0264413_1534126 | 160 |
| 39 | 3300042594 | Ga0466694_042634 | Ga0466694_042634_438_920 | 160 |
| 40 | 3300042596 | Ga0466696_437361 | Ga0466696_437361_795_1277 | 160 |
| 41 | 3300042597 | Ga0466699_012840 | Ga0466699_012840_760_1242 | 160 |
| 42 | 3300042603 | Ga0466714_165425 | Ga0466714_165425_29448_29930 | 160 |
| 43 | 3300042607 | Ga0466720_165612 | Ga0466720_165612_505_987 | 160 |
| 44 | 3300042609 | Ga0466722_039316 | Ga0466722_039316_3665_4147 | 160 |
| 45 | 3300042610 | Ga0466698_451092 | Ga0466698_451092_206_688 | 160 |
| 46 | 3300042616 | Ga0466715_169080 | Ga0466715_169080_35129_35611 | 160 |
| 47 | 3300042616 | Ga0466715_333068 | Ga0466715_333068_3635_4117 | 160 |
| 48 | 3300005200 | Ga0072940_1061258 | Ga0072940_10612582 | 161 |
| 49 | 3300005201 | Ga0072941_1156122 | Ga0072941_11561222 | 161 |
| 50 | 3300010049 | Ga0123356_10063844 | Ga0123356_100638441 | 161 |
| 51 | 3300010167 | Ga0123353_10085849 | Ga0123353_100858494 | 161 |
| 52 | 3300042591 | Ga0466692_109783 | Ga0466692_109783_4595_5080 | 161 |
| 53 | 3300042591 | Ga0466692_147164 | Ga0466692_147164_1089_1574 | 161 |
| 54 | 3300042596 | Ga0466696_008088 | Ga0466696_008088_387_872 | 161 |
| 55 | 3300042596 | Ga0466696_434912 | Ga0466696_434912_265_750 | 161 |
| 56 | 3300042596 | Ga0466696_436013 | Ga0466696_436013_1421_1906 | 161 |
| 57 | 3300042596 | Ga0466696_437833 | Ga0466696_437833_419_904 | 161 |
| 58 | 3300042599 | Ga0466706_260726 | Ga0466706_260726_242_727 | 161 |
| 59 | 3300042601 | Ga0466707_180176 | Ga0466707_180176_14726_15211 | 161 |
| 60 | 3300042601 | Ga0466707_186188 | Ga0466707_186188_3635_4120 | 161 |
| 61 | 3300042601 | Ga0466707_216150 | Ga0466707_216150_4907_5392 | 161 |
| 62 | 3300042602 | Ga0466713_010250 | Ga0466713_010250_2006_2491 | 161 |
| 63 | 3300042602 | Ga0466713_112217 | Ga0466713_112217_595_1080 | 161 |
| 64 | 3300042602 | Ga0466713_126050 | Ga0466713_126050_6322_6807 | 161 |
| 65 | 3300042605 | Ga0466716_023451 | Ga0466716_023451_5880_6365 | 161 |
| 66 | 3300042606 | Ga0466719_145533 | Ga0466719_145533_381_866 | 161 |
| 67 | 3300042606 | Ga0466719_404444 | Ga0466719_404444_5119_5604 | 161 |
| 68 | 3300042609 | Ga0466722_222865 | Ga0466722_222865_3390_3875 | 161 |
| 69 | 3300042609 | Ga0466722_268760 | Ga0466722_268760_688_1173 | 161 |
| 70 | 3300042612 | Ga0466705_106709 | Ga0466705_106709_723_1208 | 161 |
| 71 | 3300042612 | Ga0466705_110769 | Ga0466705_110769_772_1257 | 161 |
| 72 | 3300042612 | Ga0466705_115441 | Ga0466705_115441_1576_2061 | 161 |
| 73 | 3300042612 | Ga0466705_141644 | Ga0466705_141644_9045_9530 | 161 |
| 74 | 3300042612 | Ga0466705_202667 | Ga0466705_202667_776_1261 | 161 |
| 75 | 3300042612 | Ga0466705_223657 | Ga0466705_223657_2173_2658 | 161 |
| 76 | 3300042612 | Ga0466705_319436 | Ga0466705_319436_306_791 | 161 |
| 77 | 3300042612 | Ga0466705_322115 | Ga0466705_322115_11_496 | 161 |
| 78 | 3300042612 | Ga0466705_423614 | Ga0466705_423614_1499_1984 | 161 |
| 79 | 3300042612 | Ga0466705_494069 | Ga0466705_494069_1920_2405 | 161 |
| 80 | 3300042615 | Ga0466711_097566 | Ga0466711_097566_4074_4559 | 161 |
| 81 | 3300042615 | Ga0466711_355777 | Ga0466711_355777_672_1157 | 161 |
| 82 | 3300042616 | Ga0466715_034925 | Ga0466715_034925_141_626 | 161 |
| 83 | 3300042616 | Ga0466715_419328 | Ga0466715_419328_2031_2516 | 161 |
| 84 | 3300042616 | Ga0466715_554078 | Ga0466715_554078_517_1002 | 161 |
| 85 | 3300042618 | Ga0466723_022972 | Ga0466723_022972_63819_64304 | 161 |
| 86 | 3300042619 | Ga0466726_084384 | Ga0466726_084384_25065_25550 | 161 |
| 87 | 3300042619 | Ga0466726_266534 | Ga0466726_266534_506_991 | 161 |
| 88 | 3300042620 | Ga0466728_130712 | Ga0466728_130712_200_685 | 161 |
| 89 | 3300042620 | Ga0466728_335941 | Ga0466728_335941_133_618 | 161 |
| 90 | 3300042621 | Ga0466729_026352 | Ga0466729_026352_131_616 | 161 |
| 91 | 3300042624 | Ga0466735_167646 | Ga0466735_167646_521_1006 | 161 |
| 92 | 3300042636 | Ga0466703_125883 | Ga0466703_125883_1573_2058 | 161 |
| 93 | 3300042636 | Ga0466703_292797 | Ga0466703_292797_912_1397 | 161 |
| 94 | 3300042636 | Ga0466703_402166 | Ga0466703_402166_28_513 | 161 |
| 95 | 3300042643 | Ga0466704_220900 | Ga0466704_220900_9762_10247 | 161 |
| 96 | 3300042643 | Ga0466704_307663 | Ga0466704_307663_7658_8143 | 161 |
| 97 | 3300042643 | Ga0466704_569961 | Ga0466704_569961_991_1476 | 161 |
| 98 | 3300042652 | Ga0466708_321961 | Ga0466708_321961_5490_5975 | 161 |
| 99 | 3300042655 | Ga0466727_039034 | Ga0466727_039034_3296_3781 | 161 |
| 100 | 3300042655 | Ga0466727_044104 | Ga0466727_044104_769_1254 | 161 |
| 101 | 3300042655 | Ga0466727_305768 | Ga0466727_305768_201_686 | 161 |
| 102 | 3300002462 | JGI24702J35022_10272831 | JGI24702J35022_102728311 | 162 |
| 103 | 3300005071 | Ga0068302_10142115 | Ga0068302_101421153 | 162 |
| 104 | 3300010049 | Ga0123356_10456129 | Ga0123356_104561292 | 162 |
| 105 | 3300010167 | Ga0123353_10053811 | Ga0123353_100538114 | 162 |
| 106 | 3300010167 | Ga0123353_10096690 | Ga0123353_100966903 | 162 |
| 107 | 3300010882 | Ga0123354_10556200 | Ga0123354_105562001 | 162 |
| 108 | 3300042601 | Ga0466707_228583 | Ga0466707_228583_541_1029 | 162 |
| 109 | 3300042602 | Ga0466713_147168 | Ga0466713_147168_14049_14537 | 162 |
| 110 | 3300042624 | Ga0466735_172137 | Ga0466735_172137_2272_2760 | 162 |
| 111 | 3300056856 | Ga0562375_0918 | Ga0562375_0918_45982_46515 | 162 |
| 112 | 3300005083 | Ga0068305_10001041 | Ga0068305_1000104117 | 163 |
| 113 | 3300042550 | Ga0466656_228157 | Ga0466656_228157_653_1144 | 163 |
| 114 | 3300042582 | Ga0466657_025673 | Ga0466657_025673_19421_19912 | 163 |
| 115 | 3300042582 | Ga0466657_130917 | Ga0466657_130917_846_1337 | 163 |
| 116 | 3300042590 | Ga0466690_071057 | Ga0466690_071057_25616_26107 | 163 |
| 117 | 3300042590 | Ga0466690_134528 | Ga0466690_134528_4215_4706 | 163 |
| 118 | 3300042591 | Ga0466692_004119 | Ga0466692_004119_10274_10765 | 163 |
| 119 | 3300042591 | Ga0466692_085023 | Ga0466692_085023_553_1044 | 163 |
| 120 | 3300042593 | Ga0466691_161769 | Ga0466691_161769_4269_4760 | 163 |
| 121 | 3300042600 | Ga0466700_377631 | Ga0466700_377631_2869_3360 | 163 |
| 122 | 3300042601 | Ga0466707_406450 | Ga0466707_406450_9458_9949 | 163 |
| 123 | 3300042602 | Ga0466713_001957 | Ga0466713_001957_1818_2309 | 163 |
| 124 | 3300042604 | Ga0466717_228991 | Ga0466717_228991_855_1346 | 163 |
| 125 | 3300042609 | Ga0466722_022567 | Ga0466722_022567_6245_6736 | 163 |
| 126 | 3300042609 | Ga0466722_026475 | Ga0466722_026475_718_1209 | 163 |
| 127 | 3300042610 | Ga0466698_398242 | Ga0466698_398242_1266_1757 | 163 |
| 128 | 3300042611 | Ga0466697_192953 | Ga0466697_192953_2064_2555 | 163 |
| 129 | 3300042612 | Ga0466705_415057 | Ga0466705_415057_4385_4876 | 163 |
| 130 | 3300042613 | Ga0466710_077315 | Ga0466710_077315_24147_24638 | 163 |
| 131 | 3300042616 | Ga0466715_095543 | Ga0466715_095543_1388_1879 | 163 |
| 132 | 3300042618 | Ga0466723_145616 | Ga0466723_145616_14813_15304 | 163 |
| 133 | 3300042620 | Ga0466728_179624 | Ga0466728_179624_21826_22317 | 163 |
| 134 | 3300042621 | Ga0466729_187605 | Ga0466729_187605_553_1044 | 163 |
| 135 | 3300042623 | Ga0466734_068026 | Ga0466734_068026_1208_1699 | 163 |
| 136 | 3300042636 | Ga0466703_099817 | Ga0466703_099817_4735_5226 | 163 |
| 137 | 3300042636 | Ga0466703_300663 | Ga0466703_300663_18144_18635 | 163 |
| 138 | 3300042643 | Ga0466704_619883 | Ga0466704_619883_4562_5053 | 163 |
| 139 | 3300042648 | Ga0466709_056114 | Ga0466709_056114_12146_12637 | 163 |
| 140 | 3300042648 | Ga0466709_380814 | Ga0466709_380814_5735_6226 | 163 |
| 141 | 3300042649 | Ga0466724_54317 | Ga0466724_54317_474_965 | 163 |
| 142 | 3300042654 | Ga0466725_074171 | Ga0466725_074171_5496_5987 | 163 |
| 143 | 3300042654 | Ga0466725_321139 | Ga0466725_321139_3015_3506 | 163 |
| 144 | 3300042655 | Ga0466727_217954 | Ga0466727_217954_5850_6341 | 163 |
| 145 | 3300042656 | Ga0466732_018800 | Ga0466732_018800_570_1061 | 163 |
| 146 | 3300042659 | Ga0466733_137485 | Ga0466733_137485_5499_5990 | 163 |
| 147 | iso_pr_bacteria | 2820089333 | 2820090788 | 163 |
| 148 | iso_pr_bacteria | 2820110010 | 2820110702 | 163 |
| 149 | iso_pr_bacteria | 2820121232 | 2820122552 | 163 |
| 150 | iso_pr_bacteria | 2820373881 | 2820374243 | 163 |
| 151 | iso_pr_bacteria | 2891720358 | 2891724531 | 163 |
| 152 | 3300002504 | JGI24705J35276_12209380 | JGI24705J35276_122093801 | 164 |
| 153 | 3300005083 | Ga0068305_10232389 | Ga0068305_1023238916 | 164 |
| 154 | 3300009784 | Ga0123357_10001212 | Ga0123357_1000121218 | 164 |
| 155 | 3300009784 | Ga0123357_10002811 | Ga0123357_1000281111 | 164 |
| 156 | 3300010049 | Ga0123356_10395044 | Ga0123356_103950442 | 164 |
| 157 | 3300010049 | Ga0123356_10395656 | Ga0123356_103956562 | 164 |
| 158 | 3300010167 | Ga0123353_10012748 | Ga0123353_1001274812 | 164 |
| 159 | 3300010167 | Ga0123353_11018344 | Ga0123353_110183442 | 164 |
| 160 | 3300010882 | Ga0123354_10135350 | Ga0123354_101353504 | 164 |
| 161 | 3300042599 | Ga0466706_037575 | Ga0466706_037575_81227_81721 | 164 |
| 162 | 3300042643 | Ga0466704_363778 | Ga0466704_363778_73248_73742 | 164 |
| 163 | 3300005083 | Ga0068305_10010337 | Ga0068305_100103375 | 165 |
| 164 | 3300042596 | Ga0466696_341062 | Ga0466696_341062_2739_3236 | 165 |
| 165 | 3300042602 | Ga0466713_148925 | Ga0466713_148925_74849_75346 | 165 |
| 166 | 3300042606 | Ga0466719_233762 | Ga0466719_233762_4585_5082 | 165 |
| 167 | 3300042612 | Ga0466705_463124 | Ga0466705_463124_195_692 | 165 |
| 168 | 3300042616 | Ga0466715_368032 | Ga0466715_368032_2214_2711 | 165 |
| 169 | 3300042618 | Ga0466723_344680 | Ga0466723_344680_290_787 | 165 |
| 170 | 3300042620 | Ga0466728_168858 | Ga0466728_168858_1847_2344 | 165 |
| 171 | 3300042636 | Ga0466703_058274 | Ga0466703_058274_10096_10593 | 165 |
| 172 | 3300042636 | Ga0466703_197391 | Ga0466703_197391_2867_3364 | 165 |
| 173 | 3300042659 | Ga0466733_073751 | Ga0466733_073751_1001_1498 | 165 |
| 174 | 3300005071 | Ga0068302_10052705 | Ga0068302_100527054 | 166 |
| 175 | 3300005083 | Ga0068305_10000168 | Ga0068305_10000168189 | 166 |
| 176 | 3300010167 | Ga0123353_11785142 | Ga0123353_117851422 | 166 |
| 177 | 3300038395 | Ga0415639_225647 | Ga0415639_225647_55_555 | 166 |
| 178 | 3300042594 | Ga0466694_302536 | Ga0466694_302536_396_896 | 166 |
| 179 | 3300042596 | Ga0466696_151642 | Ga0466696_151642_3809_4309 | 166 |
| 180 | 3300042601 | Ga0466707_140172 | Ga0466707_140172_2197_2697 | 166 |
| 181 | 3300042601 | Ga0466707_173160 | Ga0466707_173160_549_1049 | 166 |
| 182 | 3300042602 | Ga0466713_045730 | Ga0466713_045730_51369_51869 | 166 |
| 183 | 3300042602 | Ga0466713_051810 | Ga0466713_051810_502_1002 | 166 |
| 184 | 3300042604 | Ga0466717_180712 | Ga0466717_180712_305_805 | 166 |
| 185 | 3300042623 | Ga0466734_002244 | Ga0466734_002244_136_636 | 166 |
| 186 | iso_pr_bacteria | 2820234266 | 2820235257 | 166 |
| 187 | iso_pr_bacteria | 2820357977 | 2820359298 | 166 |
| 188 | 3300000062 | IMNBL1DRAFT_c0000002 | IMNBL1DRAFT_0000002335 | 167 |
| 189 | 3300002462 | JGI24702J35022_10074183 | JGI24702J35022_100741831 | 167 |
| 190 | 3300009784 | Ga0123357_10071358 | Ga0123357_100713584 | 167 |
| 191 | 3300010049 | Ga0123356_10006945 | Ga0123356_100069458 | 167 |
| 192 | 3300010049 | Ga0123356_10015463 | Ga0123356_100154636 | 167 |
| 193 | 3300010049 | Ga0123356_10020322 | Ga0123356_100203222 | 167 |
| 194 | 3300010049 | Ga0123356_10029039 | Ga0123356_100290395 | 167 |
| 195 | 3300010049 | Ga0123356_10041122 | Ga0123356_100411222 | 167 |
| 196 | 3300010049 | Ga0123356_12664189 | Ga0123356_126641892 | 167 |
| 197 | 3300010167 | Ga0123353_10098636 | Ga0123353_100986363 | 167 |
| 198 | 3300010167 | Ga0123353_10223470 | Ga0123353_102234702 | 167 |
| 199 | 3300010167 | Ga0123353_10273160 | Ga0123353_102731603 | 167 |
| 200 | 3300010167 | Ga0123353_10340876 | Ga0123353_103408762 | 167 |
| 201 | 3300010167 | Ga0123353_10557845 | Ga0123353_105578452 | 167 |
| 202 | 3300010167 | Ga0123353_10911179 | Ga0123353_109111792 | 167 |
| 203 | 3300042619 | Ga0466726_085163 | Ga0466726_085163_399_902 | 167 |
| 204 | 3300042649 | Ga0466724_42971 | Ga0466724_42971_878_1381 | 167 |
| 205 | iso_pr_bacteria | 2862075925 | 2862076685 | 167 |
| 206 | iso_pr_bacteria | 2864899338 | 2864900246 | 167 |
| 207 | iso_pr_bacteria | 8109397740 | 8109401568 | 167 |
| 208 | 3300010167 | Ga0123353_10203004 | Ga0123353_102030042 | 168 |
| 209 | 3300042602 | Ga0466713_134711 | Ga0466713_134711_2195_2701 | 168 |
| 210 | 3300042643 | Ga0466704_408371 | Ga0466704_408371_5766_6272 | 168 |
| 211 | 3300042652 | Ga0466708_077145 | Ga0466708_077145_33400_33906 | 168 |
| 212 | 3300056814 | Ga0562378_0051 | Ga0562378_0051_326983_327489 | 168 |
| 213 | 3300056842 | Ga0562377_1211 | Ga0562377_1211_2928_3434 | 168 |
| 214 | 3300056856 | Ga0562375_0029 | Ga0562375_0029_505864_506370 | 168 |
| 215 | 3300056856 | Ga0562375_0083 | Ga0562375_0083_146685_147191 | 168 |
| 216 | 3300056856 | Ga0562375_2614 | Ga0562375_2614_13426_13932 | 168 |
| 217 | 3300057007 | Ga0562374_0462 | Ga0562374_0462_54468_54974 | 168 |
| 218 | iso_pr_bacteria | 2820412446 | 2820412732 | 168 |
| 219 | 3300009826 | Ga0123355_10585307 | Ga0123355_105853072 | 169 |
| 220 | 3300010882 | Ga0123354_10005771 | Ga0123354_1000577111 | 169 |
| 221 | 3300012820 | Ga0160456_107853 | Ga0160456_1078532 | 169 |
| 222 | 3300012852 | Ga0160430_107904 | Ga0160430_1079042 | 169 |
| 223 | 3300042612 | Ga0466705_281125 | Ga0466705_281125_290_799 | 169 |
| 224 | 3300042624 | Ga0466735_128617 | Ga0466735_128617_384_893 | 169 |
| 225 | iso_pr_bacteria | 2837204985 | 2837205375 | 169 |
| 226 | 3300002501 | JGI24703J35330_11748630 | JGI24703J35330_1174863016 | 170 |
| 227 | 3300007153 | Ga0104050_1203095 | Ga0104050_12030951 | 170 |
| 228 | 3300012858 | Ga0160457_1011052 | Ga0160457_10110522 | 170 |
| 229 | 3300042593 | Ga0466691_004808 | Ga0466691_004808_2104_2616 | 170 |
| 230 | 3300042601 | Ga0466707_298598 | Ga0466707_298598_10210_10722 | 170 |
| 231 | 3300042599 | Ga0466706_167168 | Ga0466706_167168_239_754 | 171 |
| 232 | 3300042611 | Ga0466697_140221 | Ga0466697_140221_1139_1654 | 171 |
| 233 | 3300010049 | Ga0123356_10066920 | Ga0123356_100669201 | 172 |
| 234 | 3300010049 | Ga0123356_10473950 | Ga0123356_104739502 | 172 |
| 235 | 3300010049 | Ga0123356_10623349 | Ga0123356_106233492 | 172 |
| 236 | 3300042616 | Ga0466715_219573 | Ga0466715_219573_6042_6560 | 172 |
| 237 | 3300042616 | Ga0466715_519361 | Ga0466715_519361_834_1352 | 172 |
| 238 | 3300042621 | Ga0466729_191344 | Ga0466729_191344_376_894 | 172 |
| 239 | 3300042636 | Ga0466703_250320 | Ga0466703_250320_477871_478389 | 172 |
| 240 | 3300012848 | Ga0160443_100018 | Ga0160443_100018146 | 173 |
| 241 | 3300042596 | Ga0466696_478070 | Ga0466696_478070_4513_5034 | 173 |
| 242 | 3300042606 | Ga0466719_349854 | Ga0466719_349854_19012_19533 | 173 |
| 243 | 3300042620 | Ga0466728_371669 | Ga0466728_371669_134_655 | 173 |
| 244 | 3300042625 | Ga0466730_087152 | Ga0466730_087152_2472_2993 | 173 |
| 245 | iso_pr_bacteria | 2820922474 | 2820923282 | 173 |
| 246 | 3300010049 | Ga0123356_10000416 | Ga0123356_100004167 | 174 |
| 247 | iso_pr_bacteria | 2518645556 | 2518832239 | 174 |
| 248 | iso_pr_bacteria | 2820814774 | 2820816550 | 174 |
| 249 | iso_pr_bacteria | 2888667245 | 2888668350 | 174 |
| 250 | 3300010049 | Ga0123356_10004461 | Ga0123356_100044614 | 175 |
| 251 | 3300042643 | Ga0466704_374867 | Ga0466704_374867_766_1293 | 175 |
| 252 | 3300042601 | Ga0466707_149726 | Ga0466707_149726_4102_4632 | 176 |
| 253 | 3300010167 | Ga0123353_10279427 | Ga0123353_102794272 | 177 |
| 254 | 3300042600 | Ga0466700_011552 | Ga0466700_011552_24_557 | 177 |
| 255 | 3300042618 | Ga0466723_155978 | Ga0466723_155978_1219_1752 | 177 |
| 256 | iso_pr_bacteria | 2820387566 | 2820388364 | 178 |
| 257 | 3300010167 | Ga0123353_10678812 | Ga0123353_106788122 | 179 |
| 258 | 3300042617 | Ga0466718_034656 | Ga0466718_034656_121_660 | 179 |
| 259 | 3300042636 | Ga0466703_199385 | Ga0466703_199385_12499_13038 | 179 |
| 260 | 3300010049 | Ga0123356_10266470 | Ga0123356_102664702 | 180 |
| 261 | 3300042609 | Ga0466722_243021 | Ga0466722_243021_429_971 | 180 |
| 262 | 3300010049 | Ga0123356_10039259 | Ga0123356_100392594 | 181 |
| 263 | 3300042616 | Ga0466715_001270 | Ga0466715_001270_799_1356 | 185 |
| 264 | 3300042643 | Ga0466704_468556 | Ga0466704_468556_1843_2433 | 188 |
| 265 | 3300042596 | Ga0466696_071885 | Ga0466696_071885_4150_4725 | 191 |
| 266 | 3300042643 | Ga0466704_509301 | Ga0466704_509301_453_1028 | 191 |
| 267 | 3300042601 | Ga0466707_321644 | Ga0466707_321644_337_957 | 206 |
| 268 | 3300042624 | Ga0466735_034700 | Ga0466735_034700_5542_6162 | 206 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.78 | 0.84 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.